FCC Web Documents citing 4.1
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.pdf  
- Kent to Melanie Godschall, Investigations and Hearings Division, Enforcement Bureau, Federal Communications Commission, dated July 6, 2006. See Thompson Response at 5-6; Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-3861A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-3861A1.pdf  
- of hours in dispute and the hourly rates provided by Irving. See Irving PRM, App. 125 at 578. We do not discuss the remaining $58,050.61 in costs in the following categories comprising a PFA: System and Subscriber Unit Inventory or Legal. . See Id. See Irving PRM, App. 10 at 144-45 (aggregating the hours and cost estimates for Tasks 1.6.3, 4.1, 4.4, 4.5, and 4.8). See Irving PRM at 6. See Irving SOP at 5. Id. Id. at 6. Id. at 7. Id. at 11. Sprint PRM at 4. Id. See Sprint SOP at 11. Sprint PRM at 4. RR at 14-16. Id. at 14. Id. at 15. State of Maryland and Sprint Nextel, Memorandum Opinion and Order, WT Docket No. 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-4721A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-4721A1.pdf  
- that statement is unsupported by specific facts or analysis, and is undermined by the evidence of some boxing on NPTC's poles. Accordingly, we direct NPTC, within 60 days, to revise the Pole Attachment Agreement to eliminate this discriminatory provision. The Pole Attachment Agreement Unreasonably Requires Salsgiver to Incur Make-Ready Costs With No Assurance That Those Costs Will Be Reasonable. Section 4.1.3 of the Agreement provides that Salsgiver's submission of a pole attachment application is deemed to constitute Salsgiver's agreement to pay for the cost of the Make-Ready survey. Under the Agreement, NPTC is not required to provide, nor is Salsgiver apparently permitted to demand, an estimate of those costs before Salsgiver is deemed to have agreed to pay them. We find 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-5051A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-07-5051A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-2318A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-2318A1.pdf  
- the development of coordinated regional plans, and developed a Regional Planning Guidebook. Following the sunset of the NCC's charter on July 25, 2003, the National Public Safety Telecommunications Council (NPSTC) agreed to continue to provide assistance to regional planners. A copy of the 700 MHz Regional Planning Guidebook is available at the NPSTC website at http://www.npstc.org/documents.html. See Revised Plan Section 4.1 Convening of the RPC at 9. See Revised Plan Appendix J - Current List of Executive Committee Officers at 98. See Revised Plan Appendix A - Bylaws at 38-42. See Revised Plan Appendix E - Meeting Minutes at 66-67 (June 4, 2003). See Revised Plan, Section 4 - Notification Process at 9-10 (describing outreach methods - RPC master email distribution 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-711A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-08-711A1.pdf  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Thomas J. Sugrue Vice President, Government Affairs T-Mobile USA, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111 and 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Kathleen O'Brien Ham, T-Mobile USA, Inc. (Aug. 6, 2007). Id. Letter from David H. Solomon, Esq., Wilkinson Barker Knauer, LLP, to Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau (Sept. 5, 2007). Under this provision, 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1053A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1053A1.pdf  
- may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Michael D. Rhoda Senior Vice President Windstream Corporation ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 26, 2007); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 7, 2008). Letter 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1319A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1319A1.pdf  
- 4.11. See 47 CFR Part 4. The Commission requires providers of wireline, wireless, cable circuit-switched telephony, satellite, paging and Signaling System 7 communications services to submit outage reports regarding disruptions to communication. The FCC's Public Safety & Homeland Security Bureau Launches Disaster Information Reporting System (DIRS), Public Notice, DA 07-3871, 22 FCC Rcd 16757 (PSHSB 2007). See 47 CFR §§ 4.1, et seq. 47 C.F.R. § 1.3. This rule provides that ``[a]ny provision of the rules may be waived by the Commission on its own motion or on petition if good cause therefor is shown.'' Id. PSHSB staff typically sends an email to the DIRS participants announcing the de-activation of DIRS for that event. Subsequently, PSHSB issues a public notice announcing 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1825A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-1825A1.pdf  
- Amendment). See Non-Streamlined Plan Amendment, Attachment B - Region 6 Table of Channels (listing all existing licensees and available channels). See Letter from Art McDole, Chair, Region 6 (Northern California) NPSPAC Regional Planning Committee, to Federal Communications Commission, Gen. Docket No. 90-287 at 1-2 (summarizing modifications to the Region 6 Plan) (filed April 22, 2009). See Non-Streamlined Plan Amendment, Section 4.1.1 Licensing Procedures at 11-12. See Non-Streamlined Plan Amendment, Section 4.3 - Interoperability Channels and Usage Covered by This Plan at 13 (all channels are used primarily for coordination of activities between agencies in mutual aid, or emergencies requiring interoperability); see also, Non-Streamlined Plan Amendment, Section 4.3.2 - Implementation Plan at 14 (requiring eligible users in each county to develop an 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2035A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2035A1.pdf  
- not imply that counties have ownership of the frequencies in the pre-allotment sort. Channels are available to all eligible Region 33 public safety entities on a first-come, first-served basis and will be allotted channels if Plan requirements are met. See Plan, Section 5 - Procedures for Frequency Coordination (addressing process, licensee responsibilities and technical requirements) at 23-24. See Plan, Section 4.1 - Processing and Evaluating Applications at 21-22 (listing application requirements); see also, Plan, Appendix K - Evaluation Matrix Point System at 119-122. See Plan, Section 3.11 - Design and Engineering Responsibilities at 16-17; see also Plan, Section 3.13 - Implementation of Channels at 18. See Plan, Section 3.14 - Interoperability Channels; see also Plan, Appendix J - Table of Interoperability 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2219A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-2219A1.pdf  
- Amendment). See Non-Streamlined Plan Amendment, Attachment B - Region 6 Table of Channels (listing all existing licensees and available channels). See Letter from Art McDole, Chair, Region 6 (Northern California) NPSPAC Regional Planning Committee, to Federal Communications Commission, Gen. Docket No. 90-287 at 1-2 (summarizing modifications to the Region 6 Plan) (filed April 22, 2009). See Non-Streamlined Plan Amendment, Section 4.1.1 Licensing Procedures at 11-12. See Non-Streamlined Plan Amendment, Section 4.3 - Interoperability Channels and Usage Covered by This Plan at 13 (all channels are used primarily for coordination of activities between agencies in mutual aid, or emergencies requiring interoperability); see also, Non-Streamlined Plan Amendment, Section 4.3.2 - Implementation Plan at 14 (requiring eligible users in each county to develop an 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.pdf  
- May 19, 2003). See Revised Plan, Appendix B - Region 9 Members, Agencies, Contact Information and Voting Status at 22-25. See Revised Plan, Section 4 - Notification Process at 5. See Revised Plan, Appendix D - List of Meetings, Summaries of Minutes, and Agenda at 27-42 (seven meetings held over the course of a six-year period). See Revised Plan, Section 4.1.a Procedure for Requesting Spectrum Allocations at 6; see also Revised Plan, Section 4.3 Allocation of Narrowband ``General Use'' Spectrum (narrowband pool allotments have a channel bandwidth of 25 kHz to provide flexibility to accommodate multiple technologies using multiple bandwidths). See Revised Plan, Section 4.2 Procedure for Frequency Coordination at 8. See Revised Plan, Section 5.0 System Design/Efficiency Requirements (interference protections 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1245A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-1245A1.pdf  
- People with Disabilities: To request materials in accessible formats for people with disabilities (Braille, large print, electronic files, audio format), send an e-mail to fcc504@fcc.gov or call the Consumer and Governmental Affairs Bureau at (202) 418-0530, (202) 418-0432 (TTY). For further information about this Public Notice, please contact Jeffery Goldthorp at (202) 418-1096. - FCC - See 47 C.F.R. §§ 4.1-4.13. In 1992, the Commission established network outage reporting requirements for wireline providers. Notification by Common Carriers of Service Disruptions, Report and Order, CC Docket No. 91-273, 7 FCC Rcd 2010 (1992); see also Memorandum Opinion and Order and Further Notice of Proposed Rulemaking, CC Docket No 91-273, 8 FCC Rcd 8517 (1993); Second Report and Order, CC Docket No. 91-2739, 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2181A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2181A1.pdf  
- Decree may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date ____________________________ Lohn Weber Chief Financial Officer Norlight, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(f). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. (November 18, 2009). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2303A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-2303A1.pdf  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Steve Nocella Senior Vice President Network Services XO Communications, LLC ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Heather Burnett Gold, Senior Vice President, External Affairs, XO Communications (May 21, 2010) (``LOI''). See LOI. E-mail from Todd D. Daubert, Esq., Sonnenschein Nath & Rosenthal, LLP to Kevin M. Pittman, Esq., Spectrum Enforcement Division, Enforcement Bureau 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-237A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-237A1.pdf  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Bureau Chief Enforcement Bureau ____________________________ Date ____________________________ Scott W. McCloud Vice President-Wireless Networks Bluegrass Cellular, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Ronald R. Smith, President, Bluegrass Cellular, Inc. (July 14, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Scott W. McCloud, Vice President, Wireless Networks, Bluegrass Cellular, Inc. 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-238A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-10-238A1.pdf  
- number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ William L. Roughton, Jr. Vice President, Legal and Regulatory Affairs Centennial Communications Corporation ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to Tony L. Wolk, Senior Vice President, General Counsel and Secretary, Centennial Corporation (August 15, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to William L. Roughton, Jr., 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-1362A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-1362A1.pdf  
- of which counterparts together shall constitute one and the same fully executed instrument. ________________________________ P. Michele Ellison Chief Enforcement Bureau ________________________________ Date ________________________________ Stephen W. Crawford General Counsel and Senior Vice President, Mergers and Acquisitions Alpheus Communications, L.P. ________________________________ Date Alpheus Communications, L.P., Notice of Apparent Liability for Forfeiture, 25 FCC Rcd 8993 (Enf. Bur. 2010) (``NAL''). 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i), 503(b). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(f). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Stephen W. Crawford, Esq., General Counsel and Senior Vice President, Alpheus Communications, LP (September 10, 2009) (``LOI''). ``User minutes'' are defined as ``assigned telephone number minutes ... for telephony and for 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-402A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-402A1.pdf  
- and the same fully executed instrument. For the Enforcement Bureau: ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date AT&T: By: ____________________________ Paul Mancini Senior VP & Assistant General Counsel AT&T Services, Inc. 1120 20th Street, N.W. Suite 1000 Washington, DC 20036 ____________________________ Date 47 C.F.R. § 4.9. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. §§ 4.1 et seq. 47 C.F.R. § 4.9. Id. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Jacquelyne Flemming, Executive Director Counsel, AT&T Services, Inc. (July 18, 2007). Letter from Peter H. Jacoby , General Counsel, AT&T Services, Inc., to Kathy Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission (August 24, 2007). Letter 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-816A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-816A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, sections 17.4.1, 17.4.1.1, 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Table 1 and Note 2. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1307(b)(5); Guidelines, Second Memorandum Opinion and Order and Notice of Proposed Rulemaking, 12 FCC Rcd at 13538, 13540. See also, Public 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-944A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-944A1.pdf  
- the costs for testing portable radios. It argues that Sprint has failed to explain why it will pay for the testing of mobile, but not portable, radios. Broward also disputes the TA Mediator's contention that the FRA does not include costs for testing either mobile or portable radios. Thus, it points to the following line item in Schedule C, Section 4.1 of the FRA: Retune Existing Mobile Radios - • Functional Pre-Test of existing radio - Talk group call on system • Retune existing radio (no obstruction to retuning of radio) • Functional post test of existing radio - Talk group call on system (691 units @ 0.70 hrs each @ $118.00 /hr = $57,076.60). Broward notes that Schedule C of 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-968A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/DA-11-968A1.pdf  
- be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Roger D. Linquist President and CEO MetroPCS California, LLC ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Mark A. Stachiw, Executive Vice President Metro PCS Communications, Inc. (``LOI'') 47 C.F.R. § 4.9(e). 47 C.F.R. § 4.5(b). See LOI. See Letter from J. Christopher Luna, Staff Vice 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DOC-275666A1.pdf  
- to Determine Minimum DTV Signal Detection Threshold.....................................12 3.2.1 Baseline Detection Threshold Tests (Single DTV Input Signal)..........................................12 3.2.2 Multiple-Signal Detection Threshold Tests (Two DTV Input Signal).................................15 3.3 Field Tests with Over-the-Air Signals.......................................................................................18 3.3.1 Field Test Site 1....................................................................................................................20 3.3.2 Field Test Site 2....................................................................................................................25 3.3.3 Field Test Site 3....................................................................................................................29 3.3.4 Field Test Site 4....................................................................................................................33 3.4 Field Test Summary...................................................................................................................37 4 Transmitter Emissions Characterization Measurements..............................................................39 4.1 Transmitter Description............................................................................................................39 4.2 Measurement Approach.............................................................................................................39 4.3 Measurement Equipment Configuration...................................................................................40 4.4 Channel Consistency Test..........................................................................................................42 4.5 Fundamental Channel Emissions Measurements......................................................................44 4.6 Out-of-Channel Emissions Measurements................................................................................46 4.7 Emissions Characterization Data Summary..............................................................................47 5 Over-The-Air Interference Test.......................................................................................................49 5.1 Test Approach...........................................................................................................................49 5.2 Test System................................................................................................................................51 5.3 Test Procedure..........................................................................................................................54 5.4 Test Results................................................................................................................................54 iii 6 Data Observations Relevant to TV Services...................................................................................56 6.1 Scanning/Spectrum Sensing Capability Tests............................................................................56 6.1.1 Prototype A Results..............................................................................................................56 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.pdf  
- Service................................................................11 3.5 RECOMMENDATIONS FOR IMPLEMENTING REGIONAL PSAPS.............................................................................12 3.5.1 Criteria for Determining Proposed Regional PSAPs in Oklahoma...................................................12 3.5.2 PSAP Regionalization Example: South West Oklahoma Regional 9- 1-1 Association.....................13 3.5.3 Proposed Regi onal PSAPs........................................................................................................ ......16 3.5.4 Regional PSAPs Map............................................................................................................. .........20 3.5.5 Oklahoma E9-1-1 Implement ation/Upgrade Summary....................................................................21 3.5.6 High-Level Tasks for Regionalizing and Im plementing E9-1-1........................................................29 4. OTHER E9-1-1 ISSUES AND RECOMMENDATIONS........................................................................................ 31 4.1 E9-1-1 AND THE AMERICANS WITH DISABILITIES ACT (ADA)..............................................................................31 4.2 E9-1-1 AND MULTI-LINE TELEPHONE SYSTEMS (MLTS)....................................................................................31 4.3 E9-1-1 AND THE OKLAHOMA HIGHWAY PATROL FIELD TROOP COMMUNICATION CENTERS.................................33 4.4 E9-1-1 IN RELATION TO DEPARTMENT OF HOMELAND SECURITY PROGRAMS .....................................................34 4.4.1 Radio Intero perability......................................................................................................... ..............34 4.4.2 Next Generation 9-1-1 (NG9-1-1)....................................................................................................34 4.4.3 Evolution to a Next Generation 9-1-1 Syst em.................................................................................35 4.4.4 Next Generation 9-1-1 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-00-160A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-00-160A1.pdf  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-00-160A1.txt  
- supra, for a description of ARINC. FAA Revised Petition refers to a broadcast mode of delivery for FIS known as ``Flight Information Services-Broadcast (FIS-B),'' a concept currently under development. With FIS-B, an on-board server will be responsible for personalizing products to pilot's needs. See Aeronautical Spectrum Planning for 1997-2010, Doc. No. RTCA/DO-210 January 27, 1997, published by RTCA, Inc., Section 4.1.2.3. For this Notice, we will use the term FIS that appears to encompass FIS-B. We seek comments on the use of these terms. See para. 12 and note 73, infra. The FAA states that the original petition remains valid except as amended in its revision. FAA Revised Petition at 1. The FAA proposes a 25 kHz channeling plan for the 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.pdf  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries were not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1. The United States has not adopted 8.33 kHz spacing. See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-124A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-07-124A1.pdf  
- superseded by such Commission rule or order. This Consent Decree cannot be modified without the advance written consent of both Parties. This Consent Decree may be signed in counterparts. For the Federal Communications Commission: ____________________________ Marlene H. Dortch Secretary ____________________________ Date For Verizon: ____________________________ Michael D. Poling Senior Vice President -- National Operations and Support ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). Under this provision, Verizon will not be required to provide outage reporting compliance training to employees whose responsibilities do not include gathering, analysis, or data entry of information regarding Verizon's network outages or compiling Verizon's outage reports, or whose involvement in Verizon's outage reporting activities is limited to performing job functions that are not 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.pdf  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.txt  
- the D Block spectrum and then randomly allocate the spectrum to users in incremental amounts. Accordingly, with such technology this requirement could be characterized as ensuring that public safety has assured access to 50 percent of the engineered RAN capacity. See Network Reliability and Interoperability Council Wireless Network Reliability Final Report, September 2005 at http://www.nric.org/meetings/docs/meeting_20051019/NRICVII_FG3A_FinalRep ort_September_2005.pdf. See 47 C.F.R. §§ 4.1-4.2, 4.3(f), 4.5, 4.7, 4.9(e), 4.11, 4.13. See also New Part 4 of the Commission's Rules Concerning Disruptions to Communications, Report and Order and Further Notice of Proposed Rulemaking, ET Docket No. 04-35, 19 FCC Rcd 16830, 16882-16890 ¶¶ 97-114 (2004). By ``critical network elements,'' we mean to refer to those network elements that would require geographic redundancy and mesh connectivity 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-09-27A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-09-27A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm.2 47 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.pdf  
- local entities. Homeland Security Policy Directive 8 (Dec. 17, 2003), replaced by Presidential Policy Directive 8 on March 30, 2011. See supra note 8. (last visited May 9, 2011). (last visited April 12, 2011). See Network Reliability Steering Committee 2008-2009 Biennial Report (Apr. 2010), http://www.atis.org/nrsc/Docs/ATIS-0100029%20-%20NRSC%20Biennial%20Repor t.pdf (last visited May 9, 2011). (last visited May 9, 2011). See 47 C.F.R. §§ 4.1-4.13. In 1992, the Commission established network outage reporting requirements for wireline providers. Notification by Common Carriers of Service Disruptions, Report and Order, CC Docket No. 91-273, 7 FCC Rcd 2010 (1992) (1992 Part 4 Report and Order); see also Memorandum Opinion and Order and Further Notice of Proposed Rulemaking, 8 FCC Rcd 8517 (1993); Second Report and Order, FCC Rcd 
 
- http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-82A1.doc  http://fjallfoss.fcc.gov/edocs_public/attachmatch/FCC-11-82A1.pdf  
- for example, observed that ``IP based systems are . . . in . . . 18 states (plus the District of Columbia), of which at least 10 are already originating and disseminating CAP messages for EAS, and the remainder appear to have near-term plans to begin introducing CAP message origination and dissemination within their state systems.'' CSRIC Final Report, § 4.1.2. CSRIC further observed that ``[w]here advanced EAS capabilities have not yet been deployed, emergency managers continue to utilize EAS in traditional manners.'' Id. . . See Second Report and Order, 22 FCC Rcd 13275, 13291, para. 32. See id. See id. Id. See 47 C.F.R. § 11.56. Timm Reply Comments at 2-3. Id. at 3. Id. SpectraRep Comments at 3. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1321A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1321A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1321A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1476A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1476A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-1476A1.txt  
- §§2.7 &2.8 New Agreement §2.6. Old Agreement,§2.9; New Agreement §1. Old Agreement, Specifications, Item 7; New Agreement, §2.9 & Specifications, Item 7. Old Agreement §2.10; New Agreement §2.10. Old Agreement §3.10; New Agreement §3.12. Old Agreement §3.6; New Agreement §3.8. Old Agreement §3.7; New Agreement §3.9(a). Old Agreement §6.7. New Agreement §2.11(a). New Agreement §2.11(b). New Agreement §4.3. New Agreement §4.1(b). Response at Attachment 1. Complaint at Exhibit 3. Id. The major discrepancy is on Invoice 03387 wherein Respondent charges for 1,980 allegedly unauthorized attachments in Littleton, but not 211 in Cherry Hills Village, 1,089 in Englewood, 9 in Greenwood Village, and 407 in Sheridan. Complaint at Exhibit 3. There are minor discrepancies on Invoices 03383 (difference of 17 poles), and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-660A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-660A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-00-660A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1247A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1247A1.txt  
- AM P 070-05-51.0 W 0000410007 National Grid USA Service Company, Inc.Nantucket 04/03/2001 00956.39375 41-16-13.0 N RI AM WNTU572 P 071-28-29.6 W 0000410010 National Grid USA Service Company, Inc.WARWICK 04/03/2001 00952.61875 41-40-56.7 N MA AM WNTR639 P 071-21-13.7 W 0000410068 National Grid USA Service Company, Inc.WALPOLE 04/03/2001 00952.49375 42-06-34.8 N OH AM WNTW907 081-41-39.4 W 0000410524 WKYC-TV, Inc. Cleveland 04/03/2001 23425.00000 41-30-04.1 N OH AM WNTW907 081-41-39.4 W 0000410524 WKYC-TV, Inc. Cleveland 04/03/2001 23575.00000 41-30-04.1 N OH AM WNTW907 081-41-39.4 W 0000410524 WKYC-TV, Inc. Cleveland 04/03/2001 23575.00000 41-30-04.1 N WY AM WPOL571 110-01-52.6 W 0000411392 CENTRAL WYOMING COLLEGE/PUBLIC TELEVISION Dubois 04/05/2001 06545.00000 43-40-16.8 N WY AM WPOL571 110-01-52.6 W 0000411392 CENTRAL WYOMING COLLEGE/PUBLIC TELEVISION Dubois 04/05/2001 06625.00000 43-40-16.8 N WY AM WPOL571 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1496A1.txt  
- 4.13 COE Exchange Circuit Equip - Jointly Used N/A N/A N/A N/A N/A 1276 % LOOP ALLOC. FACTOR N/A N/A N/A N/A N/A 1277 Total Category 4.13 COE Exchange Circuit Equip N/A N/A N/A N/A N/A 1280 Special Category 4.13 COE Exchange Circuit Equip N/A N/A N/A N/A N/A 1290 Total Category 4.13 COE N/A N/A N/A 1300 Total Category 4.1 COE Exchange Line Circuit Equipment N/A 1310 Category 4.21 COE Furnished to Another Co. N/A N/A N/A N/A N/A 1320 Category 4.22 COE IX Circuit Equipment (WDBD) - Pvt. Line N/A N/A N/A N/A N/A 1322 Category 4.22 COE IX Circuit Equipment (WDBD) - Joint. Use N/A N/A N/A N/A N/A 1323 # Conversation Minutes Kilometers Factor N/A N/A N/A 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1613A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1613A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1613A1.txt  
- Communications (AT&T or Applicant), located at 55 Corporate Drive, Bridgewater, NJ 08807, filed an application requesting authority under section 214(a) of the Communications Act of 1934, 47 U.S.C. § 214(a), and section 63.71 of the Federal Communications Commission's (FCC or Commission) rules, 47 C.F.R. § 63.71, to discontinue AT&T Sent-Paid Coin Service (Service). The Service is referenced in sections 3.8.6, 4.1.1, 5.1, and 24.1 of AT&T Tariff FCC No. 27. Specifically, AT&T states that it seeks to withdraw the Service from ``dumb'' coin telephones that require network signaling to handle coin-related functions. On June 18, 2001, AT&T filed a supplement to its application containing more specific information about the proposed discontinuance. The application indicates that AT&T seeks to withdraw the Service 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1870A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1870A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-1870A1.txt  
- Communications (AT&T or Applicant), located at 55 Corporate Drive, Bridgewater, NJ 08807, filed an application requesting authority under section 214(a) of the Communications Act of 1934, 47 U.S.C. § 214(a), and section 63.71 of the Federal Communications Commission's (FCC or Commission) rules, 47 C.F.R. § 63.71, to discontinue AT&T Sent-Paid Coin Service (Service). The Service is referenced in sections 3.8.6, 4.1.1, 5.1, and 24.1 of AT&T Tariff FCC No. 27. Specifically, AT&T states that it seeks to withdraw the Service from ``dumb'' coin telephones that require network signaling to handle coin-related functions. On June 18, 2001, AT&T filed a supplement to its application containing more specific information about the proposed discontinuance. The application, as supplemented, states that AT&T seeks to discontinue 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2168A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2168A1.txt  
- relative powers are also provided in Table II. Example 1 A land mobile transmitter, with any value of necessary bandwidth, must meet a spurious domain emission attenuation of 43 + 10 log (P), or 70 dBc, whichever is less stringent. To measure spurious domain emissions in the frequency range between 30 MHz and 1 GHz, Recommendation ITU-R SM.329-7 8 recommends 4.1 indicates the use of a reference bandwidth of 100 kHz. For other frequency ranges, the measurement must use the appropriate reference bandwidths given in recommends 4.1. With a measured total mean power of 10 W: Attenuation relative to total mean power = 43 + 10 log (10) = 53 dBc. The 53 dBc value is less stringent than the 70 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2210A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2210A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2210A1.txt  
- Petitioner: Flagler Broadcasting c/o A. Wray Fitch, III Gammon & Grange, P.C. 8280 Greensboro Drive, 7th Floor McLean, Virginia 22102-3807 . Proposal: Allot Channel 283C3 at Flagler, Colorado, as that community's first local aural transmission service. Community Present Proposed Flagler, Colorado --------- 283C3 Coordinates: 39-17-17 NL and 103-08-32 WL Additional Information: This allotment requires a site restriction of 6.5 kilometers (4.1 miles) west of Flagler, Colorado. FCC Contact: R. Barthen Gorman (202) 418-2180 C. MM Docket No. 01-252; RM-10221 Petitioner: Charles Crawford 4553 Bordeaux Ave. Dallas, Texas 75205 Proposal: Allot Channel 223A to Moberly, Missouri, as that community's sixth local aural transmission service. Community Present Proposed Moberly, Missouri 247C3, 284C, 288C2 247C3, 284C, 288C2, 223A Coordinates: 39-25-06 NL and 92-26-17 WL. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2251A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2251A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2251A1.txt  
- D. MM Docket No. 01-266, RM-10283 Petitioner: Jeraldine Anderson 1702 Cypress Drive Irving, Texas 75061 Proposal: Allot Channel 226C2 at Aspermont, Texas, as the community's first local aural transmission service. Channel Community Present Proposed Aspermont, Texas ---- 226C2 Coordinates: 33-11-27 NL and 100-14-50 WL Additional Information: Channel 226C2 can be allotted at Aspermont with a site restriction of 6.7 kilometers (4.1 miles). In support of the allotment, petitioner states that Aspermont has the indicia of a community for allotment purposes. It states that it is an incorporated city, the county seat of Stonewall County, has a population exceeding 1000 persons. It has a mayor, volunteer fire department, post office, school district and churches. We seek additional information on the community status 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2375A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2375A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2375A1.txt  
- customer hardship. Accordingly, by this public notice, Applicant's request to discontinue providing its sent-paid coin service in accordance with the terms of its proposed final transition plan is granted. The terms of this transition plan, attached hereto, are incorporated by reference. . -FEDERAL COMMUNICATIONS COMMISSION- 47 U.S.C. § 214(a). 47 C.F.R. § 63.71. The Service is referenced in sections 3.8.6, 4.1.1, 5.1, and 24.1 of AT&T Tariff FCC No. 27. According to AT&T, it seeks to retire network-controlled coin calling from ``dumb'' coin phones that require Feature Group C-based network signaling to: (a) determine the rates for a dialed call; (b) track the deposit of coins into the phone; (c) time the call to require deposit of additional coins for additional 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2732A1.txt  
- with U.S. federal and state law or regulations. 3.8 Access to Classified or Sensitive Information: Nothing contained in this Agreement or Implementation Plan shall limit or affect the authority of a Government Authority within the United States to grant, deny, modify or revoke MSV's access to Classified and Sensitive Information under that agency's jurisdiction. ARTICLE IV AUDITING, REPORTING AND NOTICE 4.1 Notice of Obligations: MSV shall instruct appropriate officials, employees, contractors and agents as to their obligations under this Agreement and Implementation Plan (including the reporting requirements under Section(s) 3.3, 3.4, 3.5, 3.6, 4.2, 4.3, 4.4, 4.5, 4.9, and 4.10 of this Agreement) and issue periodic reminders to them of such obligations. 4.2 Reporting of Incidents: MSV shall take all practicable 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2764A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2764A1.txt  
- allocation has not proven to be useful since it was established in 1992. Also, there are no demonstrated spectrum requirements for MSS systems, which necessitate the continuance of an MSS allocation to Region 2 in this band. 15 Appendix S5 ANNEX 1 USA/ /6 MOD TABLE S5-2 NOTE 4 Exceptions for the band 1 492-1 525 MHz are as follows: 4.1 For the land mobile service on the territory of Japan (No. S5.348A): 150 dB(W/m2) in 4 kHz at all angles of arrival is applicable to all satellite space-to-Earth emissions. 4.2 For the aeronautical mobile service for telemetry (No. S5.343), the requirement for coordination is determined by frequency overlap (No. S5.348). Reasons: Consequential changes due to the deletion of the MSS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-2854A1.txt  
- - The definition of this row is revised to read: ``Total Category 4.13 Exchange Line Circuit Equipment, total of Rows 1277 and 1280, including Category 4.13 COE that is directly assigned pursuant to Section 36.126(c)(4), Section 69.306(e), and the Part 69 Reconsideration Order, at para. 48.'' Row 1300 - The definition of this row is revised to read: ``Total Category 4.1 Exchange Circuit Equipment, total of Rows 1224, 1260, and 1290.'' Row 1310 - The definition of this row is revised to read: ``Category 4.21 Interexchange Circuit Equipment Furnished to Another Company for Interstate Use that is directly assigned pursuant to Section 36.126(e)(4), Section 69.306(e), and the Part 69 Reconsideration Order, at para. 48.'' Row 1320 - The definition of this 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-3008A1.txt  
- terminals shall employ an algorithm that is resistant to capturing and tracking adjacent satellite signals, and each terminal shall be capable of inhibiting its own transmission in the event it detects unintended satellite tracking; 3) AMSS mobile terminals are monitored and controlled by a ground-based Network Control and Monitoring Center (``NCMC'') or equivalent facility; 4) each AMSS mobile terminal shall: 4.1.) be able to receive at least ``enable transmission'' and ``disable transmission'' commands from the NCMC; 4.2.) cease transmissions after receiving any ``parameter change'' command, which may cause harmful interference to other satellite systems during the change, until it receives an ``enable transmission'' command from its NCMC; and 4.3.) be monitored by the NCMC to determine if its operation is malfunctioning; 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A1.txt  
- not specify different D/U ratio values based upon whether the incumbent licensee is operating an analog or digital system. Therefore, for purposes of this study the required 45 dB D/U ratio was used for the co-channel analysis. For the adjacent channel analysis, FCC rules specify that a D/U ratio of 0 dB be maintained. Tables 4-A and 4-B in Appendix 4.1 summarize the pertinent provisions of the FCC rules for ITFS/MDS response stations and ITFS/MDS main stations. The analysis assumed two operating scenarios for 3G base stations based on the five IMT-2000 radio interface standards, one operating with high power - 500 watts EIRP (27 dBW), and one operating with low power - 10 watts EIRP (10 dBW). The analysis of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-01-786A2.txt  
- not specify different D/U ratio values based upon whether the incumbent licensee is operating an analog or digital system. Therefore, for purposes of this study the required 45 dB D/U ratio was used for the co-channel analysis. For the adjacent channel analysis, FCC rules specify that a D/U ratio of 0 dB be maintained. Tables 4-A and 4-B in Appendix 4.1 summarize the pertinent provisions of the FCC rules for ITFS/MDS response stations and ITFS/MDS main stations. The analysis assumed two operating scenarios for 3G base stations based on the five IMT-2000 radio interface standards, one operating with high power - 500 watts EIRP (27 dBW), and one operating with low power - 10 watts EIRP (10 dBW). The analysis of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-101A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-101A1.txt  
- Allocations at 1492 - 1525 MHz in Region 2. 17 USA/ /5 SUP S5.348A Reason: Consequential to the deletion of the Mobile-Satellite Service from the Table of Frequency Allocations at 1492 - 1525 MHz in Region 2. USA/ /6 MOD Appendix S5 ANNEX 1 TABLE S5-2 NOTE 4  Exceptions for the band 1 492-1 525 MHz are as follows: 4.1 For the land mobile service on the territory of Japan (No. S5.348A):  150 dB(W/m2) in 4 kHz at all angles of arrival is applicable to all satellite space-to-Earth emissions. 4.2 For the aeronautical mobile service for telemetry (No. S5.343), the requirement for coordination is determined by frequency overlap (No. S5.348). NOCNOTE 5 Reason: Consequential changes due to the deletion 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-106A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-106A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-106A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-108A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-108A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-108A1.txt  
- place or will be in place to provide service within 60 days are contracts for unbundled network elements, network information indicating equipment has been purchased and is operational or will be operational, business plans or interconnection agreements. 48 Obtain the last two initial numbering applications from the company and document that the applicant has met the requirements outlined in Section 4.1.1 through 4.1.4 in the Central Office Code Assignment guidelines. 49 Check the above documentation against the information received from NANPA. Note any discrepancies and inquire of the company for explanation(s). Note the exception(s) and the company's response(s). 50 Application for Numbering Resources (Growth) 51 Obtain from NANPA the last two growth numbering applications that the company has filed with NANPA. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1269A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1269A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1269A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1412A2.txt  
- assigned, reserved or otherwise unavailable for assignment Total Available(The total number of codes available for assignment (i.e., vacant codes). These reports shall be provided on the NANPA web site. Summary of NANPA Technical Reports . Summary of Technical Reports Name Reference Media Periodicities Numbering Plan Area 8.0 Weekly and Monthly. Biannually in March and in September. Central Office Code Status 4.1, 4.2.2, 4.2.4, 8.0 Assigned and available posted daily; status monthly. Biannually in March and September. International Inbound NPA Code 8.0 Within 5 days of a new assignment; status monthly. Biannually in March and September. Personal Communications Service Code 8.0 NRUF form semi-annually; upon any new assignment. Status monthly. Biannually in March and September. 900 Code 8.0 NRUF form semi-annually; upon 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1869A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1869A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-1869A1.txt  
- Hooks has its own local government, post office and city hall, school system, and a fire department as well as a number of local churches serving the community. A staff engineering analysis indicates that Channel 231A can be allotted to Hooks consistent with the minimum distance separation requirements of the Commission's Rules provided there is a site restriction 6.6 kilometers (4.1 miles) west of the community. 3. In view of the fact that the proposed allotment could provide an additional service to Hooks, Texas, the Commission believes it would serve the public interest to solicit comments on the proposal to allot Channel 231A to Hooks.. Therefore, we will seek comments on the proposed amendment to the FM Table of Allotments, Section 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2320A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2320A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2320A1.txt  
- Sharon P. McDonald, (202) 418-2180. F. MB Docket No. 02-293; RM-10541 Petitioner: Maurice Salsa 5615 Evergreen Valley Drive Kingwood, Texas 77345 Proposal: Allot Channel 280C2 at Wheeler, Texas, as the community's first local aural transmission service. Community Present Proposed Wheeler, Texas -- 280C2 Coordinates: 35-28-55 NL and 100-12-56 WL Additional Information: This allotment requires a site restriction of 6.7 kilometers (4.1 miles) northeast to avoid short-spacings to the licensed sites of Station KKYN-FM, Channel 280C2, Plainview, Texas and Station KHYM(FM), Channel 280C1, Copeland, Kansas. FCC Contact: Sharon P. McDonald, (202) 418-2180. G. MB Docket No. 02-294; RM-10543 Petitioner: Black Diamond Broadcasting c/o Scott C. Cinnamon 1090 Vermont Ave., Suite 800 Washington, D.C. 20005 Proposal: Allot Channel 263A at Opal, Wyoming, as 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2361A1.txt  
- did not identify a need to modify this section. Therefore the current OEPM degradation limit is appropriate and should be maintained. USA/xx/2 MOD 3 Limits to the change in the power flux-density to protect the broadcasting-satellite service in Regions 1 and 2 in the band 12.2-12.5 GHz and in Region 3 in the band 12.5-12.7 GHz With respect to § 4.1.1 c) of Article 4, an administration in Region 2 shall be considered as being affected if the proposed new or modified assignment in the Regions 1 and 3 List would result in exceeding the power flux-densities given below, at any test point in the service area affected. spect to § 4.2.3 a), 4.2.3 b) or 4.2.3 f) of Article 4, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2512A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2512A2.txt  
- issue periodic reminders to them of such obligations. VA0 1 lGRlFJ120093.12 13 3.11 Access to Classified, Controlled Unclassified, or Sensitive Information. Nothing contained in this Agreement shall limit or affect the authority of a U.S. government agency to deny, limit or revoke Domestic Communications Companies' access to Classified, Controlled Unclassified, and Sensitive Information under that agency's jurisdiction. ARTICLE 4: DISPUTES 4.1 Informal Resolution. The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements shall be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to the General Counsel of X0, the General Counsel of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2815A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2815A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-2815A1.txt  
- of Aspermont, and we therefore take official notice that Aspermont is a community for allotment purposes. It is an incorporated city, the county seat of Stonewall County, and has a population exceeding 1,000 persons. It has a mayor, volunteer fire department, post office, school district and churches. Channel 226C2 is allotted at Aspermont with a site restriction of 6.7 kilometers (4.1 miles). Petitioner filed comments reiterating its support of the allotment, pledging to apply for the channel, when allotted, and if authorized, promptly build the facility. FCC Contact: Victoria M. McCauley (202) 418-2180. E. MM Docket No. 01-267, RM-10289 Petitioner: Jeraldine Anderson 1702 Cypress Drive Irving, Texas 75061 Determination: Allot Channel 289A at Cotulla, Texas, as the community's second local aural 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-296A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-296A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-296A1.txt  
- Barthen Gorman (202) 418-2180 MM Docket No. 01-251; RM-10274 Action: At the request of Flagler Broadcasting, we are allotting Channel 283C3 at Flagler, Colorado, as that community's first local aural transmission service. Coordinates: The reference coordinates for Channel 283C3 at Flagler are 39-17-17 North Latitude and 103-08-32 West Longitude. Additional Information: This allotment requires a site restriction of 6.5 kilometers (4.1 miles) west of Flagler, Colorado. FCC Contact: R. Barthen Gorman (202) 418-2180 C. MM Docket No. 01-253; RM 10276 Action: At the request of Stratton Broadcasting, we are allotting Channel 246C1 at Stratton, Colorado, as that community's first local aural transmission service. Coordinates: The reference coordinates for Channel 246C1 at Stratton are 39-18-34 North Latitude and 102-33-17 West Longitude. Additional 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3068A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3068A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-3068A1.txt  
- the allotment of Channel 231A at Hooks. 2. We believe that the public interest would be served by the allotment of Channel 231A at Hooks, Texas, as it will provide the community with additional local FM broadcast service. Channel 231A can be allotted to Hooks in compliance with the Commission's minimum distance separation requirements with a site restriction 6.6 kilometers (4.1 miles) west of the community. 3. Accordingly, pursuant to of the Communications Act of 1934, as amended, and Sections 0.61, 0.204(b) and 0.283 of the the authority contained in Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b) Commission's Rules, IT IS ORDERED, That effective December 23, 2002, the FM Table of Allotments, Section 73.202(b) of the Commission's Rules, IS AMENDED 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-379A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-379A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-379A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-409A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-409A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-409A1.txt  
- at Smithfield, North Carolina, or requiring New Age to demonstrate the availability of an additional equivalent channel for use by other parties. 5. Channel 272A can be allotted to Smithfield, North Carolina, consistent with the technical requirements of the Commission's Rules, at New Age's specified site, utilizing coordinates 35-28-21 NL and 78-19-43 WL. The transmitter site has a restriction of 4.1 kilometers (2.5 miles) south of Smithfield in order to avoid short-spacings to Station WJMH, Channel 271C at Reidsville, North Carolina; Station WFNC, Channel 272A at Lumberton, North Carolina; and Station WHLQ, Channel 273A, at Louisburg, North Carolina. 6. Accordingly, we seek comments on the proposed amendment to the FM Table of Allotments, Section 73.202(b) of the Commission's Rules, with respect 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-02-861A1.txt  
- Also see the section entitled, HOW TO OBTAIN AN FRN, for additional information. HOW DOES THE ELECTRONIC REMITTANCE FORM 159 HANDLE THE FRN Customers are encouraged to submit an electronic remittance Form 159 when filing an electronic application through IBFS. Instructions for doing so follow. On the IBFS Application Menu Screen page, press the Form 159 Menu button. See Exhibit 4.1 below. Exhibit 4.1 TIN, if other than Applicant, and check the box(es) next to the left of the application(s) for which payment is to be made. Press the Continue button. Exhibit 4.2 The IB customer will be presented with the Electronic Form 159 screen shown in Exhibit 4.3. Insert the Payor's FRN and password and press the Continue button. Exhibit 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-1771A1.txt  
- Cellular SID Administrators. 3.4 New Cellular SID Administrators can be recognized by the FCC by filing a letter of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2411A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-2411A2.txt  
- 160.02 18 1 24.7N 66 38 5.3W Quebrada Seca Ceiba PR 68.58 3.05 18 13 45.7N 65 37 6.8W Ceiba Ceiba PR 91.44 100.89 17 59 25.9N 66 6 41.8W Coabey Jayuya PR 77.72 39.62 18 25 55.7N 66 29 52.8W Manati Manati PR 78.941,029.61 18 18 39.6N 65 47 32.5W Campamento Zarzal Rio Grande PR 100.58 7.01 17 58 4.1N 66 11 58.4W Campamento Zarzal Rio Grande PR 88.7 134.42 18 21 41.8N 65 47 41.7W Las Tres Rio Grande PR 87.48 15.24 18 20 36N 65 38 8W Plantaje Toa Baja PR 83.82 3.05 18 27 25N 66 5 14W Regadera Vega Alta PR 21.34 128.02 18 27 57.7N 67 4 4.8W AGUADILLA PR 21.34 128.02 18 27 58.4N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-272A1.txt  
- Docket No. 02-293; RM-10541; 17 FCC Rcd 18118 (2002) Action: At the request of Maurice Salsa, we are allotting Channel 280C2 at Wheeler, Texas, as the community's first local aural transmission service. Coordinates: The reference coordinates for Channel 280C2 at Wheeler are 35-28-55 North Latitude and 100-12-56 West Longitude. Additional Information: This allotment requires a site restriction of 6.7 kilometers (4.1 miles) northeast to avoid short-spacings to the licensed sites of Station KKYN-FM, Channel 280C2, Plainview, Texas, and Station KHYM(FM), Channel 280C1, Copeland, Kansas. FCC Contact: Sharon P. McDonald (202) 418-2180 2. Accordingly, pursuant to the authority found in Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b) of the Communications Act of 1934, as amended, and Sections 0.61, 0.204(b) and 0.283 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A1.txt  
- section 310(b)(3) of the Act. See Cellwave Telephone Services, 30 F.3d at 1534-35; Moving Phones Partnership, 998 F.2d at 1055. No such statutory violation exists here. See supra note 81 (section 310(b)(3) is inapplicable to the Applications). We note that the New GX/Executive Branch Agreement provides first for informal resolution of any disputes. See New GX/Executive Branch Agreement at Art. 4.1. If any of the parties to the New GX/Executive Branch Agreement determines that further negotiation would be fruitless, Article 4.1 authorizes the party to resort to the remedies of Article 4.2 to enforce the New GX/Executive Branch Agreement. See id. Article 4.2 includes the right of a party to bring action for appropriate judicial relief and expressly does not limit 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A3.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3121A3.txt  
- and shall issue periodic reminders to them of such obligations. 3.25. Access to Classified, Controlled Unclassified, or Sensitive Information Nothing contained in this Agreement shall limit or affect the authority of a U.S. government agency Page 20 to deny, limit or revoke Domestic Communications Companies' access to Classified, Controlled Unclassified, and Sensitive Information under that agency's jurisdiction. ARTICLE 4: DISPUTES 4.1. The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements shall be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to the General Counsel of New GX, the General Counsel of the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3335A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3335A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3335A1.txt  
- and is in the public interest. In order to accommodate the allotment at Lamont, we will substitute Channel 282A for vacant Channel 247A at McFarland, California. 4. As stated in the Notice, Channel 247A can be allotted to Lamont, California, consistent with the minimum distance separation requirement of the Commission's Rules, provided there is a site restriction of 6.5 kilometers (4.1 miles) southeast of the community. Moreover, Channel 282A can be allotted to McFarland, California by using the same reference coordinates as vacant Channel 247A, in conformity with the Commission's Rules, provided there is a site restriction of 10.3 kilometers (6.4 miles) west of the community. 5. Accordingly, pursuant to the authority found in Sections 4(i), 5(c)(1), 303(g) and (r) and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-333A1.txt  
- see also Dobson, Western Wireless, and RCC Comments at 3-4; AWS Comments at 3. See Petition at 12-14; see also AWS Comments at 3-4. Agreement Establishing Lafayette MSA Limited Partnership among Lafayette CGSA, Inc. and Century Telephone Enterprises, Inc. (Mar. 8, 1990) (``Limited Partnership Agreement''). The Limited Partnership Agreement is attached to the Petition as an exhibit. See id. §§ 4.1, 7.2; see also Petition at 7-8. The Limited Partnership Agreement does provide the limited partner with passive investor protections. See Limited Partnership Agreement, at § 4.2. These provisions, however, would not confer control of Lafayette to ALLTEL. is usually the output-based market share of carrier i, and n is the number of carriers in the market. The HHI can range 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-347A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-347A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-347A1.txt  
- Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP, Annex 10 to the Convention on Civil Aviation, Vol. V, Aeronautical Radio Frequency Spectrum Utilization, Amendment No. 72, International Civil Aviation Organization, Montreal, 1997,at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. See Part 87 NPRM, 16 FCC Rcd at 19016 ¶ 24. The list of frequencies is contained 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-3947A1.txt  
- a difference in the short term. Accordingly, as owner of the tandem switching facilities, Verizon is the only carrier that can impose or require order in the tandem rehoming process. Cavalier also notes that section 252 does not require direct interconnection. In response to Verizon's argument that Cavalier need not lease duplicate facilities because it has the option, under section 4.1.1 of the proposed Agreement, to ``connect[] to all of Verizon's tandems through a single point in the LATA,'' Cavalier claims that Verizon never before has offered Cavalier the option of not directly connecting at the new tandem. Cavalier complains that Verizon's proposed section 4.1.1, and accompanying schedule 4.2.7, which itemizes end office interconnection arrangements between the Parties in Virginia, are 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-766A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-766A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-766A1.txt  
- the substitution at McFarland would not deprive the community of a second local service and would provide a first local service to the community of Lamont. A staff engineering analysis indicates that Channel 247A can be allotted to Lamont, California, consistent with the minimum distance separation requirements of the Commission's Rules, provided there is a site restriction of 6.5 kilometers (4.1 miles) southeast of the community. Furthermore, Channel 282A can be allotted to McFarland, California by using the same reference coordinates as vacant Channel 247A, in conformity with the Commission's Rules, provided there is a site restriction of 10.3 kilometers (6.4 miles) west of the community. 3. Accordingly, we seek comment on the proposed amendments of the FM Table of Allotments, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1.txt  
- Cellular SID Administrators. 3.4 New Cellular SID Administrators can be recognized by the FCC by filing a letter of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-03-864A1_Erratum.doc  
- Cellular SID Administrators. 3.4 New Cellular SID Administrators can be recognized by the FCC by filing a letter of intent and certifying they will comply with the guidelines and then signing a Memorandum of Understanding with the Wireless Telecommunications Bureau. 4.0 ASSIGNMENT PRINCIPLES The assignment principles defined below allow cellular systems the greatest possible latitude in providing seamless roaming capabilities. 4.1 Information requested from applicants for Cellular SID numbers will be kept uniform and kept to a minimum. 4.2 Maintain the current practice of assigning odd number SIDs to Channel Block ``A'' licensees and even number SIDs to Channel Block ``B'' licensees. 4.3 The assignment of a Cellular SID number does not imply ownership of the Cellular SID number. 4.4 If 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1031A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1031A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-1031A1.txt  
- License, filed by Mobile Relay Associates and Mobile Relay Associates, Inc., James A. Kay, Jr., and Laurence J. Feinberg (Feb. 4, 2004) (Joint Motion). This Public Notice is issued by both Divisions because the Settlement Agreement covers both Private Land Mobile Radio and Commercial Mobile Radio Service licenses, which are, respectively, the responsibility of PSCID and the Mobility Division. Schedules 4.1 and 5.1 to the Settlement Agreement list a number of pleadings associated with 23 applications that the Parties intend to withdraw upon approval of the Agreement. The same lists are provided in Exhibits E and F to the Joint Motion. FCC Application for Wireless Telecommunications Bureau Radio Service Authorization, Assignment of Authorization, File No. 0001621776 (Feb. 25, 2004). Thirteen (13) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2081A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2081A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2081A1.txt  
- band, but merely indicated a possible intent to make such a request at a future date. Therefore, we find that Lockheed's July 2003 amendments, for the first time requested additional spectrum in the 5010-5030 MHz frequency band thereby, violating the freeze. Consequently, we dismiss that portion of Lockheed's July 2003 amended applications, without prejudice to refiling. Additionally, in comparing Table 4.1-1 of Lockheed's original applications filed in April 1999 and Table 4.1-1 in the July 2003 amendments, we find that Lockheed requests an additional 41 MHz of spectrum that was not included in its original applications. Specifically, Lockheed requests the use of the 6629.02-6649.52 MHz and 6680-6700.67 MHz bands for an augmentation data uplink. Lockheed's request for these additional frequencies in 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2507A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2507A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2507A1.txt  
- Commission's Rules, we will modify the license of Station WKIX to specify operation on Channel 272A at Smithfield, North Carolina. 4. Channel 272A can be allotted to Smithfield, North Carolina, in conformity with the technical requirements of the Commission's Rules, utilizing Petitioner's requested site at the coordinates of 35-28-21 North Latitude and 78-19-43 West Longitude, with a site restriction of 4.1 kilometers (2.5 miles) south of Smithfield, North Carolina. 5. This document does not contain [new or modified] information collection requirements subject to the Paperwork Reduction Act of 1995 (PRA), Public Law 104-13. In addition, therefore, it does not contain any new or modified ``information collection burden for small business concerns with fewer than 25 employees,'' pursuant to the Small Business 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A1.txt  
- Conditions at 4. See Foreign Participation Order, 12 FCC Rcd at 23919-21, ¶¶ 61-66. See id. at 23919, ¶ 62. See id. at 23920-21, ¶ 65. See id. at 23919, ¶ 62. See VAI/Executive Branch Agreement at Art. 7.1. We note that the VAI/Executive Branch Agreement provides first for informal resolution of any dispute. See VAI/Executive Branch Agreement at Art. 4.1. If any of the parties to the agreement should determine that further negotiation is fruitless, Article 4.1 authorizes the party to resort to the remedies of Article 4.2 to enforce the agreement. See id. Article 4.2 includes the right of a party to bring action for appropriate judicial relief and expressly does not limit the right of a U.S. government 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2668A2.txt  
- VSNL America shall monitor on a regular basis the status of screened personnel, and shall remove screened personnel who no longer meet the requirements set forth for screened personnel. (e) VSNL America shall maintain records relating to the status of screened personnel, and shall provide these records, upon request, to the DOJ, the FBI, or the DHS. ARTICLE 4: DISPUTES 4.1 Informal Resolution. The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements shall be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to the General Counsel of VSNL America, the General Counsel 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2689A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2689A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-2689A1.txt  
- limit of 30 degrees W.L. in the frequency coordination report is inconsistent with the eastern satellite arc limit of 10 degrees W.L. entered in E54 of Schedule B. If Telco214 refiles, the coordination report must be consistent with the range of arc proposed for operation, and it must be current within six months. Values of EIRP density of -15 and -4.1 dBW/4KHz entered for the emissions 2M46G7W and 205KG7W in Items E49 of Schedule B are substantially lower than and inconsistent with the mathematically minimum possible values of 30.9 and 41.7 calculated by subtracting the bandwidth of the emission divided by 4 KHz, after conversion to dB, from the EIRP of 59 dBW. If Telco214 refiles, it must supply values for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3513A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3513A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-04-3513A1.txt  
- more than 50 percent of an urbanized area. Therefore, a Tuck showing is not required since the proposed Salt Lick reallotment would not implicate the Commission's policy against migration of stations from rural to urban areas. Channel 249A can also be allotted to Salt Lick in compliance with the Commission's spacing requirements provided there is a site restriction 6.6 kilometers (4.1 miles) northeast of Salt Lick. The Joint Petitioners note that the relocation of Station WAXZ from Georgetown to Salt Lick would result in a population net loss of 36,904 persons. However, the entire loss area is considered well-served since Georgetown will continue to receive at least five other aural services. 6. The Joint Petitioners also propose the reallotment of Station 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-1774A1.txt  
- network coordination and notification procedures Reasons: The temporary procedures are fully implemented and this resolution, which, inter alia, calls for electronic submission of due diligence information, is no longer needed. USA/ /8 SUP RESOLUTION 81 (WRC-2000) Evaluation of the administrative due diligence procedure for satellite networks Reasons: Consequential to SUP Resolution 49 (Rev. WRC-03). USA/ /9 MOD APPENDIX 30 (Rev.WRC-03) 4.1.3bis The regulatory time-limit for bringing into use of an assignment in the List may be extended once by not more than three years due to launch failure in the following cases: - the destruction of the satellite intended to bring the assignment into use; - the destruction of the satellite launched to replace an already operating satellite which is intended 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2207A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2207A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2207A1.txt  
- can be allotted to Mason in compliance with the Commission's spacing requirements provided there is a site restriction 9.4 kilometers (5.8 miles) east at reference coordinates 39-20-57 North Latitude and 84-12-08 West Longitude. Id. note 6. Channel 249A can also be allotted to Salt Lick in compliance with the Commission's spacing requirements provided there is a site restriction 6.6 kilometers (4.1 miles) northeast at reference coordinates 38-10-15 North Latitude and 83-34-31 West Longitude. Channel 276A can also be allotted to Georgetown in compliance with the Commission's spacing requirements provided there is a site restriction 12.1 kilometers (7.5 miles) east of at reference coordinates 38-52-14 North Latitude and 83-45-55 West Longitude.. Commission records indicate that while Station WVXU(FM), File No. BPED-19930628KD, was 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2265A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2265A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2265A1.txt  
- re-file the application. Our study reveals that based on the Maximum EIRP Density (Question E49) and Antenna Transmit Gain (E41/42), your Maximum Input Power Density exceeds Section 25.212(d) of the Commission's rules by 2.2 dB for the 36M0G7W (in both applications) and 4M50G7W (in the application regarding Call Sign E050151) emissions. We also note that your applications propose to use 4.1 meter antennas. These antennas are considered ``non-routine'' under Commission Rules. Therefore, in refiling your applications, you must identify specific satellites as Points of Communication and include certifications from adjacent operators of all satellites located within 6 degrees of your target satellite agreeing to your proposed operations. Alternatively, your application may request ALSAT as Points of Communication so long as you 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2424A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2424A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2424A1.txt  
- Agreement for Payload Deactivation Capability, it executed with Telesat Canada on June 29, 2005. See Appendix B. Augmentation messages referred to here are messages that contain error correction information that provide for differential corrections to the GPS receive signals, resulting in more accurate GPS navigation information. See Lockheed February 2004 Amendment at 11. See Lockheed February 2004 Amendment, Revised Table 4.1-1. . See also 47 C.F.R. §2.1. See 47 C.F.R. § 2.106 footnote 5.458 and footnote US342. In addition, Section 25.203(c) of the Commission's rules requires that an Earth station applicant, prior to filing its application, shall coordinate its proposed frequency usage with existing terrestrial users and with applicants for terrestrial station authorizations. Therefore, we remind Lockheed that it is required 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2424A1_Erratum.doc  
- Agreement for Payload Deactivation Capability, it executed with Telesat Canada on June 29, 2005. See Appendix B. Augmentation messages referred to here are messages that contain error correction information that provide for differential corrections to the GPS receive signals, resulting in more accurate GPS navigation information. See Lockheed February 2004 Amendment at 11. See Lockheed February 2004 Amendment, Revised Table 4.1-1. . See also 47 C.F.R. §2.1. See 47 C.F.R. § 2.106 footnote 5.458 and footnote US342. In addition, Section 25.203(c) of the Commission's rules requires that an Earth station applicant, prior to filing its application, shall coordinate its proposed frequency usage with existing terrestrial users and with applicants for terrestrial station authorizations. Therefore, we remind Lockheed that it is required 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2481A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2481A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2481A1.txt  
- overlap, and ion of Article 2A of Appendix 30 for the space operation functions using the guardbands defined in § 3.9 of Annex 5 of Appendix 30, the threshold/condition specified for the FSS in the bands in 2) applies. In application of Article 2A of Appendix 30A for the space operation functions using the guardbands defined in § 3.1 and 4.1 of Annex 3 of Appendix 30A, the threshold/condition specified for the FSS in the bands in 4) applies Reason: ITU studies have shown that extending the ±8ş coordination arc, currently applicable to FSS networks in this band, to meteorological satellite (MetSat) services in this band would reduce the number of unnecessary coordinations for such systems without compromising the technical integrity 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-265A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-265A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-265A1.txt  
- Provider [i.e., NIP] is in the business of providing Services . . .; and B. Customer desires to purchase Prepaid Calling Services from Provider for resale to Card Holders. Such language describing the parties' relationship does not differ materially among the Service Contracts. See Revised Joint Statement at 5-6, ¶ 4; Service Contracts at 3.7 (custom branding) and 4.0 or 4.1 (technical support). Revised Joint Statement at 7-8, ¶ 16. Revised Joint Statement at 9, ¶¶ 20-21. See generally Uniform Commercial Code § 2A-103 (stating that identification of the goods to be let is the sine qua non of a lease). APCC Services et al. v. NetworkIP, Informal Complaint, File No. EB-02-MDIC-0017, at 2-4 (filed Mar. 29, 2002); APCC Services et 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2741A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2741A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-2741A1.txt  
- a radial distance of approximately 0.17 wavelength (169 feet at 1000 kHz). The KinStar antenna requires use of the standard 120-radial, one-quarter wave, buried ground system. Attachment A to this Public Notice is a report providing details of the construction, modeling, and field testing of the KinStar antenna. Both field tests and computer modeling using the Numerical Electromagnetic Code (NEC) 4.1 method of moments program indicate that the KinStar antenna produces an essentially omnidirectional radiation pattern in the horizontal plane. The developers' tests also show that the KinStar antenna meets the minimum efficiency for Class B, C, and D stations. The elevation pattern of the KinStar antenna can be represented by the formula in Section 73.160(b)(2) of the Commission's rules for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-3102A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-3102A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-3102A2.txt  
- FCC's designee, without charge. System and Equipment Inventory Inventory data (hardware model, serial numbers and descriptions) on equipment shall be reported as part of the contractor's annual reporting requirements, as well as any upgrades or replacements, including the license numbers of any Commercial Off-the-Shelf (COTS) software. Reserved Contract Data Requirements List (CDRL) All CDRLs shall be approved by the FCC. 4.1 Reserved Security Plan The contractor shall furnish a Security Plan within 45 calendar days of contract award per Sections 3.1, 3.7, and 3.16.1. System Documentation Plan The contractor shall furnish a System Documentation Plan within 60 calendar days of contract award per Section 3.19. Disaster/Continuity of Operations Plan The contractor shall furnish a Disaster/Continuity of Operations Plan within 60 calendar 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-704A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-704A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-704A1.txt  
- Dana J. Puopolo 2134 Oak Street, Unit C Santa Monica, CA 90405 Proposal: Allot Channel 264A at Cumberland Head, New York, as the community's first local FM allotment. Community Present Proposed Cumberland Head, New York ---- 264A Coordinates: 44-43-12 NL and 73-19-12 WL Additional Information: Channel 264A can be allotted to Cumberland Head with a site restriction of 6.6 km (4.1 miles) east of Cumberland Head. Petitioner states that Cumberland Head is a Census Designated Place with a population of 1,698 persons. Concurrence in a specially negotiated short-spaced allotment by the Government of Canada is required because the proposed allotment is located within 320 kilometers (199 miles) of the U.S.-Canadian border. FCC Contact: Deborah A. Dupont (202) 418-7072 2. Comments, reply 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-749A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-749A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-05-749A1.txt  
- in MB Docket No. 04-80. Community Present Proposed Arlington, Tennessee ----- 274C1 Memphis, Tennessee 246C1,259C,274C1, 246C1,259C,283C1,290C 283C1,290C Proposed Coordinates for Channel 274C1 at Arlington, Tennessee: 35-16-33 NL and 89-46-38 WL,at a site 10.8 km (6.7 miles) west of Arlington (no change in coordinates). Proposed New Coordinates for Channel 274C1 at Saint Florian, Alabama: 34-50-12 NL and 87-37-27 WL,at a site 4.1 km (2.5 miles) south of Saint Florian. 6. The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the attached Appendix and are incorporated by reference herein. In particular, we note that a showing of continuing interest is required in paragraph 2 of the Appendix before a channel will be allotted. 7. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-202A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-202A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-202A1.txt  
- radio service of the proposed network or affected networks is other than the space services listed in the threshold/condition column, or in the case of coordination of space stations operating in the opposite direction of transmission i) Bandwidth overlap, and ation of Article 2A of Appendix 30A for the space operation functions using the guardbands defined in § 3.1 and 4.1 of Annex 3 of Appendix 30A, the threshold/condition specified for the FSS in the bands in 4) applies Reasons: Consequential modification to the additional allocation to MetSat in the band 18.0-18.1 GHz. ITU studies have shown that extending the ±8ş coordination arc, currently applicable to FSS networks in this band, to the meteorological-satellite (MetSat) services in this band would reduce 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2607A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2607A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-2607A1.txt  
- which provides that a transferor of a broadcast station license may retain ``no right of reversion of the license, no right to reassignment of the license in the future, and may not reserve the right to use the facilities of the station for any period whatsoever.'' 47 C.F.R. § 73.1150(a). See Objection at Exhibit C, § 2(g); Exhibit D, § 4.1 See December 27, 2005, Order at 2. Arecibo Radio Corp., Memorandum Opinion and Order, 101 FCC 2d 545 (1985); Radio Station WOW, Inc. v. Johnson, 326 U.S. 120, 131-32 (1945). Compare Kirk Merkley, Receiver, Memorandum Opinion and Order, 94 FCC 2d 829 (1983), recon. denied, Memorandum Opinion and Order, 56 RR 2d 413 (1984), aff'd sub nom. Merkley v. FCC, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-267A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-267A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-267A1.txt  
- the public interest would be served by reallotting Channel 274C1 at Arlington, Tennessee. Channel 274C1 can be allotted at Arlington in compliance with the minimum distance separation requirements of the Commission's Rules at its existing reference coordinates. The reference coordinates of vacant Channel 274A at Saint Florian, Alabama, can be changed to 34-50-12 NL and 87-37-27 WL, at a site 4.1 kilometers (2.5 miles) south of Saint Florian. 6. The Commission will send a copy of this Report and Order in a report to be sent to Congress and the Government Accountability Office pursuant to the Congressional Review Act, see 5 U.S.C. §801(a)(a)(A). 7. Accordingly, pursuant to the authority found in 47 U.S.C. Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b), 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-06-960A1.txt  
- narrowband systems, the pfd is translated into a 4 kHz bandwidth. Summary: The following pages indicate the modification to the IAP for agenda item 1.11 in strikethrough/underline format. VI MEETING OF PERMANENT CONSULTATIVE COMMITTEE II: RADIOCOMMUNICATIONS INCLUDING BROADCASTING October 25 to 28, 2005 San José, Costa Rica OEA/Ser.L/XVII.4.2 CCP.II-RADIO/doc. 896/05 Original: English INTER-AMERICAN PROPOSALS OF WSG-2 (Item on the Agenda: 4.1 ) (Document submitted by working sub-group 2 (WSG-2) ) Agenda Item 1.11: to review sharing criteria and regulatory provisions for protection of terrestrial services in particular terrestrial television broadcasting services, in the band 620 - 790 MHz from BSS networks and systems, in accordance with Resolution 545 (WRC-03) Background Under footnote No.5.311, the band 620-790 MHz may be used for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-1564A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-1564A2.txt  
- -6.6 0.5 0.2 5.6 N-1/N-2 -0.3 0.7 0.2 4.0 -0.3 0.7 0.1 3.6 N+1/N+2 -1.5 0.0 0.3 0.6 -1.3 0.6 0.5 2.3 N+2/N+4 -1.5 2.7 0.1 11.3 -1.2 4.0 3.9 11.4 N+3/N+6 -0.2 7.2 6.8 14.1 2.1 9.8 9.9 14.7 N+4/N+8 1.5 8.2 7.0 16.4 0.7 8.7 8.9 13.8 N+5/N+10 0.0 7.9 9.1 12.8 -0.3 7.1 7.3 13.7 -1.9 4.7 4.1 16.4 -6.6 5.9 6.8 16.9 Note 1 For D = -53 dBm, the actual means, medians, and maxima for channels N+3/N+6 and beyond on the positive side and N-4/N-8 and beyond on the negative side are underestimated because most of the individual measurements on which the summed D/U's are based were for measurement conditions in which TOV for the receivers 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-181A1.txt  
- B K Marine Construction, Inc., to Tracy Simmons, Federal Communications Commission; Letter dated Jan. 31, 2006 from Richard S. Becker, Richard S. Becker and Associates Chartered, counsel for B K Marine Construction, Inc., to Marlene H. Dortch, Secretary, Federal Communications Commission. See FCC File No. 0000598516. See license for Station WPTR255, Fort Pierce, Florida. See Petition at 1; Exhibits 4, 4.1 and 4.2. 47 C.F.R. § 90.157(a); see also 47 C.F.R. § 1.955(a)(3) (authorizations automatically terminate, without specific Commission action, if service is permanently discontinued). For the purposes of Section 90.157, any station which has not operated for one year or more is considered to have been permanently discontinued. 47 C.F.R. § 90.157(a). Pursuant to a Commission reorganization effective September 25, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-2279A1.txt  
- Kent to Melanie Godschall, Investigations and Hearings Division, Enforcement Bureau, Federal Communications Commission, dated July 6, 2006. See Thompson Response at 5-6; Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A11.txt  
- Second, we assess the financial performance of the radio industry, comparing its performance to the performance of the S&P o We focus first on margins). We then explore ratios that shed light on the financing of radio companies (i.e., total debt as a percentage of total capital; fixed charge coverage after taxes; market to book ratio; and stock market returns). 4.1 EBIT Margins The earnings before interest and taxes margin (EBIT Margin) is defined as the ratio of firm's earnings (before subtracting out interest and reflects how efficiently the firm generates profits from its sales, or alternatively stated, how w the firm minimizes the operating, personnel, and administrative costs of its operations for a g level of sales. The ratio represents 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A4.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A4.txt  
- 8 TherewereseveralidiosyncraciestotheNielsendata.First,wewereonlyabletoobtainratings dataforcertainpartsoftheday:from7:00-11:00a.m.andfrom6:00p.m.-12:00a.m.Wefocus exclusivelyonthelatterperiodinourresults.Second,thebroadcastandcablenetworkratings camefromdifferentsourceswithinthecompany.Broadcastratingsdataareavailableforeachof the210DMAsandareusedinthestudy.Duetodifficultiesinthedeliveryandformattingofthe cableratingsdata,wewerenotabletousetheminthisstudy.Instead,weobtainedannualaverage prime-timeratingsdatafromKaganWorldMedia(2006).Whilenotidealthebroadcastratings dataareforthespecificprogramsshownonthespecificdaysofourstudywhilethecableratings dataareannualaverages-theyareusefulforpermittingustoconductanintegratedanalysisof programmingonbothbroadcastandcablenetworks. AdvertisingMinutesData(TNS)AsnotedinSection2,itisimportanttounderstandthe impactofownershipstructureonboththecontentandadvertisingmarkets.Todoso,theFCC purchaseddatafromTNS,Inc.(TNS)forthesameweeksforwhichweobtainedtheTMSand Nielsendata. TherewerealsoseveralidiosyncraciestotheTNSdata.First,theFCCcontractedwithTNSfor onlybroadcastadvertisingminutes.Thesewereavailableinmostofthetop108DMAs.17Second, TNSprovideduswithinformationaboutthenumberandlengthofadvertisementsineachprogram, butonlyinformationaboutthenumberofpromotionsineachprogram.18Thisimpactedslightly ourestimatesofthetotalnon-programmingtimeonagivenprogram.19 4DataAggregationandProgramTypes Asdescribedearlier,wehavethreemeasuresofthequantityoftelevision:theamountoftelevision programmingproduced(andavailablesomewhere)intheUnitedStates,theamountoftelevision programmingavailabletothetypicalU.S.household,andtheamountoftelevisionactuallywatched byU.S.households.Wewilldiscussprogrammingofdifferenttypesinwhatfollows;fornowassume 17MissingwereDMAs10-11,66-68,and76-78. 18Promotionsareadvertisementsforothertelevisionprograms.Typicallytheseareforotherprogramsonthesame channelorotherprogramsonaffiliatedchannels. 19Thedataweregiventousatthelevelofthenetwork-program-timeperiod-advertisement.Eachad(orpromotion) wasassociatedwitha"pod",acollectionofadsand/orpromotionsassociatedwitheachcommercialbreakwithin aprogram.Toaggregatethedatatotheleveloftheprogram,wefirstaggregatedtheinformationwithineachpod andthenaggregatedinformationacrosspodswithinaprogram.Weonlyranintotroublewhenapromotionwas eitherfirstorlastwithinapod.Inthatcase,wedidn'tknowexactlyhowlongthepodwas(andthereforehowlong thepromotionwas).Toestimatetotalnon-programming(i.e.adpluspromotion)time,wesubstitutedtheaverage promotionlength(whichwecancalculatebycomparingpodlengthtototaladvertisinglengthforpodsthatbegin andendwithads)forthosepromotionsatthebeginningandendofthepod.Thisisunlikelytodramaticallyimpact ourresults. 9 wearediscussinga"generictelevisionprogram". Howdowemeasurewhatisproduced?Asdescribedabove,theTMSdataprovidesanexhaustive inventoryofthetelevision"channels"(broadcasttelevisionstationsandcabletelevisionnetworks) onofferacrosstheUnitedStates.Indeed,theyprovidetoomuch-almost8,000such"channels". Wetrimthisdownintwoways.First,forbroadcastnetworks,wefocusonthesetoffull-power broadcasttelevisionstationsthatarethefocusoftheFCCMediaOwnershipstudy#2.Wefurther reducethisnumberbyremovingfromourstudy(wherefeasible)thesecond(weaker)broadcast televisionstationaffiliatedwithabroadcastnetworkwithineachNielsenDMA.20Second,forcable networks,wehadtodecidehowmanycablenetworkstoincludeintheanalysis.NCTA(2007)lists over500cablenetworks(plannedoractive).Thisverylargenumbernodoubtreflectsthegrowth inavailablecapacityacrosscableandsatellitesystemsbroughtonbythedigitaldistributionof programming.Buthowmanyofthesearetrulyavailable?Anearlyversionofourresultsusingthe TMSdataincluded362cablenetworks.Intheresultswepresenthere,however,wefocusonthe setofbasiccablenetworksforwhichwehadinformationabouttheirnationwideavailabilityfrom KaganWorldMedia(2006)aswellasanypremiumandpay-per-viewnetworks.21Thisleft192 cablenetworks.Whilenotexhaustive-andperhapsnotrepresentativeofthefutureofprogram availability-itdoesreflectthepopulationofat-least-reasonably-availablecablenetworksasoflate 2006. Whatdowemissbylimitingourselvesinthisway?Inthebroadcastarea,theserulesmeanwewill notanalyzetheriseoflow-powerbroadcasttelevisionstations.22Inthecablearea,itmeanswedo notanalyzetwotypesofnetworks:newand/orverynarrowlydistributedbasiccablenetworksand varioustypesoflocalorigination(publicaccess,etc.).23 4.1AggregatingBroadcastProgramming Beforewedescribethepatternsinthedataundertheseassumptions,wemustaddressafun- damentaldifferenceinthereportingofbroadcastandcabletelevisionprogramminginthedata. 20Forexample,therearetwoABCaffiliatesinthe7th-largestDMA:WCVB(Boston,MA)andWMUR(Manch- ester,NH).Ofthese,WCVBhasthe(much)higheraverageratingacrosstheprogramsinourdata:4.82versus0.96. WethereforedroppedfromtheanalysisWMUR,alongwithall234othernetworkaffiliatesforwhichtherewasa secondaffiliatewiththesamenetworkwithinthesameDMAthathadhigherratings.Therewere7instancesof multiplenetworkaffiliatesforwhichneitherhadanyratingsinformationinthedata.Inthesecases,weassumedthey couldeachreach50%ofthehouseholdsintheDMA. 21Theleastwidelydistributedbasiccablenetwork(HTVMusica)wasavailableinjust2.0millionhouseholds. 22AbrieflookatthefullTMSdatashowsthattheyareontherise:from776inMay2003to1,235inNovember 2006. 23ThismayseemanimportantomissiongiventheFCC'scurrentandhistoricfocusonlocalism(cf.FCC(2003)), butweconcludedadetailedanalysisofthemanyvarietiesoflocaloriginationwasbeyondthescopeofthisstudy. Thedataexist,however,foradetailedanalysisoflocallyavailablecableprogramming.AsforLPTVstations,we cansaythattheirnumberhasgrowninthesample,from484inMay2003to697inNovember2006. 10 Inourestimationdataset,thereare1,583broadcastaffiliatesand192cablenetworks.Muchof theprogrammingonthebroadcastnetworks,however,issimilar,particularlyduringprimetime (8:00-11:00EST).24Evenifnot,itisprovidedwithinaDMAwhileeachofthecablenetworkscan (atleastinprinciple)bedistributednationally.Inordertocompareprogramming,atleastona nationalbasis,wehadtosomehowaggregatetheinformationabouttheprogrammingprovidedon broadcastaffiliatesintosomethinglikea"national"broadcastnetwork. Thisproblemwasconceptuallyeasyfortelevisionstationsaffiliatedwithabroadcastnetwork: simply"addup"(withappropriateweights)theprogrammingprovidedoneachaffiliate.We describeindetailhowwedidthisinthenextparagraph.Buthowshouldone"addup"themany independentandpublictelevisionstations?Whilemanyassumptionsarepossible,wechoseto makeseveral"virtualnetworks"ofthesestations.25Takeindependentstationsforclarity(public stationsweretreatedsimilarly).Weexaminedalltheindependenttelevisionstationswithineach DMAintheU.S.andrankedthemaccordingtotheirchannelnumber(withlowchannelnumbers atthetopofthelist).26Wethenmadea"network"ofallofthe"first"independentstations.Call this"network""Independent1".Wemadesimilar"networks"outofeachofthesecond,third, etc.stationsuntilweranoutofstations.Thisyielded9independenttelevision"networks"and6 publictelevision"networks".Table5reportsthenumberofaffiliatesforeachofournetworksin theestimationdata.Tables27and28reporttheidentitiesofthecablenetworksinthedata.27 Havingidentifiedeachbroadcastnetwork(realorvirtual),wenextfacedthetaskofaggregating theseacrossthevariousDMAsintoasinglenationalnetwork.Butwhatdoesitmeanto"add up""WheelofFortune"inSanDiegowith"EntertainmentTonight"inTampa?28Whilewecan't aggregateprogramnames,wecanaggregatethecharacteristicsofthoseprograms.Considerthe TVContentRatingforclarity.29"WheelofFortune"inSanDiegohasaTVContentRatingof TV-G(giveitavalueof3)while"EntertainmentTonight"isn'trated(giveitavalueof0).Adding upthetvratingsofthesetwoprograms(andacrossalltheprogramsonagivennetworkforagiven dayandtimeperiod)givesbothan"average"TVratingaswellastheshareofaffiliatesthathave eachrating.30WedothisnotonlyforTVContentRatings,butforallthecharacteristicsofthe 24Afterstandardizingfordifferencesintimezones,itwastypicalforeveryaffiliateofthefourbigbroadcastnetworks (ABC,CBS,NBC,andFOX)intheUnitedStatestocarrythesameprogram. 25Thishadtheadvantageofcapturingthefactthathouseholdsinsome(larger)DMAshaveaccesstomore independentandpublictelevisionstationsthanhouseholdsinotherDMAs. 26Channelnumberishistoricallyimportantassignalqualityviaover-the-airbroadcastwasgenerallyhigherthe lowerthechannelnumber. 27Thereappeartobeafewidiosyncraciesinthenetworksreportedtousbythedataproviders.Forexample,we receivedanumberofthepremium"multiplexes"(e.g.Showtime,Starz)butnotothers(e.g.HBO,Cinemax).This isunlikelytodramaticallyaffectourconclusions. 28Notethisisn'tnearlyasmuchaproblemforthemajorbroadcastnetworksinprimetime.There,theuniformity ofprogrammingacrossaffiliatesmeanswecansimplyreporttheprogrambeingshownonalltheaffiliates. 29Thetelevisioncontentratingisamethodofdescribingthesuitabilityofparticularcontentforparticularaudiences. TheyaresimilartoMPAAratingsformovies.Wedescribetheminfurtherdetailbelow. 30Forexample,theaverageTVcontentratingofprogramsonNBCaffiliatesat7:00p.m.(moregenerally,one 11 programmingprovidedtousbyTMS(ordefinedbyususingTMSdata).Thisyieldsapicture ofwhatthe"average"televisionstationaffiliatedwitheachnetworkisbroadcastingforagiven 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A5.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A5.txt  
- marginal effect is a function of the impact of each covariate on both the expected count of intervals in the "sometimes-zero" group and the effect of the covariate on the probability a station falls into the "always-zero" group. For dummy independent variables, the marginal effect is the change associated with a change of the dummy variable from 0 to 1. 4.1 News ZINB model estimates of the quantities of news based on the EMR data and the audited data are shown in Tables II-6 and II-7, respectively. Tables II-8 and II-9 present the analogous estimations for local news. We limit our discussion here to the results of the estimates of the EMR data since the audited data are not significantly different 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A6.txt  
- at least at the 5 percent level. Source: Ownership Database (from FCC), Edison Airplay Database Dependent Variable Table 22: Station Pair Descriptives for Other Content Program Measures, Stratified by Common Ownership and Market All Commercial, In-Market, Edison Surveyed Stations Same Market [1] Different Market [2] Same Market [3] Different Market [4] Content Angle 57.1 50.8 53.2 58.1 57.3 -7.3 - -4.1 - Origination Angle 33.2 33.8 31.0 30.5 33.4 3.3 + -2.3 - Live Angle 30.8 31.6 30.7 27.8 30.8 3.9 + -0.1 - Content Angle 49.8 43.6 51.8 49.7 49.7 -6.1 - 2.1 + Origination Angle 31.8 24.6 35.9 28.2 31.6 -3.6 - 4.3 + Live Angle 31.1 29.6 35.0 30.5 31.0 -0.9 - 4.0 + Content Angle 51.1 56.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A7.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A7.txt  
- Notes: Mean and standard deviation. Difference in means is (cross-owned less non-cross- owned); ***p<.01, **p<.05, and *p<.10. 45 Table 13: Difference in Speaking Time (Democratic coverage less Republican coverage, in seconds) Independent variables (1) (2) (3) (4) (5) Local station ownership Cross-owned newspaper -3.0 (1.14) -4.4 (1.16) -5.8 (1.28) -5.2 (1.24) -5.4 (1.29) Cross-owned radio station 1.2 (0.32) 1.8 (0.49) 4.1 (1.13) 2.4 (0.59) Cross-owned radio and newspaper 2.9 (0.55) 3.5 (0.61) 2.3 (0.40) 5.1 (0.80) Parent company coverage of all television households (%) 0.2 (0.84) 0.1 (0.38) 0.3 (1.23) Network owned and operated -6.2 (1.19) -6.9 (1.25) -10.5* (1.77) Network affiliation (omitted category is CW\MyNetwork) ABC -2.1 (0.61) -4.5 (0.83) CBS -0.7 (0.21) -4.2 (0.68) FOX 5.8 (1.63) 9.2** (2.33) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3558A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3558A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3558A1.txt  
- reimburse United States CP, LLC, for its costs should Petitioner prevail at auction and become the permittee on Channel 249C2 at Blanca. A staff engineering analysis indicates that Channel 249C2 can be allotted to Blanca consistent with the minimum distance separation requirements of the Commission's rules, at coordinates 37-26-35 NL and 105-26-29 WL, with a site restriction of 6.6 kilometers (4.1 miles) east of the community. Accordingly, we seek comment on the proposed amendment of the FM Table of Allotments, Section 73.202(b), as follows: Community Present Proposed Blanca, Colorado --- 249C2 The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the attached Appendix and are incorporated by reference herein. In particular, we 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3861A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3861A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3861A1.txt  
- of hours in dispute and the hourly rates provided by Irving. See Irving PRM, App. 125 at 578. We do not discuss the remaining $58,050.61 in costs in the following categories comprising a PFA: System and Subscriber Unit Inventory or Legal. . See Id. See Irving PRM, App. 10 at 144-45 (aggregating the hours and cost estimates for Tasks 1.6.3, 4.1, 4.4, 4.5, and 4.8). See Irving PRM at 6. See Irving SOP at 5. Id. Id. at 6. Id. at 7. Id. at 11. Sprint PRM at 4. Id. See Sprint SOP at 11. Sprint PRM at 4. RR at 14-16. Id. at 14. Id. at 15. State of Maryland and Sprint Nextel, Memorandum Opinion and Order, WT Docket No. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-4721A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-4721A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-4721A1.txt  
- that statement is unsupported by specific facts or analysis, and is undermined by the evidence of some boxing on NPTC's poles. Accordingly, we direct NPTC, within 60 days, to revise the Pole Attachment Agreement to eliminate this discriminatory provision. The Pole Attachment Agreement Unreasonably Requires Salsgiver to Incur Make-Ready Costs With No Assurance That Those Costs Will Be Reasonable. Section 4.1.3 of the Agreement provides that Salsgiver's submission of a pole attachment application is deemed to constitute Salsgiver's agreement to pay for the cost of the Make-Ready survey. Under the Agreement, NPTC is not required to provide, nor is Salsgiver apparently permitted to demand, an estimate of those costs before Salsgiver is deemed to have agreed to pay them. We find 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-5051A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-5051A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-5051A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1272A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1272A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1272A1.txt  
- from the site and assembled on site. Id. at Section 1.2.4. The EA notes that the Snohomish River, a ``nearby wetland and ditched tributary creek, are located off site to the west'' and that there are no bodies of water or wetlands on the site. EA at Section 1.1. Id. at Section 1.2. Id. at Section 1.2.7. Id. at Section 4.1; see also EA, Figure 1, Site Location Map. Id. No endangered species were found to be present in the vicinity of the site. The bald eagle was de-listed by the USFWS on June 28, 2007. See Endangered and Threatened Wildlife . See EA, Attachment E, Biological Assessment, at 27. The BA also concludes that ``[n]o species were identified as proposed. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1891A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1891A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-1891A1.txt  
- to Nassau's violation of Section 73.3555(a) of the Commission's Rules. Sincerely, Peter H. Doyle Chief, Audio Division Media Bureau cc: David G. O'Neil, Esq. Capitol Broadcasting Corporation, Inc. Concord Broadcasting, LLC Letter to Capitol Broadcasting Corporation, Concord Broadcasting, LLC, and Nassau Broadcasting I, LLC, 23 FCC Rcd 5478 (MB 2008)(``WWHK Order''). See Application, Attachment 6, Joint Sales Agreement, at Section 4.1. WWHK Order, 23 FCC Rcd at 5480. See 47 C.F.R. § 73.3555(a)(1)(iii). See Broadcast Actions, Public Notice, Report No. 46168 (Feb. 8, 2006)(``Public Notice''). 47 C.F.R. §73.3555 Note 2(k)(1) (``Note 2''). Pursuant to Section 73.3555 Note 2(k)(1), a JSA that exceeds 15 percent of the weekly advertising time of a station is attributable to a party that owns other stations 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A11.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A11.txt  
- 8TßÔë Á „&" ÷Pq˘ˇĹ Ăă ˘G±÷%- FóÍă ŇE|(,µ `ôRé‚ň |čÓă>-L''¸ !fpŇńmMhçfDÔt3 (R)ě =¤E¬ůî ˙n o ˛0Ą‡Í"=‹§Ń3}·l ŮŚË˝: âa ~ŔCC đ€ `ĐÁűHÄS:‰„ýŕ 1ńű áőďk˙ ŁwÎĺ±ä8ł?´µ :E†¸˛Â‡Ă~2׿óWűíüâq $4 hę˘K„3? >LÉṠ÷F-ď•„ń''$¶x1sľŔ~ ę(±T Ů(ó!ĺ Hh ä͇ˇ" ÎTđµ >T``sá" ńA- 5„ci,ÁX e}7¬Ű_Ł FÖ÷F>Đ‹CĚm.}ôH>hY?# ¦ĄÎl>ŔPŃň-LČáá ¶¸Ö-3éY; -žě_đtµn@TOl "0]š•;ů" W×¤Ţ •łN- >-j|Ŕ ćđpVMćĂT...TÍ€ ž...¶ %Ž l!Ô"8˙ÇÖď‹Ü€^Ę(BI= ‚z‰ŃťßČ -‹ çż‚...`~ű ,>€ćĂŰ,  p QĹÁ :͇TÂ6đ!nXíaCöž· M Ü-Ż `ü&ví @üJb4.1P8řÇđáë_üE>Lm"/__N ˝Ô€ňtm Üők ]ŃÉŮýýňáń|čÜŁ b˝-ë ˘Ä ź<ěa€ŮÇ ]L... şž ŚQľŠĘ}·źä_ʸ=Sv,Śç'ÄE- Ńţ ‚ŠÉň(úý_4˘Ş_CL´5ď~`Giś_< A``-ë˙ĺĂăř ¶ńľé äáââđ D ţ Úz)l_dŤÝ‹6P7=š.ł; wĂĂ^#W×IG č€ăˇh‹Ť×X> óÔKčwÝÚ{ ĺĂżÁCoěá(·p\Š 1- ý'ńŔ ¶ ł˙ÖQIlsîĂ ű›5µ''Y|Ôŕ Žűˇ-„Üg† ›!ʇ&>ôNE ąQŽs Ď |@Á ¸fç9x`Í`Ś@ô*ü@3 endstream endobj 93 0 obj <>stream -Ž-n ş´HĐň endstream endobj 94 0 obj <>stream | źŚ 6$$ 2¨!>X]E‡źĄřŕ >ť ×|>ř*_Ä 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A3.txt  
- device, which may or may not be representative of a final TV white space product. These tests all utilized the Adaptrum WSD transmitter to radiate an undesired signal while the potential victim receive system was monitored visually for interference. Attempts were made to operate the victim receiver in a minimum desired signal condition to represent a worst-case interference scenario. Section 4.1 describes a test performed to assess potential adjacent-channel and co-channel interference interactions when a proximate DTV receive system is tuned to a station near the recognized threshold of visibility (TOV) of -84 dBm. This test was performed within the FCC laboratory facility. Section 4.2 describes tests performed at two of the residential field trial sites to assess the potential for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A6.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2243A6.txt  
- -27.4 Y 13.1 39 D 620.3 -44.2 Y 7.1 40 D 626.3 -30.9 Y 54.1 41 D 632.3 -42.7 Y 24.1 42 D 638.3 -51.1 Y 22.1 43 N 645.25 -79.2 5 43 D 644.3 -66 Y 66.1 44 45 N 657.25 -28.8 1 46 D 662.3 -30 Y 45.1 47 N 669.24 -82 5 48 D 674.3 -43.8 Y 4.1 49 N 681.26 -77.8 5 50 N 687.25 -40.5 1 51 D 692.3 -49.7 Y 50.1 Table C-7. Measurement Results - College Park Channel Signal Type (N or D) Frequency (MHz) Measured Power (dBm) Viewable (Picture/TASO) Reported PSIP 21 22 N 519.28 -63.1 2 23 N 525.24 -48.2 2 24 N 531.26 -67.5 2 25 N 537.25 -66.6 3 26 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2277A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2277A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2277A1.txt  
- 33-25-55 NL and 99-47-43 WL, at a site 2.7 km (1.6 miles) northeast of Knox City (no site change). Proposed Coordinates for Channel 251C3 at Quanah, Texas: 34-24-09 NL and 99-46-02 WL, at a site 11.9 km (7.4 miles) north of Quanah. Proposed Coordinates for Channel 288C2 at Rule, Texas: 33-10-29 NL and 99-49-26 WL, at a site 6.6 km (4.1 miles) east of Rule. 6. The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the attached Appendix and are incorporated by reference herein. In particular, we note that a showing of continuing interest is required in paragraph 2 of the Appendix before a channel will be allotted. 7. Pursuant to Sections 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2318A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2318A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-2318A1.txt  
- the development of coordinated regional plans, and developed a Regional Planning Guidebook. Following the sunset of the NCC's charter on July 25, 2003, the National Public Safety Telecommunications Council (NPSTC) agreed to continue to provide assistance to regional planners. A copy of the 700 MHz Regional Planning Guidebook is available at the NPSTC website at http://www.npstc.org/documents.html. See Revised Plan Section 4.1 Convening of the RPC at 9. See Revised Plan Appendix J - Current List of Executive Committee Officers at 98. See Revised Plan Appendix A - Bylaws at 38-42. See Revised Plan Appendix E - Meeting Minutes at 66-67 (June 4, 2003). See Revised Plan, Section 4 - Notification Process at 9-10 (describing outreach methods - RPC master email distribution 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-378A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-378A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-378A1.txt  
- reimburse United States CP, LLC, for its costs should Petitioner prevail at auction and become the permittee on Channel 249C2 at Blanca. A staff engineering analysis indicates that Channel 249C2 can be allotted to Blanca consistent with the minimum distance separation requirements of the Commission's rules, at coordinates 37-26-35 NL and 105-26-29 WL, with a site restriction of 6.6 kilometers (4.1 miles) east of the community. Accordingly, pursuant to the authority contained in 47 U.S.C. §§ 4(i), 5(c)(1), 303(g), and (r), and 307(b), and 47 C.F.R. §§0.61, 0.204(b) and 0.283, IT IS ORDERED That effective March 31, 2008, the FM Table of Allotments, 47 C.F.R. § 73.202(b) IS AMENDED, with respect to the community listed below, as follows: Community Channel Blanca, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-490A2.txt  
- from the Part 1 application submitted by service providers and information from the Part 3 response. States will be able to select daily, weekly or monthly distribution of this report. Summary of NANPA Technical Reports . Summary of Technical Reports Name Reference Frequency Numbering Plan Area 8.0 Weekly and Monthly. Biannually in March and in September. Central Office Code Status 4.1, 4.2.2, 4.2.4, 8.0 Assigned and available posted daily; status monthly. Biannually in March and September. International Inbound NPA Code 8.0 Within five days of a new assignment; status monthly. Biannually in March and September. Personal Communications Service Code 8.0 NRUF form semi-annually; upon any new assignment. Status monthly. Biannually in March and September. 900 Code 8.0 NRUF form semi-annually; upon 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-550A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-550A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-550A1.txt  
- emission power. Thus, the portion of FiberSat's application pertaining to the 36M0G7W emission using an EIRP of 74.9 dBW is defective. While we dismiss the portion of the application on the above basis, we also request the following information regarding the portions of the application that remain pending. In response to Question E15 of Schedule B, FiberSat answered that its 4.1 meter antenna earth station complies with the antenna gain patterns specified in Section 25.209(a) and (b) of the Commission's rules, 47 C.F.R. §25.209(a) and (b). Pursuant to Section 25.132(a)(1) of the Commission's rules, we request FiberSat to demonstrate these measurements by submitting the antenna gain patterns for the 4.1 meter antenna. Accordingly, pursuant to Section 25.112(a)(1) of the Commission's rules, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-711A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-711A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-08-711A1.txt  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Thomas J. Sugrue Vice President, Government Affairs T-Mobile USA, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111 and 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Kathleen O'Brien Ham, T-Mobile USA, Inc. (Aug. 6, 2007). Id. Letter from David H. Solomon, Esq., Wilkinson Barker Knauer, LLP, to Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau (Sept. 5, 2007). Under this provision, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1053A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1053A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1053A1.txt  
- may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Michael D. Rhoda Senior Vice President Windstream Corporation ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 26, 2007); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 7, 2008). Letter 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1319A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1319A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1319A1.txt  
- 4.11. See 47 CFR Part 4. The Commission requires providers of wireline, wireless, cable circuit-switched telephony, satellite, paging and Signaling System 7 communications services to submit outage reports regarding disruptions to communication. The FCC's Public Safety & Homeland Security Bureau Launches Disaster Information Reporting System (DIRS), Public Notice, DA 07-3871, 22 FCC Rcd 16757 (PSHSB 2007). See 47 CFR §§ 4.1, et seq. 47 C.F.R. § 1.3. This rule provides that ``[a]ny provision of the rules may be waived by the Commission on its own motion or on petition if good cause therefor is shown.'' Id. PSHSB staff typically sends an email to the DIRS participants announcing the de-activation of DIRS for that event. Subsequently, PSHSB issues a public notice announcing 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1825A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1825A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1825A1.txt  
- Amendment). See Non-Streamlined Plan Amendment, Attachment B - Region 6 Table of Channels (listing all existing licensees and available channels). See Letter from Art McDole, Chair, Region 6 (Northern California) NPSPAC Regional Planning Committee, to Federal Communications Commission, Gen. Docket No. 90-287 at 1-2 (summarizing modifications to the Region 6 Plan) (filed April 22, 2009). See Non-Streamlined Plan Amendment, Section 4.1.1 Licensing Procedures at 11-12. See Non-Streamlined Plan Amendment, Section 4.3 - Interoperability Channels and Usage Covered by This Plan at 13 (all channels are used primarily for coordination of activities between agencies in mutual aid, or emergencies requiring interoperability); see also, Non-Streamlined Plan Amendment, Section 4.3.2 - Implementation Plan at 14 (requiring eligible users in each county to develop an 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1994A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-1994A2.txt  
- ToimprovetransparencyintoGSaresourcesactuallybeingusedbymakingbringingintouse dataforfrequencyassignmentsandsatellitenetworksreadilyavailable. 35 USAlxx/2 MOD Theuncertaintyassociatedwithwhenfrequencyassignmentsareactuallybroughtintouseand withpossibleinaccuracieswithResolution49Annex2datacanbeaddressedasfollows: RESOLUTION49(Rev.WRC-12Q+) Administrativeduediligenceapplicabletosomesatellite radiocommunicationservices TheWorldRadiocornrnunicationConference(Geneva,20129+), considering a) thatResolution18ofthePlenipotentiaryConference(Kyoto,1994)instructedthe DirectoroftheRadiocommunicationBureautoinitiateareviewofsomeimportantissues concerninginternationalsatellitenetworkcoordinationandtomakeapreliminaryreportto WRC-95andafinalreporttoWRC-97; b) thattheDirectoroftheBureauprovidedacomprehensivereporttoWRC-97,includinga numberofrecommendationsforactionassoonaspossibleandforidentifyingareasrequiring furtherstudy; c) thatoneoftherecommendationsintheDirector'sreporttoWRC-97wasthat administrativeduediligenceshouldbeadoptedasameansofaddressingtheproblemof reservationoforbitandspectrumcapacitywithoutactualuse; d) thatexperiencema)'needtobegainedintheapplicationoftheadministrativedue diligenceproceduresadoptedbyWRC-97indicatescertainchangesshouldbemadetothose procedures,andthatse't'eralyearsmaybeneededtosee't','hetheradministrativeduediligence measuresproducesatisfactoryresults; e) thatnewregulatoryapproachesmayneedtobecarefullyconsideredinordertoavoid adverseeffectsonnetworksalreadygoingthroughthedifferentphasesoftheprocedures; f) thatArticle44oftheConstitutionsetsoutthebasicprinciplesfortheuseoftheradio- frequencyspectrumandthegeostationary-satelliteandothersatelliteorbits,takingintoaccount theneedsofdevelopingcountries, consideringfurther g) thatWRC-97decidedtoreducetheregulatorytime-frameforbringingasatellitenetwork intouse; h) thatWRC-2000hasconsideredtheresultsoftheimplementationoftheadministrative duediligenceproceduresandpreparedareporttothe2002PlenipotentiaryConferencein responsetoResolution85(Minneapolis,1998), resolves 1 thattheadministrativeduediligenceprocedurecontainedinAnnex1tothisResolution shallbeappliedasfrom22November1997forasatellitenetworkorsatellitesystemofthefixed- satelliteservice,mobile-satelliteserviceorbroadcasting-satelliteserviceforwhichtheadvance publicationinformationunderNo. 9.2B,orforwhichtherequestformodificationsofthe Region2PlanunderArticle4, §4.2.1b)ofAppendices30and30Athatinvolvetheadditionof newfrequenciesororbitpositions,orforwhichtherequestformodificationsoftheRegion2 PlanunderArticle4, §4.2.1a)ofAppendices30and30Athatextendtheserviceareatoanother 36 countryorcountriesinadditiontotheexistingservicearea,orforwhichtherequestforadditional usesinRegions1and3under §4.1ofArticle4ofAppendices30and30A,orforwhichthe submissionofinformationundersupplementaryprovisionsapplicabletoadditionaluses inthe plannedbandsasdefinedinArticle2ofAppendix 30B(Section illofArticle6)hasbeen receivedbytheBureaufrom22November1997,orforwhichsubmissionunderArticle6of Appendix 30B(Rev.WRC-07)isreceivedonorafter17November2007,withtheexceptionof submissionsofnewMemberStatesseekingtheacquisitionoftheirrespectivenationalallotmentsI forinclusionintheAppendix 30BPlan; 2 thatforasatellitefletworkorsatellitesystem't't'ithiflthescopeof§1or3ofAflfle)(1to thisResolutioflflOtyetrecordedifltheMasterlRterflationalFrequeflcyRegister(MIFR)by 22November1997,forwhichtheadvancepublicationinformatiofluflderNo. 1042oftheRadio Regulations(Editionof1990,revisedin1994)orfortheapplicatioflofSectionIIIofArticle6of Appefldix JOBhasbeeflreceiyedbytheBureaubefore22November1997,theresponsible admiflistratioflshallsubmittotheBureauthecompleteduediligeflceiflformationinaccordaflce ',yithAflflex2tothisResolutioflflOtlaterthan21No,>'ember2004,orbeforethem(piryofthe notifiedperiodforbringiflgthesatellitenetworkintouse,plusanyextensionperiod'""hichshall flOtexceedthreeyearspursuanttotheapplicationofNo. lSSOoftheRadioRegulations(Editiofl of1990,revisedin1994)orthedatesspecifiedinthereleyantprovisionsArticle6of Appefldi)( JOB,'t',rhiche,>rerdatecomesearlier.Ifthedateofbriflgingifltouse,includiflgextension specifiedabove,isbefore1July1999,theresponsibleadministrationshallsubmittotheBureau thecompleteduediligeflceinformationiflaccordaflcewithAflfle)(2tothisResolutioflnotlater than1July1999;(Reason:Overtakenbytime) 2his thatforasatellitefleh't'orl(orsatellitesystem't'lithiflthescopeof§2ofAflnex1tothis ResolutioflnotrecordedintheMIFRb)'22NO't'ember1997,forwhichtherequestfora modificatiofltothePlansofAppendices JOandJOAhasbeenreceivedbytheBureaubefore 22November1997,theresponsibleadministrationshallsubmittotheBureauthecompletedue diligeflceinformationinaccordancewithAflfle)(2tothisResolutioflasearlyaspossiblebefore theefldoftheperiodestablishedasalimittobringingintouseiflaccordaflcewiththerelevaflt provisioflsofArticle4ofAppefldi)( JOafldtherelevantprovisionsofArticle4ofAppefldix JOA; (Reason:Overtakenbytime) See§2.3ofAppendix30B(Rev.WRC·07). 37 3 thatforasatellitenetworkorsatellitesystem'tyithinthescopeof§1,2or3ofAnne),1to thisResolutionrecordedintheMIFRby22No',cember1997,theresponsibleadministrationshall subrllittotheBureauthecompleteduediligenceinformationinaccordancewithAnnex2tothis Resolutionnotlaterthan21NO't'ember2000,orbeforethenotifieddateofbringingthesatellite networkintouse(includinganymttensionperiod),>tYhiche't'erdatecomeslater;_(Reason: Overtakenbytime) 4 thatsi),monthsbeforetheexpirydatespecifiedin resolves2or2eisabo't'e,ifthe responsibleadrllinistrationhasnotsubrllittedtheduediligenceinformation,theBureaushallsend arerllindertothatadrllinistration;(Reason:Overtakenbytime) 5 thatiftheduediligenceinformationisfoundtobeincomplete,theBureaushall immediatelyrequesttheadrllinistrationtosubrllitthemissinginformation. Inanycase,the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2035A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2035A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2035A1.txt  
- not imply that counties have ownership of the frequencies in the pre-allotment sort. Channels are available to all eligible Region 33 public safety entities on a first-come, first-served basis and will be allotted channels if Plan requirements are met. See Plan, Section 5 - Procedures for Frequency Coordination (addressing process, licensee responsibilities and technical requirements) at 23-24. See Plan, Section 4.1 - Processing and Evaluating Applications at 21-22 (listing application requirements); see also, Plan, Appendix K - Evaluation Matrix Point System at 119-122. See Plan, Section 3.11 - Design and Engineering Responsibilities at 16-17; see also Plan, Section 3.13 - Implementation of Channels at 18. See Plan, Section 3.14 - Interoperability Channels; see also Plan, Appendix J - Table of Interoperability 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2219A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2219A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-2219A1.txt  
- Amendment). See Non-Streamlined Plan Amendment, Attachment B - Region 6 Table of Channels (listing all existing licensees and available channels). See Letter from Art McDole, Chair, Region 6 (Northern California) NPSPAC Regional Planning Committee, to Federal Communications Commission, Gen. Docket No. 90-287 at 1-2 (summarizing modifications to the Region 6 Plan) (filed April 22, 2009). See Non-Streamlined Plan Amendment, Section 4.1.1 Licensing Procedures at 11-12. See Non-Streamlined Plan Amendment, Section 4.3 - Interoperability Channels and Usage Covered by This Plan at 13 (all channels are used primarily for coordination of activities between agencies in mutual aid, or emergencies requiring interoperability); see also, Non-Streamlined Plan Amendment, Section 4.3.2 - Implementation Plan at 14 (requiring eligible users in each county to develop an 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-53A1.txt  
- for both groups of cable operators, those relieved from rate regulation of their basic tier (i.e., those whom the Commission has found face ``effective competition'' in their service areas) and those serving noncompetitive communities (i.e., those for whom no effective competition finding exists). For the years ending January 1, 2007 and January 1, 2008, prices increased by 6.1 percent and 4.1 percent, respectively, for the group relieved from rate regulation and by 4.3 percent and 5.2 percent for the noncompetitive group. As of January 1, 2006; January 1, 2007; and January 1, 2008, cable operators on average charged $45.26, $47.27, and $49.65, respectively, per month for expanded basic programming service. As of the same three dates, cable operators granted relief from 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-54A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-54A1.txt  
- McCall, Roaming Feeds Regional Carriers, WIRELESS WEEK, Mar. 26, 2001, at 23. Federal Communications Commission DA 09-54 77 revenues408 for the entire mobile telephone industry increased to $3.74 billion in 2007 from $3.5 billion in 2006, but fell below the amount collected in 2005 of $3.8 billion.409 The contribution of roaming revenues to total service revenues continued its decline: from 4.1 percent in 2004, to 3.3 percent in 2005, to 2.8 percent in 2006, to 2.7 percent in 2007, down from over ten percent seven years ago.410 As discussed in the Twelfth Report, roaming revenues typically account for a higher percentage of total service revenues for rural and smaller regional providers than for nationwide carriers.411 The Twelfth Report also acknowledged the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-09-874A1.txt  
- May 19, 2003). See Revised Plan, Appendix B - Region 9 Members, Agencies, Contact Information and Voting Status at 22-25. See Revised Plan, Section 4 - Notification Process at 5. See Revised Plan, Appendix D - List of Meetings, Summaries of Minutes, and Agenda at 27-42 (seven meetings held over the course of a six-year period). See Revised Plan, Section 4.1.a Procedure for Requesting Spectrum Allocations at 6; see also Revised Plan, Section 4.3 Allocation of Narrowband ``General Use'' Spectrum (narrowband pool allotments have a channel bandwidth of 25 kHz to provide flexibility to accommodate multiple technologies using multiple bandwidths). See Revised Plan, Section 4.2 Procedure for Frequency Coordination at 8. See Revised Plan, Section 5.0 System Design/Efficiency Requirements (interference protections 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1245A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1245A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1245A1.txt  
- People with Disabilities: To request materials in accessible formats for people with disabilities (Braille, large print, electronic files, audio format), send an e-mail to fcc504@fcc.gov or call the Consumer and Governmental Affairs Bureau at (202) 418-0530, (202) 418-0432 (TTY). For further information about this Public Notice, please contact Jeffery Goldthorp at (202) 418-1096. - FCC - See 47 C.F.R. §§ 4.1-4.13. In 1992, the Commission established network outage reporting requirements for wireline providers. Notification by Common Carriers of Service Disruptions, Report and Order, CC Docket No. 91-273, 7 FCC Rcd 2010 (1992); see also Memorandum Opinion and Order and Further Notice of Proposed Rulemaking, CC Docket No 91-273, 8 FCC Rcd 8517 (1993); Second Report and Order, CC Docket No. 91-2739, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-1348A1_Rcd.pdf  
- Media: AM (2); FM (59); TV (120). Topography: Finland occupies an area slightly smaller than Montana. Finland's population is concentrated on a small southwestern coastal plain. The terrain is mostly low, flat to rolling plains interspersed with lakes and low hills. Subscriptions per 100 people Access per 100 people Total Subscribers Total Fiber Cable DSL Other 66.1 1,579,600 29.7 0.0 4.1 24.9 0.8 12. France Regulation:The responsibility for France's national telecommunications policy resides in the General Directorate for the Information Technology and Postal Services (DiGITIP), a unit of the Ministry of Economy, Industry and Employment (MEIE).80 Created in November 1998, the DiGITIP proposes and implements policies to promote an industrial and competitive environment favorable to France's communications industry, both domestically and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-156A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-156A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-156A1.txt  
- City, Texas: 33-25-55 NL and 99-47-43 WL, at a site 2.7 km (1.6 miles) northeast of Knox City (no site change). Coordinates for Channel 251C3 at Quanah, Texas: 34-24-09 NL and 99-46-02 WL, at a site 11.9 km (7.4 miles) north of Quanah. Coordinates for Channel 288C2 at Rule, Texas: 33-10-29 NL and 99-49-26 WL, at a site 6.6 km (4.1 miles) east of Rule. 5. IT IS FURTHER ORDERED, That effective March 15, 2010, the Media Bureau's Consolidated Data Base System will reflect the following: Channel 255C3 at Crowell, Texas, as a vacant allotment, in lieu of Channel 293C3; Channel 293A at Knox City, Texas, as a vacant allotment, in lieu of Channel 291A; Channel 251C3 at Quanah, Texas, as 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2069A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2069A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2069A1.txt  
- 3(b), 47 U.S.C. § 615). VoIP 911 Order, 20 FCC Rcd at 10272. Id. at n. 152. See 47 C.F.R. §§ 1.20000 - 1.20008. See 47 C.F.R. §§ 64.2001 - 64.2009. See 47 C.F.R. §§ 64.601 - 64.608. See 47 C.F.R. §§ 6.1 - 6.23 and 7.1 - 7.23. See 47 C.F.R. §§ 52.20 - 52.33 See 47 C.F.R. §§ 4.1 - 4.13. See 47 C.F.R. § 54.706. See 47 C.F.R. § 64.604. See 47 C.F.R. § 52.17. See 47 C.F.R. § 52.32. See 47 C.F.R. § 1.80(b)(3). 47 U.S.C. § 503(b)(5). Federal Communications Commission DA 10-2069 Federal Communications Commission DA 10-2069 FEDERAL COMMUNICATIONS COMMISSION WASHINGTON, D.C. 20554  -ě-&U)çE/A8 |ż˙‰PNG (c)|)QŰŢ@0·łÓű Ä~.˙ í ĺ-cßÁ"Pgń Ľc)˘0O§Ý) bŹ"cúş €Á-ô Ž!|} 2 ×ńčřun‚''...›Ą 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2181A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2181A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2181A1.txt  
- Decree may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date ____________________________ Lohn Weber Chief Financial Officer Norlight, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(f). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. (November 18, 2009). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2303A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2303A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2303A1.txt  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Steve Nocella Senior Vice President Network Services XO Communications, LLC ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Heather Burnett Gold, Senior Vice President, External Affairs, XO Communications (May 21, 2010) (``LOI''). See LOI. E-mail from Todd D. Daubert, Esq., Sonnenschein Nath & Rosenthal, LLP to Kevin M. Pittman, Esq., Spectrum Enforcement Division, Enforcement Bureau 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-2346A2.txt  
- \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof SEQ SectionNumber _Toc280004970 \\* ARABIC }}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof -} {\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof PAGEREF _Toc280004970 \\h }{\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof {\*\datafield 08d0c9ea79f9bace118c8200aa004ba90b02000000080000000e0000005f0054006f0063 003200380030003000300034003900370030000000}}}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 1}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \b0\lang1024\langfe1024\noproof \par }\pard\plain \ltrpar\s30\ql \li240\ri0\sb120\widctlpar\tqr\tldot\tx8976\wrapdefault\aspalpha\aspnum\ faauto\adjustright\rin0\lin240\itap0 \rtlch\fcs1 \af0\afs24\alang1025 \ltrch\fcs0 \fs24\lang1033\langfe1033\cgrid\langnp1033\langfenp1033 {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4.1 Requirements\tab }{\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof SEQ SectionNumber _Toc280004971 \\* ARABIC }}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 4}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof -} {\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof PAGEREF _Toc280004971 \\h }{\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof {\*\datafield 08d0c9ea79f9bace118c8200aa004ba90b02000000080000000e0000005f0054006f0063 003200380030003000300034003900370031000000}}}{\fldrslt {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof 1}}}\sectd \marglsxn1627\margrsxn1627\margtsxn2160\margbsxn2160\binfsxn7\binsxn7\sb kodd\pgnrestart\pgnlcrm\linex0\footery1440\sectdefaultcl\sftnbj {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof \par 4.2 Functional Specifications\tab }{\field{\*\fldinst {\rtlch\fcs1 \af0 \ltrch\fcs0 \lang1024\langfe1024\noproof SEQ 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-237A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-237A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-237A1.txt  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Bureau Chief Enforcement Bureau ____________________________ Date ____________________________ Scott W. McCloud Vice President-Wireless Networks Bluegrass Cellular, Inc. ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Ronald R. Smith, President, Bluegrass Cellular, Inc. (July 14, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Scott W. McCloud, Vice President, Wireless Networks, Bluegrass Cellular, Inc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-238A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-238A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-238A1.txt  
- number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ William L. Roughton, Jr. Vice President, Legal and Regulatory Affairs Centennial Communications Corporation ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to Tony L. Wolk, Senior Vice President, General Counsel and Secretary, Centennial Corporation (August 15, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to William L. Roughton, Jr., 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2.txt  
- new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the request for additional uses in Regions 1 and 3 under § 4.1 of Article 4 of Appendices 30 and 30A, or for which the 17 submission of information under supplementary provisions applicable to additional uses in the planned bands as defined in Article 2 of Appendix 30B (Section III of Article 6) has been received by the Bureau from 22 November 1997, or for which submission under Article 6 of Appendix 30B 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-372A2_Rcd.pdf  
- new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the request for additional uses in Regions 1 and 3 under § 4.1 of Article 4 of Appendices 30 and 30A, or for which the 2167 submission of information under supplementary provisions applicable to additional uses in the planned bands as defined in Article 2 of Appendix 30B (Section III of Article 6) has been received by the Bureau from 22 November 1997, or for which submission under Article 6 of Appendix30B (Rev.WRC-07) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-855A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-855A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-855A1.txt  
- 1994) (Arrangement F) as modified by attachment to letter from Robert W. McCaugern, Deputy Director General, Spectrum Engineering to Mr. Bruce Franca, Deputy Chief Engineer, Office of Engineering and Technology, Federal Communications Commission (Dec. 9, 1994) (Letter Amendment). Arrangement F at ¶¶ 3-4. Letter Amendment at Annex A. Id. at Annex B, Tables C1 and C2. Arrangement F at ¶ 4.1(a). License WQEN999 authorizes Hazelton to operate on the following channel pair that is primary to licensees in Canada in Canada Border Region 3, which includes Lenawee County, Michigan: 814.4375 MHz/859.4375 MHz. We note that Hazelton's mobile units operate within a 32-kilometer radius of the base station location and thus operate more then 69 kilometers from the border with Canada. Mobile 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-10-855A1_Rcd.pdf  
- lacks the authority to waive or modify the provisions of international treaties. Hazelton's statement must be filed with the Office of the Secretary, Federal Communications Commission, 445 Twelfth Street, S.W., Room TW-A325, Washington, DC20554.8In addition, please provide an electronic copy of the statement to Brian Marenco, Policy Division, Public Safety and Homeland Security Bureau, at Brian.Marenco@fcc.gov. 5Arrangement F at ¶ 4.1(a). License WQEN999 authorizes Hazelton to operate on the following channel pair that is primary to licensees in Canada in Canada Border Region 3, which includes Lenawee County, Michigan: 814.4375 MHz/859.4375 MHz. 6We note that Hazelton's mobile units operate within a 32-kilometer radius of the base station location and thus operate more then 69 kilometers from the border with Canada. Mobile 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1126A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1126A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1126A1.txt  
- Carolina State Users Network, and the North Carolina National Emergency Numbering Association). See Plan, Appendix A - Membership at 26-28. See Plan, Appendix B - By-Laws at 29-33. See Plan, Appendix C - Meeting Notifications at 34-43 (includes summaries of meetings held). Meeting minutes and draft documents are available on the Region 31 list serve at http://groups.yahoo.com/group/NC_700_RPC. See Plan, Section 4.1 - Procedure for Requesting Channels at 14 (all applications will be considered on a first come, first served basis); see also, Plan, Section 4.7 - Procedure for Frequency Coordination at 17. See Plan, Section 4.11 - Priority Matrix at 20-21 (application evaluation matrix point system and scoring categories, noting that the matrix will be used only in the event that 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1362A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1362A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1362A1.txt  
- of which counterparts together shall constitute one and the same fully executed instrument. ________________________________ P. Michele Ellison Chief Enforcement Bureau ________________________________ Date ________________________________ Stephen W. Crawford General Counsel and Senior Vice President, Mergers and Acquisitions Alpheus Communications, L.P. ________________________________ Date Alpheus Communications, L.P., Notice of Apparent Liability for Forfeiture, 25 FCC Rcd 8993 (Enf. Bur. 2010) (``NAL''). 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i), 503(b). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(f). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Stephen W. Crawford, Esq., General Counsel and Senior Vice President, Alpheus Communications, LP (September 10, 2009) (``LOI''). ``User minutes'' are defined as ``assigned telephone number minutes ... for telephony and for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1455A2_Rcd.pdf  
- in Height but Otherwise Do Not Change the Categorical Exclusion ............................................................................ 3-7 3.4 Alternatives Considered And Dismissed ............................................................ 3-9 3.4.1 Prohibit All New Tower Construction ................................................... 3-9 3.4.2 Prohibit Towers That Exceed a Certain Height ..................................... 3-9 3.4.3 Prohibit Towers in Certain Locations .................................................... 3-9 3.4.4 Prohibit Guy Wires on New Towers .................................................... 3-10 CHAPTER FOUR AFFECTED ENVIRONMENT .................................................................................... 4-1 4.1 Introduction ......................................................................................................... 4-1 4.2 Existing Communications Towers ...................................................................... 4-1 4.2.1 General Characteristics .......................................................................... 4-1 4.2.2 Number of Existing Towers ................................................................... 4-2 4.2.3 Distribution of Existing Towers ............................................................ 4-3 4.2.4 Future Needs/Trends .............................................................................. 4-3 4.3 Resources Not Affected ...................................................................................... 4-4 4.3.1 Geology.................................................................................................. 4-4 4.3.2 Soils ....................................................................................................... 4-4 4.3.3 Farmlands .............................................................................................. 4-4 13849 Table of Contents ii 4.3.4 Groundwater .......................................................................................... 4-5 4.3.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1521A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1521A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-1521A1.txt  
- end user. Specifically, (1) equivalent channel capacity; (2) equivalent signaling capability, baud rate and access time; (3) coextensive geographic coverage; and (4) operating costs.'' Id. at 15077 ¶ 201 (footnotes omitted). Id. at 14986 ¶ 26. The change order request sought funds for Motorola to ``design and modify the current 3 site, 7 SmartNet channel Simulcast system to a SmartZone 4.1 mixed mobile system with 2 channels being ASTRO digital equipped.'' Letter from Gary T. Maha, Sheriff, Genesee County, N.Y. to Omer Saeed, Sprint Nextel Corp. at 2 (Sept. 24, 2009) (Genesee Letter). TA RR at 2-3. Id. at 3. Genesee estimates that the design of the modified system, and associated legal fees, would cost $108,320. Genesee Letter at 3. The 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-402A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-402A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-402A1.txt  
- and the same fully executed instrument. For the Enforcement Bureau: ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date AT&T: By: ____________________________ Paul Mancini Senior VP & Assistant General Counsel AT&T Services, Inc. 1120 20th Street, N.W. Suite 1000 Washington, DC 20036 ____________________________ Date 47 C.F.R. § 4.9. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. §§ 4.1 et seq. 47 C.F.R. § 4.9. Id. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Jacquelyne Flemming, Executive Director Counsel, AT&T Services, Inc. (July 18, 2007). Letter from Peter H. Jacoby , General Counsel, AT&T Services, Inc., to Kathy Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission (August 24, 2007). Letter 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-454A1.txt  
- Order, 12 FCC Rcd at 12301 ¶ 30 (citing Working Group Report, § 4.2.3). Id. Id. at 12299-300 ¶ 28; Working Group Report, §§ 2.5.2, 2.5.3. Telecommunications Act of 1996, Public L. No. 104-104, 110 Stat. 56, codified at 47 U.S.C. §§ 151 et seq. Second Report and Order, 12 FCC Rcd at 12301 ¶ 29; Working Group Report, § 4.1.1. Second Report and Order, 12 FCC Rcd at 12303 ¶ 33. Section 6.4.4 of the Working Group Report recommends adoption of the process used to make LNPA vendor selections. See Working Group Report, § 6.4.4. Working Group Report, Appendix D, § 12.2.1. Telephone Number Portability, CC Docket No. 95-116, RM 8535, Second Report and Order, 12 FCC Rcd 12281, 12346 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2.txt  
- new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the request for additional uses in Regions 1 and 3 under § 4.1 of Article 4 of Appendices 30 and 30A, or for which the submission of information under supplementary provisions applicable to additional uses in the planned bands as defined in Article 2 of Appendix 30B (Section III of Article 6) has been received by the Bureau from 22 November 1997, or for which submission under Article 6 of Appendix 21 30B 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-712A2_Rcd.pdf  
- new frequencies or orbit positions, or for which the request for modifications of the Region 2 Plan under Article 4, § 4.2.1 a) of Appendices 30 and 30A that extend the service area to another country or countries in addition to the existing service area, or for which the request for additional uses in Regions 1 and 3 under § 4.1 of Article 4 of Appendices 30 and 30A, or for which the submission of information under supplementary provisions applicable to additional uses in the planned bands as defined in Article 2 of Appendix 30B (Section III of Article 6) has been received by the Bureau from 22 November 1997, or for which submission under Article 6 of Appendix 6058 30B 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1.txt  
- and satellite systems also are available. Topography: Australia occupies an area slightly smaller than the contiguous 48 states of the United States. Australia's population is concentrated along the eastern and southeastern coasts. The terrain is mostly low plateau with deserts and fertile plain in the southeast. Fixed Total Fiber Cable DSL Other Fixed broadband subs per 100 inhabitants 24.1 0.1 4.1 19.3 0.7 Fixed broadband subs (June 2010) 5,313,000 % of households with fixed broadband access (2008) 62.0 Mobile Mobile wireless broadband subs per 100 inhabitants 47.1 Mobile wireless broadband subs (June 2010) 10,381,000 2. Austria Regulation: The Austrian Regulatory Authority for Broadcasting and Telecommunications (RTR) (Rundfunk und Telekom Regulierungs-RTR) and the Telecom Control Commission (TKK) share regulatory oversight of the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-732A1_Rcd.pdf  
- 15Id. 7414 Federal Communications Commission DA 11-732 Topography: Australia occupies an area slightly smaller than the contiguous 48 states of the United States. Australia's population is concentrated along the easternand southeastern coasts. The terrain is mostly low plateau with deserts and fertile plain in the southeast. Fixed Total Fiber Cable DSL Other16 Fixed broadband subs per 100 inhabitants17 24.1 0.1 4.1 19.3 0.7 Fixed broadband subs (June 2010)18 5,313,000 % of households with fixed broadband access (2008)19 62.0 Mobile Mobile wireless broadband subs per 100 inhabitants20 47.1 Mobile wireless broadband subs (June 2010)21 10,381,000 16"Other" can include broadband over power lines, satellite, which could be fixed or mobile, and terrestrial fixed wireless. 17OECD Broadband Portal, Table 1d (3) (June 2010) (accessed 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-816A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-816A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-816A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, sections 17.4.1, 17.4.1.1, 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Table 1 and Note 2. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1307(b)(5); Guidelines, Second Memorandum Opinion and Order and Notice of Proposed Rulemaking, 12 FCC Rcd at 13538, 13540. See also, Public 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-944A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-944A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-944A1.txt  
- the costs for testing portable radios. It argues that Sprint has failed to explain why it will pay for the testing of mobile, but not portable, radios. Broward also disputes the TA Mediator's contention that the FRA does not include costs for testing either mobile or portable radios. Thus, it points to the following line item in Schedule C, Section 4.1 of the FRA: Retune Existing Mobile Radios - • Functional Pre-Test of existing radio - Talk group call on system • Retune existing radio (no obstruction to retuning of radio) • Functional post test of existing radio - Talk group call on system (691 units @ 0.70 hrs each @ $118.00 /hr = $57,076.60). Broward notes that Schedule C of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-968A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-968A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-11-968A1.txt  
- be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Roger D. Linquist President and CEO MetroPCS California, LLC ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). 47 C.F.R. §§ 0.111, 0.311. 47 C.F.R. § 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Mark A. Stachiw, Executive Vice President Metro PCS Communications, Inc. (``LOI'') 47 C.F.R. § 4.9(e). 47 C.F.R. § 4.5(b). See LOI. See Letter from J. Christopher Luna, Staff Vice 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-193A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-193A1.txt  
- If the FCC determines that Licensee is in violation of this Second Supplemental Protective Order or this Licensing Agreement, CostQuest may terminate this Licensing Agreement. 3.4.As part of the process, access to the CQBAT may terminate on a periodic basis. Should the Viewer need to maintain access to the CQBAT, CostQuest shall renew the Viewer's access rights. 4.Limitation of Liability 4.1.IN NO EVENT SHALL COSTQUEST HAVE ANY LIABILITY FOR DAMAGES SUSTAINED BY LICENSEE IN CONNECTION WITH TillS LICENSING AGREEMENT, THE PROJECT OR THE POSSESSION OR USE OF LICENSED MATERIALS, INCLUDING, WITHOUT LIMITATION, ANY LOST REVENUES OR PROFITS, OR ANY INDIRECT, CONSEQUENTIAL, EXEMPLARY OR PUNITIVE DAMAGES, EVEN IF COSTQUEST HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 11 Federal Communications Commission 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-377A1.txt  
- public, educational, and governmental (PEG) access; commercial leased access; non-premium regional sports networks; and other non-premium channels. Table 5 Basic Service Channels January 1, 2010 Channel Category Overall Average Non Compet-itive Effective Competition Subgroups Group Second Cable Operator DBS Other Incumbent Rival Both Analog & SD digital 13.6 12.1 16.7 15.0 15.4 15.0 17.2 17.5 HD digital versions 3.8 3.6 4.1 3.8 6.4 4.3 4.1 3.6 Multicast channels 6.6 5.5 9.0 9.9 8.1 9.6 8.9 8.4 Total local broadcast 24.0 21.1 29.8 28.7 29.9 28.9 30.2 29.5 PEG 3.6 3.4 4.1 4.0 5.9 4.3 4.2 2.6 Leased access 1.1 1.0 1.2 1.7 0.6 1.5 1.2 0.8 Regional sports 0.2 0.2 0.3 0.5 0.2 0.5 0.2 0.3 Other 12.0 11.6 12.7 15.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-12-705A2.txt  
- designee, without charge. System and Equipment Inventory Inventory data (hardware model, serial numbers and descriptions) on equipment shall be reported as part of the contractor's annual reporting requirements, as well as any upgrades or replacements, including the license numbers of any Commercial Off-the-Shelf (COTS) software. Contract Data Requirements List (CDRL) (Deliverables) - All CDRLs shall be approved by the FCC. 4.1 Reserved Security Plan The contractor shall furnish a Security Plan within 45 calendar days of contract award per Sections 3.1, 3.7, and 3.16.1. System Documentation Plan The contractor shall furnish a System Documentation Plan within 60 calendar days of contract award per Section 3.19. Disaster/Continuity of Operations Plan The contractor shall furnish a Disaster/Continuity of Operations Plan within 60 calendar 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-96-1514A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-96-1514A1.txt  
- By this Order, we grant a request by Directsat Corporation ("Directsat"), a permittee hi the Direct Broadcast Satellite ("DBS") service, to modify its DBS authorization to use fixed-satellite service ("FSS") frequencies, on a non-conforming basis, in the 3698.3- 3699.7 MHz, 5923.0-5924.0 MHz, and 6426.0-6427.0 MHz bands for all on-orbit telemetry, tracking and control ("TT&C") functions on its DBS space station, USABSS-4.1 H. BACKGROUND 2. In November 1993, the Commission awarded orbital/channel assignments to Directsat at the 118.8 W.L. orbital location for its eastern DBS satellite, USABSS-4. At that time, Directsat planned to use C-band frequencies for launch and ascent operations and Ku-band frequencies for on-orbit TT&C functions. TT&C functions are required by all spacecraft for orbital maneuvers and spacecraft control operations. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-179846A1.txt  
- Compliance. TMI agrees that it is obligated to comply with the Communications Assistance for Law Enforcement Act (47 U.S.C. § 1001 et seq.) and will timely modify the switch employed at the TMI U.S. POP or other TMI U.S. facility to provide the capabilities and capacity required for compliance with the Act. ARTICLE IV REPORTING, ASSISTANCE, AND ACCESS TO INFORMATION 4.1 Access to Information. In response to reasonable requests made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-184137A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-184137A1.txt  
- Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY RO WEE209 085-07-14.8 W 0000063110 KENTUCKY, COMMONWEALTH OF SHELBYVILLE 12/28/1999 06735.00000 38-10-30.2 N KY RO WEE209 085-07-14.8 W 0000063110 KENTUCKY, COMMONWEALTH OF SHELBYVILLE 12/28/1999 06835.00000 38-10-30.2 N KY RO WEE383 083-26-04.6 W 0000063111 KENTUCKY, COMMONWEALTH OF MOREHEAD 12/28/1999 06835.00000 38-11-14.2 N HI RO WNTB408 157-53-04.1 W 0000063364 HONOLULU PUBLIC TRANSIT AUTHORITY HONOLULU 12/10/1999 21925.00000 21-20-12.6 N KY RO WED969 082-31-11.5 W 0000063392 KENTUCKY, COMMONWEALTH OF PIKEVILLE 10/22/1999 02192.80000 37-29-31.3 N KY RO WED969 082-31-11.5 W 0000063392 KENTUCKY, COMMONWEALTH OF PIKEVILLE 10/22/1999 02194.40000 37-29-31.3 N KY RO WED975 088-17-42.1 W 0000063393 KENTUCKY, COMMONWEALTH OF SALEM 10/22/1999 06805.00000 37-14-13.1 N KY RO WED975 088-17-42.1 W 0000063393 KENTUCKY, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202342A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202342A1.txt  
- 0000088219 Aquasource, Inc. Cedar Hill 02/22/2000 00956.28125 32-35-30.1 N TX NE P 096-53-59.2 W 0000088220 Aquasource, Inc. VICTORIA 02/22/2000 00956.26875 28-43-57.8 N TX NE P 095-41-12.0 W 0000088222 Aquasource, Inc. CONROE 02/22/2000 00956.26875 30-16-46.7 N TX NE P 095-41-12.0 W 0000089796 Aquasource, Inc. Palestine 02/22/2000 00956.30625 32-02-34.1 N TX NE P 097-53-51.6 W 0000089880 AquaSource, Inc. Agua Dulce 02/22/2000 00956.31875 27-51-04.1 N TX NE P 097-35-04.6 W 0000090164 Aquasource, Inc. Weatherford 02/22/2000 00956.28125 32-58-27.4 N TX NE P 094-44-50.9 W 0000090170 Aquasource, Inc. Longview 02/22/2000 00956.30625 32-35-30.1 N NM NE 103-07-23.3 W 0000107208 Public Service Company of New MexicoHOBBS 04/04/2000 00932.28125 32-40-02.6 N NM NE 103-07-23.3 W 0000107208 Public Service Company of New MexicoHOBBS 04/04/2000 00941.28125 32-40-02.6 N NM NE 104-11-15.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202472A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202472A1.txt  
- Points of Communication: 1 - INTELSAT 805 - (304.5 E.L.) E000167 SES-LIC-20000418-00591 CLEAR CHANNEL BROADCASTING LICENSES, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 38 ° 11 ' 44.00 " N LAT. SITE ID: 1 4421 BISHOP LANE, JEFFERSON, LOUISVILLE, KY 85 ° 41 ' 8.00 " W LONG. LOCATION: COMSAT 1 4.1 meters ANTENNA ID: OFFSAT C60551 55.59 dBW QPSK - VOICE 5925.0000 - 6425.0000 MHz 320KG7W 49.58 dBW QPSK - VOICE 5925.0000 - 6425.0000 MHz 50K0F3E QPSK - VOICE 3700.0000 - 4200.0000 MHz 320KG7W QPSK - VOICE 3700.0000 - 4200.0000 MHz 50K0F3E Points of Communication: 1 - ALSAT - (ALSAT) E000203 SES-LIC-20000424-00670 SABIL UPLINK COMMUNICATIONS, LLC Application for Authority Class of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202481A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-202481A1.txt  
- W 0000122896 BACKLINK LLC New York 05/03/2000 21775.00000 40-45-12.5 N NY NE 073-59-15.5 W 0000122896 BACKLINK LLC New York 05/03/2000 21775.00000 40-45-12.5 N NY NE 073-58-51.8 W 0000122897 BACKLINK LLC New York 05/03/2000 22575.00000 40-45-09.0 N NY NE 073-58-58.1 W 0000122898 BACKLINK LLC New York 05/03/2000 22825.00000 40-45-00.0 N NY NE 073-59-08.1 W 0000122899 BACKLINK LLC New York 05/03/2000 22625.00000 40-45-04.1 N NY NE 073-59-22.7 W 0000122900 BACKLINK LLC New York 05/03/2000 22575.00000 40-45-06.0 N NY NE 073-59-19.4 W 0000122901 BACKLINK LLC New York 05/03/2000 22925.00000 40-45-07.6 N NY NE 073-59-23.9 W 0000122902 BACKLINK LLC New York 05/03/2000 22725.00000 40-45-21.1 N NY NE 073-58-43.8 W 0000122903 BACKLINK LLC New York 05/03/2000 22425.00000 40-45-20.1 N NY NE 073-59-34.5 W 0000122904 BACKLINK LLC 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203523A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203523A1.txt  
- - 14500.0000 MHz 286KG1D DIGITAL, QPSK, FEC 7/8 11700.0000 - 12200.0000 MHz 286KG1D Points of Communication: HUB - ALSAT - (ALSAT) REMOTE 1 - ALSAT - (ALSAT) E000269 SES-LIC-20000606-00903 FARLINK SATELLITE SERVICES, INC. Application for Authority Class of Station: Temporary Fixed Earth Station Page 1 of 9 Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.00 dBW DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 3M00G7F- 72.40 dBW DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 36M0G7F 72.40 dBW ANALOG VIDEO W/ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E000270 SES-LIC-20000606-00912 CONUS COMMUNICATIONS COMPANY LIMITED PARTNERSHIP Application for Authority Class of Station: Temporary Fixed Earth Station Nature 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203818A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203818A1.txt  
- 40-49-46.7 N VA NE 077-34-36.0 W 0000175273 Capstar TX Limited Partnership RICHMOND 06/26/2000 00947.00000 37-30-32.0 N VA NE 077-35-00.0 W 0000176441 Capstar TX Limited Partnership Richmond 06/27/2000 00945.50000 37-30-00.0 N UT NE 111-56-33.4 W 0000176637 Citicasters Co. Salt Lake City 06/26/2000 00945.70000 40-42-36.0 N CO NE 106-02-42.1 W 0000176644 Grand County Wireless Inc Dillon 06/26/2000 00948.50000 39-37-42.0 N CO NE 106-04-04.1 W 0000176645 Grand County Wireless Inc Dillon 06/26/2000 00948.37500 39-36-50.0 N UT NE 111-56-33.4 W 0000176648 Citicasters Co. Salt Lake City 06/26/2000 00945.30000 40-42-36.0 N VA NE 077-34-36.0 W 0000177330 Capstar TX Limited Partnership RICHMOND 06/27/2000 00951.00000 37-30-32.0 N VA NE 077-35-00.0 W 0000177393 Capstar TX Limited Partnership Richmond 06/27/2000 00950.50000 37-30-00.0 N VA NE 077-34-36.0 W 0000177421 Capstar TX 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203907A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-203907A1.txt  
- W 0000168723 BACKLINK LLC BALTIMORE 06/19/2000 22925.00000 39-17-18.1 N MD NE 076-34-54.4 W 0000168724 BACKLINK LLC BALTIMORE 06/19/2000 22775.00000 39-16-54.1 N MD NE 076-36-43.1 W 0000168725 BACKLINK LLC BALTIMORE 06/19/2000 22425.00000 39-17-21.3 N MD NE 076-36-42.4 W 0000168726 BACKLINK LLC BALTIMORE 06/19/2000 22525.00000 39-17-19.6 N IL NE 087-58-57.4 W 0000168734 BACKLINK LLC ARLINGTON HTS. 06/19/2000 19600.00000 42-08-14.2 N IL NE 087-59-04.1 W 0000168735 BACKLINK LLC ARLINGTON HTS. 06/19/2000 18040.00000 42-08-08.9 N OH NE 082-59-52.4 W 0000168737 KATLINK LLC Columbus 06/19/2000 17920.00000 39-58-29.2 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH NE 083-02-43.7 W 0000168738 KATLINK LLC Columbus 06/19/2000 17800.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204216A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204216A1.txt  
- - (ALSAT) 1 - ANIK - 1 - MOR/SOL - 1 - SATMEX-5 - (116.8 W.L.) E970071 SES-MOD-20000628-01088 WCTV LICENSEE CORP. Application for Modification Class of Station: Temporary Fixed Earth Station Nature of Service:Domestic Fixed Satellite Service "MOD" to add new emission designator and related service and to increase EIRP and EIRP density. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" (OFFSAT) 72.40 dBW 5945.0000 - 6405.0000 MHz 36M0F3F Page 9 of 12 35.90 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 4M00G7W- 35.90 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E980367 SES-MOD-20000705-01101 THE RACING NETWORK, LLC Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Domestic 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204615A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204615A1.txt  
- MD KYR23 078-42-20.0 W 0000195450 NORTH CAROLINA, STATE OF NC HIGHWAY PATROL RALEIGH 07/27/2000 06680.00000 35-47-56.5 N NC MD KYR23 078-42-20.0 W 0000195450 NORTH CAROLINA, STATE OF NC HIGHWAY PATROL RALEIGH 07/27/2000 06695.00000 35-47-56.5 N TN NE 084-10-32.7 W 0000192858 Tennessee, State of LA FOLLETTE 07/21/2000 00954.30000 36-24-35.3 N IN NE 086-53-27.0 W 0000192920 Lafayette Police Dept LAFAYETTE 07/24/2000 02144.40000 40-25-04.1 N IN NE 086-52-56.0 W 0000192926 Lafayette Police Dept LAFAYETTE 07/24/2000 02138.00000 40-26-52.1 N CA NE 118-23-44.4 W 0000192928 California, State of BISHOP 07/18/2000 18665.00000 37-21-26.7 N CA NE 119-23-39.4 W 0000193012 Berkley Petroleum Inc. Buttonwillow 07/25/2000 00953.05000 35-24-09.9 N GA NE 084-26-21.2 W 0000193404 HARTSFIELD ATLANTA INTERNATIONAL AIRPORT ATLANTA 07/25/2000 21825.00000 33-38-27.1 N GA NE 084-26-21.2 W 0000193404 HARTSFIELD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204800A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-204800A1.txt  
- 08/04/2000 02128.00000 42-53-01.0 N IA MD WPND636 091-24-39.0 W 0000200510 IOWA RSA NO. 12 LIMITED PARTNERSHIP ELKADER 08/04/2000 06815.00000 42-53-01.0 N CA MD WPJC212 120-26-32.7 W 0000200542 CALIFORNIA RSA NO 3 LIMITED PARTNERSHIP JAMESTOWN 08/04/2000 05945.20000 - 06197.24000 37-56-16.7 N CA MD WPJC212 120-26-32.7 W 0000200542 CALIFORNIA RSA NO 3 LIMITED PARTNERSHIP JAMESTOWN 08/04/2000 05994.62000 37-56-16.7 N WA MD WPJB542 119-53-04.1 W 0000200715 WESTERN SUB RSA LIMITED PARTNERSHIP BEVERLY 08/04/2000 02121.60000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0000200715 WESTERN SUB RSA LIMITED PARTNERSHIP BEVERLY 08/04/2000 06855.62500 46-48-55.4 N PR MD WMK681 065-56-35.8 W 0000200786 SAN JUAN CELLULAR TELEPHONE COMPANY GURABO 08/04/2000 06063.80000 18-16-46.4 N PR MD WMK681 065-56-35.8 W 0000200786 SAN JUAN CELLULAR TELEPHONE COMPANY GURABO 08/04/2000 11525.00000 18-16-46.4 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205600A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205600A1.txt  
- Inc. SOMERVILLE 08/31/2000 17935.00000 42-23-02.0 N CA NE 114-39-16.9 W 0000212839 Los Angeles SMSA Limited Partnership San Bernardino 08/31/2000 10626.25000 34-17-03.0 N AR NE 092-10-07.5 W 0000212893 Nextel Partners, Inc. JEFFERSON 08/31/2000 06585.00000 34-22-12.3 N AR NE 092-07-22.9 W 0000212900 Nextel Partners, Inc. WHITE HALL 08/31/2000 06745.00000 34-17-10.4 N CA NE 117-08-25.1 W 0000213378 BACKLINK LLC SAN DIEGO 09/01/2000 21725.00000 32-46-04.1 N CA NE 117-09-30.7 W 0000213379 BACKLINK LLC SAN DIEGO 09/01/2000 21625.00000 32-46-40.9 N WA NE 122-20-32.7 W 0000213383 BACKLINK LLC SEATTLE 09/01/2000 19360.00000 47-37-31.7 N PA NE 075-09-56.4 W 0000213430 Teligent License Company II, L.L.C. Philadelphia 09/01/2000 19600.00000 39-57-12.2 N Page 44 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205762A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205762A1.txt  
- 073-59-33.6 W 0000215426 New York 09/07/2000 40-43-59.7 N CO 105-00-15.3 W 0000215561 BACKLINK LLC 09/07/2000 22975.00000 39-45-05.1 N NE 105-00-58.9 W 0000215564 Denver 09/07/2000 22925.00000 CO NE 0000215565 BACKLINK LLC Denver 09/07/2000 22875.00000 39-45-13.3 N CO 104-59-25.8 W 0000215566 BACKLINK LLC 09/07/2000 22625.00000 39-44-49.8 N NE 105-00-13.1 W 0000215567 Denver 09/07/2000 22475.00000 CO NE 0000215568 BACKLINK LLC Denver 09/07/2000 22775.00000 39-45-04.1 N CO 104-59-26.7 W 0000215569 BACKLINK LLC 09/07/2000 22675.00000 39-44-40.0 N NE 104-59-40.1 W 0000215570 Denver 09/07/2000 22775.00000 CA NE 0000215598 Pacific Satellite Connection, Inc. Sacramento 09/07/2000 23075.00000 38-35-46.0 N IN 086-09-13.7 W 0000215599 KATLINK LLC 09/07/2000 19360.00000 39-55-41.9 N NE 086-09-13.7 W 0000215599 Indianapolis 09/07/2000 19400.00000 IN NE 0000215599 KATLINK LLC Indianapolis 19440.00000 39-55-41.9 N IN NE 0000215599 KATLINK 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205915A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-205915A1.txt  
- N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10815.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10855.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10895.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10975.00000 33-01-26.1 N CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 10935.00000 33-02-30.2 N CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 10935.00000 33-02-30.2 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206274A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206274A1.txt  
- Wireless Fiber Corp. WASHINGTON 09/26/2000 11405.00000 38-59-06.4 N CA NE 118-31-16.3 W 0000226030 KATLINK LLC Encino 09/26/2000 19680.00000 34-09-49.9 N CA NE 118-32-07.5 W 0000226031 KATLINK LLC Tarzana 09/26/2000 19600.00000 34-10-21.4 N CA NE 118-32-04.4 W 0000226032 KATLINK LLC Tarzana 09/26/2000 21275.00000 34-10-21.1 N DC NE 077-13-38.9 W 0000226037 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 10835.00000 38-55-20.4 N FL NE 080-08-04.1 W 0000226039 KATLINK LLC Miami Beach 09/26/2000 18120.00000 25-46-27.2 N DC NE 077-07-04.9 W 0000226075 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 11325.00000 38-53-00.4 N DC NE 077-13-38.9 W 0000226088 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 10715.00000 38-55-20.4 N DC NE 077-21-25.9 W 0000226089 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 11215.00000 38-57-15.4 N DC NE 077-13-38.9 W 0000226090 Winstar Wireless Fiber 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206369A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206369A1.txt  
- 44-11-39.6 N CA MD WPNM783 119-47-45.0 W 0000234756 Illinois Lotus Corp. Fresno 10/06/2000 00947.50000 36-45-26.0 N CA MD WPNM783 119-47-45.0 W 0000234756 Illinois Lotus Corp. Fresno 10/06/2000 00947.50000 36-45-26.0 N SC NE 078-39-36.0 W 0000230721 Educational Media Foundation LITTLE RIVER 09/22/2000 00947.00000 33-51-23.5 N CO NE 106-02-42.1 W 0000231214 Grand County Wireless Inc Dillon 10/02/2000 00948.50000 39-37-42.0 N CO NE 106-04-04.1 W 0000231215 Grand County Wireless Inc Dillon 10/02/2000 00948.37500 39-36-50.0 N KS NE 099-19-49.0 W 0000234816 Radio, Inc. HAYS 10/02/2000 00951.00000 38-52-27.0 N KS NE 099-19-49.0 W 0000234817 Radio, Inc. HAYS 10/02/2000 00948.00000 38-52-27.0 N MD NE 076-04-06.5 W 0000234855 CWA BROADCASTING INC EASTON 10/02/2000 00948.01250 38-45-01.6 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206584A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206584A1.txt  
- 03890.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 03970.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 04050.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 04130.00000 32-43-36.1 N AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03770.00000 33-03-04.1 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03770.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03850.00000 33-03-04.1 N AZ MD KPK30 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206771A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206771A1.txt  
- WNUB779 120-38-37.6 W 0000243051 PAGING NETWORK OF SAN FRANCISCO INC IDRIA 10/19/2000 00929.46250 36-22-06.8 N CA RM WNUB779 119-17-00.4 W 0000243051 PAGING NETWORK OF SAN FRANCISCO INC SQUAW VALLEY 10/19/2000 00929.46250 36-44-35.8 N CA RM WPIY397 117-02-25.1 W 0000243367 AIRSTAR PAGING INC BARSTOW 10/19/2000 00929.08750 34-58-16.9 N CA RM WPIY397 116-26-01.0 W 0000243367 AIRSTAR PAGING INC PALM SPRINGS 10/19/2000 00929.08750 33-52-04.1 N CA RM WPIY397 118-34-55.3 W 0000243367 AIRSTAR PAGING INC SAN FERNANDO 10/19/2000 00929.08750 34-19-26.0 N CA RM WPIY397 118-34-55.3 W 0000243367 AIRSTAR PAGING INC SAN FERNANDO 10/19/2000 00929.08750 34-19-26.0 N CA RM WPIY397 118-54-27.3 W 0000243367 AIRSTAR PAGING INC THOUSAND OAKS 10/19/2000 00929.08750 34-09-52.0 N CA RM WPIY397 117-17-20.2 W 0000243367 AIRSTAR PAGING INC VICTORVILLE 10/19/2000 00929.08750 34-36-38.0 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206940A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-206940A1.txt  
- 00929.76250 38-31-39.2 N HI RM WPIW590 157-51-33.1 W 0000245107 PAGEMART II INC HONOLULU 09/08/2000 00929.76250 21-18-44.6 N TX RM WPIW590 096-59-00.0 W 0000245107 PAGEMART II INC LEWISVILLE 09/08/2000 00929.76250 33-00-20.4 N Page 27 GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX RM WPIW590 098-28-04.1 W 0000245107 PAGEMART II INC PLEASANTON 09/08/2000 00929.76250 28-58-28.9 N LA RM WPIW590 090-36-45.3 W 0000245107 PAGEMART II INC RACELAND 09/08/2000 00929.76250 29-42-30.8 N TX RM WPIW610 097-25-02.1 W 0000245119 PAGEMART II INC FORT WORTH 09/08/2000 00929.66250 32-43-27.3 N IL RM WPIW610 090-36-31.5 W 0000245119 PAGEMART II INC MONMOUTH 09/08/2000 00929.66250 40-53-25.1 N HI RM WPIW610 155-10-57.0 W 0000245119 PAGEMART 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207245A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207245A1.txt  
- W 0000252731 BACKLINK LLC LAKEWOOD 11/03/2000 21525.00000 39-42-51.6 N Page 48 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO NE 105-05-12.4 W 0000252732 BACKLINK LLC LAKEWOOD 11/03/2000 21225.00000 39-42-38.0 N AK RM WAH393 146-23-39.2 W 0000252599 ALASCOM, INC. VALDEZ 11/03/2000 02162.40000 61-05-04.1 N AK RM WAH393 146-23-39.2 W 0000252599 ALASCOM, INC. VALDEZ 11/03/2000 06121.24700 61-05-04.1 N AK RM WAH393 146-23-39.2 W 0000252599 ALASCOM, INC. VALDEZ 11/03/2000 06152.80000 61-05-04.1 N RO WPNN426 0000250603 NORTHERN BORDER PIPELINE COMPANY 11/01/2000 RO WLR388 0000252115 CALIFORNIA RSA NO. 4 LIMITED PARTNERSHIP 11/03/2000 RO WLV665 0000252116 CALIFORNIA RSA NO. 4 LIMITED PARTNERSHIP 11/03/2000 RO WLV666 0000252117 CALIFORNIA RSA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207434A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207434A1.txt  
- BACKLINK LLC Long Beach 11/09/2000 19600.00000 33-48-29.5 N CA NE 118-08-46.9 W 0000257449 BACKLINK LLC Long Beach 11/09/2000 19640.00000 33-48-29.5 N CA NE 118-08-44.6 W 0000257450 BACKLINK LLC Long Beach 11/09/2000 18000.00000 33-48-26.8 N NJ NE 074-56-20.9 W 0000257535 KATLINK LLC Marlton 11/09/2000 19480.00000 39-54-35.8 N NJ NE 074-56-20.7 W 0000257536 KATLINK LLC Marlton 11/09/2000 17920.00000 39-54-34.9 N WA NE 122-21-04.1 W 0000257546 BACKLINK LLC Seattle 11/09/2000 18040.00000 47-36-56.3 N IN NE 086-09-25.0 W 0000257605 Winstar Wireless Fiber Corp. Indianapolis 11/09/2000 17760.00000 39-46-10.2 N Page 24 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN NE 086-09-25.0 W 0000257605 Winstar Wireless Fiber Corp. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207700A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-207700A1.txt  
- 075-11-38.0 W 0000263585 WILCO ELECTRONIC SYSTEMS INC PHILADELPHIA 11/16/2000 18145.00000 - 18577.00000 39-57-59.0 N PA NE 075-11-38.0 W 0000263585 WILCO ELECTRONIC SYSTEMS INC PHILADELPHIA 11/16/2000 18145.00000 - 18577.00000 39-57-59.0 N CA NE 119-46-23.3 W 0000263653 NEXTEL OF CALIFORNIA, INC FRESNO 11/16/2000 06750.00000 36-37-18.3 N CA NE 119-46-23.3 W 0000263653 NEXTEL OF CALIFORNIA, INC FRESNO 11/16/2000 06830.00000 36-37-18.3 N MO NE 093-05-04.1 W 0000263656 THE BURLINGTON NORTHERN AND SANTA FE RAILWAY CO Seymour 11/16/2000 06226.89000 37-16-08.4 N MO NE 093-05-04.1 W 0000263656 THE BURLINGTON NORTHERN AND SANTA FE RAILWAY CO Seymour 11/16/2000 06345.49000 37-16-08.4 N NY NE 077-42-05.7 W 0000263662 NEW YORK STATE ELECTRIC & GAS CORPORATION Dansville 11/16/2000 06585.00000 42-33-39.8 N NY NE 077-59-51.9 W 0000263663 NEW YORK STATE ELECTRIC & 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208209A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208209A1.txt  
- SOUTHERN ILLINOIS JOHNSTON CITY 12/06/2000 02128.00000 37-47-35.1 N Page 18 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPNC455 088-00-22.1 W 0000285196 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS GRAYVILLE 12/06/2000 02174.80000 38-14-53.1 N IL MD WMS899 088-26-04.1 W 0000285227 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS CISNE 12/06/2000 06226.89000 38-30-21.1 N IL MD WMS899 088-26-04.1 W 0000285227 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS CISNE 12/06/2000 06685.00000 38-30-21.1 N IL MD WMK706 089-00-49.2 W 0000285234 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS BENTON 12/06/2000 06226.89000 38-02-14.1 N IL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208420A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208420A1.txt  
- WMQ967 079-53-14.1 W 0000291326 VIRGINIA RSA #4, INC. ROCKY MOUNTAIN 12/13/2000 06063.80000 36-54-02.5 N VA MD WMQ967 079-53-14.1 W 0000291326 VIRGINIA RSA #4, INC. ROCKY MOUNTAIN 12/13/2000 06063.80000 36-54-02.5 N VA MD WMQ967 079-53-14.1 W 0000291326 VIRGINIA RSA #4, INC. ROCKY MOUNTAIN 12/13/2000 06585.00000 36-54-02.5 N CA MD WMQ712 118-11-22.3 W 0000291382 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 12/13/2000 10551.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000291382 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 12/13/2000 10553.75000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000291382 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 12/13/2000 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000291382 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 12/13/2000 10563.75000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000291382 LOS ANGELES SMSA LIMITED PARTNERSHIP 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208607A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208607A1.txt  
- SACRAMENTO, COUNTY OF SACRAMENTO 11/21/2000 06625.00000 38-25-20.6 N CA MD WPOM422 121-21-21.8 W 0000299102 SACRAMENTO, COUNTY OF SACRAMENTO 11/21/2000 06635.00000 38-25-20.6 N Page 91 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPOL382 117-05-26.1 W 0000300797 San Diego, County of Escondido 12/19/2000 06745.62500 33-07-04.1 N CA MD WPNC669 116-10-31.0 W 0000301530 SAN DIEGO, COUNTY OF OCOTILLO WELLS 12/19/2000 00933.37500 33-08-58.1 N AZ NE 112-22-56.0 W 0000297695 PRESCOTT VALLEY WATER DISTRICTPRESCOTT VALLEY 11/21/2000 00932.30625 34-35-24.0 N AZ NE 112-22-56.0 W 0000297695 PRESCOTT VALLEY WATER DISTRICTPRESCOTT VALLEY 11/21/2000 00941.30625 34-35-24.0 N UT NE 111-55-01.7 W 0000299006 Salt Lake County of SOUTH SALT LAKE 11/17/2000 06695.00000 40-41-49.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208868A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-208868A1.txt  
- W 0000314221 KATLINK LLC Miami 01/05/2001 19400.00000 25-46-54.6 N FL NE 080-20-10.0 W 0000314222 KATLINK LLC Miami 01/05/2001 17840.00000 25-48-31.5 N FL NE 080-20-10.0 W 0000314222 KATLINK LLC Miami 01/05/2001 17920.00000 25-48-31.5 N FL NE 080-18-51.2 W 0000314223 KATLINK LLC Miami 01/05/2001 19480.00000 25-46-53.5 N FL NE 080-15-39.8 W 0000314248 KATLINK LLC Coral Springs 01/05/2001 17800.00000 26-16-17.9 N FL NE 080-15-04.1 W 0000314249 KATLINK LLC Coral Springs 01/05/2001 19360.00000 26-16-17.7 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 080-17-13.1 W 0000314267 KATLINK LLC Miami 01/05/2001 17800.00000 25-42-33.8 N FL NE 080-16-24.4 W 0000314268 KATLINK LLC Miami 01/05/2001 19360.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209174A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209174A1.txt  
- MHz 26M0G7W SATCOM TECH 2 9.2 meters ANTENNA ID: 920CS 80.00 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 80.00 dBW 5925.0000 - 6425.0000 MHz 4M50G1W 80.00 dBW 5925.0000 - 6425.0000 MHz 9M00G1W 80.00 dBW 5925.0000 - 6425.0000 MHz 26M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 4M59G1W 3700.0000 - 4200.0000 MHz 9M00G1W 3700.0000 - 4200.0000 MHz 26M0G7W COMTECH 3 4.1 meters ANTENNA ID: "18FT" OFFSAT-847130 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F Page 3 of 31 75.70 dBW 5925.0000 - 6425.0000 MHz 4M50G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 9M00G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 26M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 4M59G1W 3700.0000 - 4200.0000 MHz 9M00G1W 3700.0000 - 4200.0000 MHz 26M0G7W COMTECH 4 4.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209306A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209306A1.txt  
- MSAT-1 - (106.5 W.L.) E010012 SES-LIC-20010111-00064 MOTOR RACING NETWORK, INC. ( d/b/a MRN RADIO ) Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 29 ° 11 ' 15.00 " N LAT. SITE ID: 1 1801 WEST INTERNATIONAL SPEEDWAY BLVD., VOLUSIA, DAYTONA, FL 81 ° 4 ' 15.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 52.90 dBW ANALOG FM 5925.0000 - 6425.0000 MHz 200KF3E 52.90 dBW DIGITAL, QPSK, 192 KBPS, 1/2 FEC 5925.0000 - 6425.0000 MHz 230KG7W ANALOG FM 3700.0000 - 4200.0000 MHz 200KF3E Page 1 of 5 DIGITAL, QPSK, 192 KBPS, 1/2 FEC 3700.0000 - 4200.0000 MHz 230KG7W Points of Communication: 1 - ALSAT - (ALSAT) E900071 SES-LIC-20010112-00068 KMOV-TV, INC. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209312A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209312A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209312A1.txt  
- CORRECTION TO PUBLIC NOTICE FCC 01-11 REGARDING MERGER BETWEEN AMERICA ONLINE, INC. AND TIME WARNER, INC. On January 11, 2001, the Commission released a Public Notice, FCC 01-11 (``Subject to Conditions, Commission Approves Merger Between America Online, Inc. and Time Warner, Inc.''). In the Public Notice, the paragraph immediately following the heading ``Instant Messaging'' uses the phrase ``such as AIM 4.1.'' This phrase should be amended to read ``such as AIM 4.3'' so that it conforms with the ordering clauses of the Memorandum Opinion and Order released January 22, 2001 [FCC 01-12] in CS Docket No. 00-30. Media Contact: Nancy Stevenson 202-418-7200 --FCC-- (...continued from previous page) (continued...) New Conditions as of 1/11/01 PRIVILEGED AND CONFIDENTIAL - FOR INTERNAL USE ONLY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209552A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-209552A1.txt  
- New York 01/23/2001 22925.00000 40-45-07.1 N NY MD WPQQ309 073-59-24.9 W 0000340400 BACKLINK LLC New York 01/23/2001 22925.00000 40-45-07.1 N NY MD WPQQ316 073-59-10.9 W 0000340401 BACKLINK LLC New York 01/23/2001 22475.00000 40-45-09.8 N NY MD WPQQ316 073-59-10.9 W 0000340401 BACKLINK LLC New York 01/23/2001 22475.00000 40-45-09.8 N NY MD WPQQ328 073-59-08.1 W 0000340403 BACKLINK LLC New York 01/23/2001 22625.00000 40-45-04.1 N NY MD WPQQ328 073-59-08.1 W 0000340403 BACKLINK LLC New York 01/23/2001 22625.00000 40-45-04.1 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD WPQQ313 073-59-03.6 W 0000340404 BACKLINK LLC New York 01/23/2001 22875.00000 40-45-00.7 N NY MD WPQQ313 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210072A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210072A1.txt  
- 42-19-06.0 N GA NE 084-20-58.5 W 0000361840 BACKLINK LLC Atlanta 02/08/2001 17760.00000 33-54-43.3 N TX NE 095-31-04.5 W 0000362184 BACKLINK LLC Houston 02/08/2001 19560.00000 29-42-06.6 N TX NE 095-29-47.8 W 0000362185 BACKLINK LLC Houston 02/08/2001 19360.00000 29-42-50.0 N TX NE 095-31-04.5 W 0000362187 BACKLINK LLC Houston 02/08/2001 19560.00000 29-42-06.6 N AZ NE 111-55-34.9 W 0000362501 BACKLINK LLC Scottsdale 02/08/2001 19520.00000 33-32-04.1 N AZ NE 111-55-29.1 W 0000362502 BACKLINK LLC Scottsdale 02/08/2001 19400.00000 33-32-40.6 N TX NE 095-24-16.5 W 0000362728 KATLINK LLC Houston 02/08/2001 22575.00000 29-42-21.8 N TX NE 095-24-03.2 W 0000362729 KATLINK LLC Houston 02/08/2001 21375.00000 29-41-31.8 N CA NE 117-19-00.9 W 0000362832 BACKLINK LLC Carlsbad 02/08/2001 22825.00000 33-06-56.6 N CA NE 117-19-04.2 W 0000362833 BACKLINK LLC Carlsbad 02/08/2001 21425.00000 33-07-47.7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210629A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210629A1.txt  
- 2 9.2 meters ANTENNA ID: 920CS 80.00 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 80.00 dBW 5925.0000 - 6425.0000 MHz 4M50G1W 80.00 dBW 5925.0000 - 6425.0000 MHz 9M00G1W 80.00 dBW 5925.0000 - 6425.0000 MHz 26M0G7W Page 1 of 10 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 4M59G1W 3700.0000 - 4200.0000 MHz 9M00G1W 3700.0000 - 4200.0000 MHz 26M0G7W COMTECH 3 4.1 meters ANTENNA ID: "18FT" OFFSAT-847130 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 75.70 dBW 5925.0000 - 6425.0000 MHz 4M50G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 9M00G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 26M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 4M59G1W 3700.0000 - 4200.0000 MHz 9M00G1W 3700.0000 - 4200.0000 MHz 26M0G7W COMTECH 4 4.1 meters ANTENNA ID: "18FT" 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210801A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-210801A1.txt  
- Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL AM WPAD752 080-04-14.0 W D146520 PAGEMART II INC BOCA RATON 02/26/2001 00929.71250 26-20-41.0 N FL AM WPAD752 080-07-50.2 W D146520 PAGEMART II INC NORTH MIAMI BEACH 02/26/2001 00929.71250 25-57-14.3 N FL AM WPAD752 080-18-50.0 W D146520 PAGEMART II INC SOUTH MIAMI 02/26/2001 00929.71250 25-41-07.0 N FL AM WPAD752 080-03-04.1 W D146520 PAGEMART II INC WEST PALM BEACH 02/26/2001 00929.71250 26-42-01.2 N FL AM WPAD753 080-04-14.0 W D146521 PAGEMART II INC BOCA RATON 02/26/2001 00929.66250 26-20-41.0 N FL AM WPAD753 080-07-50.2 W D146521 PAGEMART II INC NORTH MIAMI BEACH 02/26/2001 00929.66250 25-57-14.3 N FL AM WPAD753 080-18-50.0 W D146521 PAGEMART II INC SOUTH MIAMI 02/26/2001 00929.66250 25-41-07.0 N FL AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211021A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211021A1.txt  
- SAN DIEGO 03/08/2001 18000.00000 32-46-50.6 N CA MD WPQW477 117-08-09.8 W 0000391432 BACKLINK LLC SAN DIEGO 03/08/2001 18080.00000 32-46-50.6 N CA MD WPQW477 117-08-09.8 W 0000391432 BACKLINK LLC SAN DIEGO 03/08/2001 18080.00000 32-46-50.6 N CA MD WPQW477 117-08-09.8 W 0000391432 BACKLINK LLC SAN DIEGO 03/08/2001 18120.00000 32-46-50.6 N CA MD WPQW478 117-08-25.1 W 0000391434 BACKLINK LLC SAN DIEGO 03/08/2001 19480.00000 32-46-04.1 N CA MD WPQW479 117-09-31.9 W 0000391435 BACKLINK LLC SAN DIEGO 03/08/2001 19440.00000 32-46-39.6 N CA MD WPQR496 117-08-15.5 W 0000391436 BACKLINK LLC SAN DIEGO 03/08/2001 19360.00000 32-46-07.8 N CA MD WPQR497 117-08-09.9 W 0000391437 BACKLINK LLC SAN DIEGO 03/08/2001 19640.00000 32-46-04.3 N CA MD WPQR498 117-07-50.0 W 0000391438 BACKLINK LLC SAN DIEGO 03/08/2001 19480.00000 32-46-17.0 N CA MD WPQR499 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211420A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-211420A1.txt  
- 0000396037 The Burlington Northern and Santa Fe Railway Co Pompey's Pillar 03/21/2001 06835.00000 46-01-46.8 N WY AM 105-58-02.0 W 0000396733 Warner, Mark K Echeta 03/22/2001 00932.28125 44-29-44.4 N WY AM 105-58-02.0 W 0000396733 Warner, Mark K Echeta 03/22/2001 00941.28128 44-29-44.4 N AZ MD WEF501 111-38-14.5 W 0000379821 SALT RIVER PROJECT AGRICULTURAL IMPROVEMENT & POWER DISTRICT (dba SRP) CAREFREE 03/19/2001 06705.00000 33-49-04.1 N AZ MD WEE446 111-02-15.1 W 0000400924 SALT RIVER PROJECT AGRICULTURAL & POWER DISTRICT (dba SRP ) SUPERIOR 03/19/2001 06565.00000 33-20-18.9 N AZ MD WEE446 111-02-15.1 W 0000400924 SALT RIVER PROJECT AGRICULTURAL & POWER DISTRICT (dba SRP ) SUPERIOR 03/19/2001 06566.25000 33-20-18.9 N AZ MD WEE446 111-02-15.1 W 0000400924 SALT RIVER PROJECT AGRICULTURAL & POWER DISTRICT (dba SRP ) SUPERIOR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212302A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212302A1.txt  
- Northern and Santa Fe Railway Co Trego 03/28/2001 06745.00000 48-38-33.8 N MT MD WAH711 115-05-30.5 W 0000410254 The Burlington Northern and Santa Fe Railway Co Trego 03/28/2001 06800.00000 48-38-33.8 N MT MD WAH711 115-05-30.5 W 0000410254 The Burlington Northern and Santa Fe Railway Co Trego 03/28/2001 06845.00000 48-38-33.8 N OH MD WNTW907 081-41-39.4 W 0000410524 WKYC-TV, Inc. Cleveland 03/28/2001 23425.00000 41-30-04.1 N OH MD WNTW907 081-41-39.4 W 0000410524 WKYC-TV, Inc. Cleveland 03/28/2001 23575.00000 41-30-04.1 N MO MD KFK87 093-28-46.7 W 0000411015 N W ELECTRIC POWER COOPERATIVE INC AVALON 03/28/2001 00933.97500 39-40-14.0 N Page 44 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WY MD WPOL571 110-01-52.6 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212840A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-212840A1.txt  
- 06315.84000 38-57-24.7 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KMQ38 123-34-50.7 W 0000450776 PACIFIC BELL MANCHESTER 05/07/2001 11325.00000 38-57-24.7 N CA MD WLC697 123-22-02.8 W 0000450777 PACIFIC BELL BOONVILLE 05/07/2001 10715.00000 39-00-31.3 N CA MD WHE243 123-21-04.1 W 0000450778 PACIFIC BELL WILLITS 05/07/2001 06345.49000 39-24-37.0 N CA MD WHE243 123-21-04.1 W 0000450778 PACIFIC BELL WILLITS 05/07/2001 11645.00000 39-24-37.0 N CA MD KNL53 122-55-10.9 W 0000450779 PACIFIC BELL LAKEPORT 05/07/2001 11365.00000 39-02-03.6 N CA MD KNL53 122-55-10.9 W 0000450779 PACIFIC BELL LAKEPORT 05/07/2001 11445.00000 39-02-03.6 N CA MD KNL53 122-55-10.9 W 0000450779 PACIFIC BELL LAKEPORT 05/07/2001 11525.00000 39-02-03.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213422A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213422A1.txt  
- N TX NE 100-55-49.8 W 0000477671 Border Opportunity Saver Systems, Inc.Del Rio 05/31/2001 21241.50000 - 22473.50000 29-21-31.2 N TX NE 106-20-18.0 W 0000477822 Blueberry Confections EL PASO 05/31/2001 23275.00000 31-45-32.0 N FL NE 081-44-13.0 W 0000477863 Marco Island Cable, Inc. Marco Island 05/31/2001 18115.00000 25-58-17.0 N AZ NE 111-51-58.5 W 0000477908 CAMP VERDE WATER SYSTEM INC CAMP VERDE 05/31/2001 00928.28125 34-34-04.1 N AZ NE 111-51-58.5 W 0000477908 CAMP VERDE WATER SYSTEM INC CAMP VERDE 05/31/2001 00952.28125 34-34-04.1 N CO NE P 104-57-30.0 W 0000478517 Denver, City and County of; Board of Water Commissioners DENVER 05/24/2001 00956.36875 39-44-21.0 N MN NE P 094-00-07.8 W 0000478536 CITY OF CLEAR LAKE CLEAR LAKE 05/23/2001 00952.81875 45-26-38.8 N MO NE 090-30-29.0 W 0000478554 JEFFERSON COUNTY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213765A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-213765A1.txt  
- File Number Frequency (MHz) Applicant Name Latitude City NH NE 071-22-08.2 W 0000483645 NEW HAMPSHIRE, STATE OF, DIVISION OF STATE POLICE GILFORD 06/06/2001 06835.62500 43-31-04.2 N NH NE 071-22-08.2 W 0000483645 NEW HAMPSHIRE, STATE OF, DIVISION OF STATE POLICE GILFORD 06/06/2001 11638.12500 43-31-04.2 N NH NE 072-16-48.5 W 0000483647 NEW HAMPSHIRE, STATE OF, DIVISION OF STATE POLICE KEENE 06/06/2001 11153.12500 42-56-04.1 N NH NE 072-20-12.7 W 0000483649 NEW HAMPSHIRE, STATE OF, DIVISION OF STATE POLICE CLAREMONT 06/06/2001 11163.12500 43-22-21.3 N NH NE 072-02-32.7 W 0000484112 NEW HAMPSHIRE, STATE OF, DIVISION OF STATE POLICE NORTH HAVERHILL 06/07/2001 11623.12500 44-06-47.0 N WA NE 123-08-21.5 W 0000486072 STATE OF WASHINGTON DEPARTMENT OF NATURAL RESOURCES OLYMPIA 06/01/2001 06705.00000 46-58-21.3 N WA NE 122-54-17.5 W 0000486077 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214106A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214106A1.txt  
- WPNG875 091-33-46.0 W 0000470718 USCOC OF GREATER IOWA, INC. RIVERSIDE 06/28/2001 06776.25000 41-30-25.0 N IA AM WPNG875 091-33-46.0 W 0000470718 USCOC OF GREATER IOWA, INC. RIVERSIDE 06/28/2001 06785.00000 41-30-25.0 N IA AM WPNG875 091-33-46.0 W 0000470718 USCOC OF GREATER IOWA, INC. RIVERSIDE 06/28/2001 06805.00000 41-30-25.0 N CA MD WMQ712 118-11-22.3 W 0000499865 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 06/25/2001 10875.00000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000499865 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 06/25/2001 19525.00000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0000499865 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 06/25/2001 19685.00000 33-53-04.1 N CA MD WMW848 118-12-11.2 W 0000499892 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 06/25/2001 18125.00000 33-51-31.0 N MO MD WMW708 091-48-35.0 W 0000499918 USCOC OF MISSOURI RSA #5, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214269A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214269A1.txt  
- 40-03-08.9 N CO NE 106-10-15.0 W 0000508246 UNION PACIFIC RAILROAD COMPANYHOT SULPHUR SPRINGS 07/02/2001 00928.19375 40-07-01.9 N CO NE 106-10-15.0 W 0000508246 UNION PACIFIC RAILROAD COMPANYHOT SULPHUR SPRINGS 07/02/2001 00952.19375 40-07-01.9 N TX NE 097-26-29.9 W 0000509111 MOTOROLA BROADBAND COMMUNICATIONS SECTOR BROWNSVILLE 07/03/2001 22799.00000 25-54-18.3 N AZ NE 111-51-58.5 W 0000509317 CAMP VERDE WATER SYSTEM INC CAMP VERDE 07/03/2001 00928.28125 34-34-04.1 N AZ NE 111-51-58.5 W 0000509317 CAMP VERDE WATER SYSTEM INC CAMP VERDE 07/03/2001 00952.28125 34-34-04.1 N AL NE 085-28-11.0 W 0000513068 Southern Company Services TURKEY HEAVEN 07/06/2001 06590.00000 33-32-41.0 N GA NE 082-53-07.0 W 0000513512 Southern Company Services CEDAR GROVE 07/06/2001 06093.45000 32-15-49.0 N GA NE 083-10-16.0 W 0000513541 Southern Company Services CHESTER 07/06/2001 06197.24000 32-22-44.0 N GA NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214594A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214594A1.txt  
- 066-07-05.0 W 0000514142 SprintCom, Inc. GUAYNABO 07/09/2001 18025.00000 18-25-23.4 N PR NE 066-07-05.0 W 0000514142 SprintCom, Inc. GUAYNABO 07/09/2001 19505.00000 18-25-23.4 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PR NE 066-08-52.5 W 0000514143 SprintCom, Inc. CATANO 07/09/2001 19310.00000 18-27-04.1 N PR NE 066-08-52.5 W 0000514143 SprintCom, Inc. CATANO 07/09/2001 19590.00000 18-27-04.1 N PR NE 066-08-47.4 W 0000514145 SprintCom, Inc. CATANO 07/09/2001 17945.00000 18-25-24.8 N PR NE 066-08-47.4 W 0000514145 SprintCom, Inc. CATANO 07/09/2001 18030.00000 18-25-24.8 N PR NE 066-07-24.0 W 0000514146 SprintCom, Inc. CATANO 07/09/2001 19585.00000 18-26-22.9 N PR NE 067-04-23.7 W 0000514148 SprintCom, Inc. PLAYA JOBOS 07/09/2001 17925.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214800A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-214800A1.txt  
- 07/16/2001 23025.00000 47-26-29.4 N OH NE 084-20-09.6 W 0000525156 Middletown, City of Middletown 07/16/2001 00932.36875 39-29-24.1 N OH NE 084-20-09.6 W 0000525156 Middletown, City of Middletown 07/16/2001 00941.36875 39-29-24.1 N WA NE 118-27-20.9 W 0000525158 THE BURLINGTON NORTHERN AND SANTA FE RAILWAY CO Lamona 07/16/2001 06645.00000 47-20-52.5 N NJ NE P 074-17-07.5 W 0000525531 MAHWAH, TOWNSHIP OF RINGWOOD 07/16/2001 00952.60625 41-09-04.1 N NJ NE P 074-17-07.5 W 0000525531 MAHWAH, TOWNSHIP OF RINGWOOD 07/16/2001 00952.60625 41-09-04.1 N WY NE 105-28-09.0 W 0000527632 Rocky Mountain Oilfield Warehouse Gillette 07/17/2001 00928.31875 44-12-35.0 N WY NE 105-28-09.0 W 0000527632 Rocky Mountain Oilfield Warehouse Gillette 07/17/2001 00952.31875 44-12-35.0 N TX NE 096-05-04.8 W 0000527736 MidSouth Electric Coop Association Navasota 07/18/2001 06845.00000 30-24-35.0 N MO NE P 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215308A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215308A1.txt  
- Station: Temporary Fixed Earth Station Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Application for modification of authorization for temporary-fixed earth station to change class to fixed earth station. 34 ° 13 ' 55.00 " N LAT. SITE ID: 1 20640 BAHAMA ST., LOS ANGELES, CHATSWORTH, CA 118 ° 34 ' 57.30 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 9M10G7F 67.70 dBW COMPRESSED DIGITAL VIDEO, DVB 6315.0000 - 6324.0000 MHz 9M00G7D COMPRESSED DIGITAL VIDEO, DVB 3700.0000 - 4200.0000 MHz 9M00G7D Points of Communication: 1 - ALSAT - (ALSAT) 1 - COL515 - (37.7 W.L.) 1 - PAS-1 - (45.0 W.L.) 1 - PAS-2R - (43.0 W.L.) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215309A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215309A1.txt  
- * Data witheld to maintain firm confidentiality. High-Speed Lines by Type of User Table 7 (Over 200 kbps in at Least One Direction) 1/ Other includes medium and large business, institutional, and government customers. Number of Providers Zero 44.0% 30.1% 25.0% One 24.5 25.8 24.5 Two 14.2 16.7 18.6 Three 8.1 9.3 10.7 Four 4.4 6.0 6.2 Five 2.6 4.2 4.1 Six 1.5 3.1 3.0 Seven 0.6 2.2 2.3 Eight 0.2 1.2 2.0 Nine 0.0 0.6 1.6 Ten or More 0.0 0.9 2.1 * Data for June 2000 have been revised. December 1999 June 2000* December 2000 Table 8 Percentage of Zip Codes with High-Speed Lines in Service High-Speed Providers by Zip Code Number of Reporting Providers 7 or more 4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215390A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215390A1.txt  
- Utilities Foley 08/07/2001 00956.40625 30-24-25.0 N ID NE 113-48-14.0 W 0000551512 College of Southern Idaho Burley 08/07/2001 06715.00000 42-31-57.0 N ID NE 113-48-14.0 W 0000551512 College of Southern Idaho Burley 08/07/2001 06745.00000 42-31-57.0 N OK NE 095-57-36.0 W 0000552310 Western Farmers Electric Cooperative WOODWARD 08/08/2001 06543.75000 35-36-15.4 N OK NE 099-23-12.4 W 0000552320 Western Farmers Electric Cooperative WOODWARD 08/08/2001 06568.75000 36-25-04.1 N OK NE 099-35-23.0 W 0000552324 Western Farmers Electric Cooperative FORT SUPPLY 08/08/2001 06526.25000 36-34-46.0 N OK NE 099-13-32.4 W 0000552351 Western Farmers Electric Cooperative MOORELAND 08/08/2001 06541.87500 36-26-13.1 N OK NE 097-41-48.2 W 0000552368 Western Farmers Electric Cooperative MEDFORD 08/08/2001 06776.25000 36-52-59.1 N OK NE 097-41-48.2 W 0000552368 Western Farmers Electric Cooperative MEDFORD 08/08/2001 06841.25000 36-52-59.1 N OK NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215526A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215526A1.txt  
- 1.4 Interstate Per-Minute Access Charges by Carrier......................................................1-8 Advanced Telecommunications....................................................................2-1 Table 2.1 High-Speed Lines.....................................................................................................2-3 Table 2.2 Advanced Services Lines..........................................................................................2-3 Table 2.3 Residential and Small Business High-Speed Lines......................................................2-3 Table 2.4 High-Speed Lines by Technology..............................................................................2-4 Consumer Expenditures...............................................................................3-1 Table 3.1 Household Expenditures for Telephone Service.........................................................3-3 Chart 3.1 Monthly Telephone Service Expenditures..................................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures by Type of Provider.........................................................................................................3-4 Earnings.......................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary...........................................................................4-3 Employment and Labor Productivity...........................................................5-1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour.............................................................................5-4 Chart 5.2 Telephone Communications Industry (SIC 481) Labor Productivity Index..................5-4 Table 5.3 Number of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215591A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215591A1.txt  
- add new emission designator and related service and to add antenna. 37 ° 21 ' 17.50 " N LAT. SITE ID: 1 1971 UNIVERSITY BLVD, LYNCHBURG, LYNCHBURG, VA 79 ° 10 ' 49.10 " W LONG. LOCATION: ANDREW 1 9.1 meters ANTENNA ID: ESA 91-46 HP 87.90 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F3F COMTECH 2 4.1 meters ANTENNA ID: OFFSAT Page 6 of 8 69.60 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 11M2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 11M2G7W 46.20 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215731A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215731A1.txt  
- File Number Frequency (MHz) Applicant Name Latitude City FL NE 082-06-34.0 W 0000567974 Infinity Radio License Inc. DUETTE 08/22/2001 00450.03750 27-40-24.0 N CA NE 119-57-38.4 W 0000571220 Entravision Holdings, LLC Santa Barbara 08/24/2001 00450.01000 34-31-28.0 N TI - TV Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR AM 122-45-04.1 W 0000247794 Freedom Broadcasting of Oregon, Inc. Medford 08/15/2001 06887.50000 42-17-42.5 N OR AM 122-45-04.1 W 0000247794 Freedom Broadcasting of Oregon, Inc. Medford 08/15/2001 06887.50000 42-17-42.5 N NH MD KYL52 071-12-27.2 W 0000565619 UNIVERSITY OF NEW HAMPSHIRE DEERFIELD 08/20/2001 07025.00000 - 07050.00000 43-10-33.2 N NH MD KYL53 071-51-26.2 W 0000565693 UNIVERSITY OF NEW HAMPSHIRE WARNER 08/20/2001 07075.00000 - 07100.00000 43-23-00.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215884A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-215884A1.txt  
- 06286.19000 30-21-14.7 N TX MD WLR663 095-05-32.7 W 0000581000 Corban Communications, Inc. CLEVELAND 08/30/2001 06404.79000 30-21-14.7 N TX MD WMJ361 104-04-35.0 W 0000581763 Corpus Christi SMSA Limited PartnershipKENT 08/31/2001 02118.40000 31-02-03.4 N TX MD WMJ361 104-04-35.0 W 0000581763 Corpus Christi SMSA Limited PartnershipKENT 08/31/2001 02124.80000 31-02-03.4 N TX MD WPJD224 103-39-24.3 W 0000581766 Corpus Christi SMSA Limited PartnershipALPINE 08/31/2001 06004.50000 30-21-04.1 N WV NE 077-54-54.2 W 0000573918 Local Communications Network, Inc. Martinsburg 08/28/2001 05925.00000 - 06425.00000 39-23-51.5 N VA NE 077-25-27.1 W 0000573933 Local Communications Network, Inc. Sterling 08/28/2001 05925.00000 - 06425.00000 38-59-04.4 N ID NE 115-55-32.9 W 0000574565 Idaho RSA No. 1 Limited Partnership Silverton 08/29/2001 10553.12500 47-29-16.9 N PR NE 066-05-26.6 W 0000575122 NewComm Wireless Services, Inc. AGUAS BUENAS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216205A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216205A1.txt  
- Colorado, LLCPaonia 09/13/2001 38-53-08.0 N CO RM KNKN453 107-58-01.3 W 0000591005 AT&T Wireless Services of Colorado, LLCParachute 09/13/2001 39-26-33.9 N Page 34 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO RM KNKN453 107-44-55.2 W 0000591005 AT&T Wireless Services of Colorado, LLCRIFLE 09/13/2001 39-30-48.9 N CO RM KNKN453 106-04-04.1 W 0000591005 AT&T Wireless Services of Colorado, LLCSILVERTHORNE 09/13/2001 39-36-50.0 N CO RM KNKN453 106-57-04.2 W 0000591005 AT&T Wireless Services of Colorado, LLCSnowmass 09/13/2001 39-12-20.0 N CO RM KNKN453 108-38-50.3 W 0000591005 AT&T Wireless Services of Colorado, LLCUnincorporated 09/13/2001 38-34-36.0 N CO RM KNKN453 106-23-20.1 W 0000591005 AT&T Wireless Services of Colorado, LLCVAIL 09/13/2001 39-38-46.9 N CO RM KNKN453 106-40-41.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216388A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216388A1.txt  
- N PA RM KNKN810 078-39-48.2 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessDEGOLIA 09/19/2001 41-54-59.5 N PA RM KNKN810 078-15-18.0 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessEMPORIUM 09/19/2001 41-29-29.2 N PA RM KNKN810 078-48-13.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessLAMONT 09/19/2001 41-37-04.2 N PA RM KNKN810 078-42-06.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessRIDGEWAY 09/19/2001 41-24-34.2 N PA RM KNKN810 078-23-04.1 W 0000595932 Cellco Partnership, d/b/a Verizon WirelessSMETHPORT 09/19/2001 41-48-37.2 N PA RM KNKQ275 079-54-00.2 W 0000595936 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP Bullion 09/19/2001 41-14-48.2 N OH RM KNKQ275 080-35-03.3 W 0000595936 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP CONNEAUT 09/19/2001 41-54-02.2 N PA RM KNKQ275 080-20-06.2 W 0000595936 PENNSYLVANIA RSA 1 LIMITED PARTNERSHIP Conneaut Lake 09/19/2001 41-34-29.2 N PA RM KNKQ275 080-20-06.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216833A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216833A1.txt  
- Notice. Opposition to objections may be filed no later than 10 days after the original objection is filed. Responses to the opposition may be filed no later than 5 days after the time for filing an opposition has expired. A Apppplliiccaanntt FFiillee N Nuum mbbeerr C Coooorrddiinnaatteess D Daattee R Reecc''dd GeoNet Towers,Inc. A0216549 30-14-56.1/92-10-23.9 10/04/01 Crown Communication Inc. A0216658 31-33-4.1/92-58-0.3 10/05/01 Signal One, LLC A0217230 30-43-16.5/88-7-8.9 10/10/01 American Tower Limited Partnership A0217451 29-33-11.0/98-54-29.5 10/11/01 -FCC- 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216935A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-216935A1.txt  
- Page 46 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WNTC687 122-28-39.9 W 0000621127 SAN MATEO, COUNTY OF REDWOOD CITY 10/10/2001 10915.00000 37-33-40.7 N CA MD WNTC687 122-28-39.9 W 0000621127 SAN MATEO, COUNTY OF REDWOOD CITY 10/10/2001 11215.00000 37-33-40.7 N HI MD WNTB408 157-53-04.1 W 0000623767 HONOLULU PUBLIC TRANSIT AUTHORITY HONOLULU 10/12/2001 10563.12500 21-20-12.6 N MI NE 083-55-15.0 W 0000617670 SAGINAW COUNTY 911 AUTHORITY Bridgeport 10/04/2001 06541.25000 43-23-31.0 N MI NE 084-08-12.0 W 0000617671 SAGINAW COUNTY 911 AUTHORITY St. Charles 10/04/2001 06718.75000 43-16-58.0 N AL NE 086-54-12.0 W 0000617890 Jefferson, County of FORESTDALE 10/05/2001 00932.46875 33-35-33.0 N AL NE 086-54-12.0 W 0000617890 Jefferson, County 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217280A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217280A1.txt  
- Company II, L.L.C. Philadelphia 10/22/2001 19480.00000 39-57-08.9 N PA NE 075-09-36.7 W 0000636270 Teligent License Company II, L.L.C. Philadelphia 10/22/2001 19520.00000 39-57-23.6 N PA NE 075-13-10.2 W 0000636321 BACKLINK LLC Bala Cynwyd 10/22/2001 19400.00000 40-00-32.3 N PA NE 075-13-06.8 W 0000636323 BACKLINK LLC Bala Cynwyd 10/22/2001 19600.00000 40-00-34.0 N AZ NE 114-03-34.0 W 0000636384 Sprint Spectrum L.P. Quartzsite 10/23/2001 06800.62500 33-40-04.1 N AZ NE 114-03-34.0 W 0000636384 Sprint Spectrum L.P. Quartzsite 10/23/2001 06820.62500 33-40-04.1 N AZ NE 114-03-34.0 W 0000636384 Sprint Spectrum L.P. Quartzsite 10/23/2001 06865.62500 33-40-04.1 N PA NE 080-09-40.0 W 0000636534 Cellco Partnership dba Verizon WirelessMC KEAN 10/22/2001 06197.24000 41-55-21.0 N PA NE 080-09-40.0 W 0000636534 Cellco Partnership dba Verizon WirelessMC KEAN 10/22/2001 06256.54000 41-55-21.0 N PA NE 080-09-40.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217478A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217478A1.txt  
- N IL NE 089-14-50.3 W 0000647728 OLYMPIA SCHOOL DISTRICT 16 Stanford 11/02/2001 06093.45000 40-23-47.1 N IL NE 089-10-15.2 W 0000647729 OLYMPIA SCHOOL DISTRICT 16 Danvers 11/02/2001 06226.89000 40-31-47.1 N IL NE 089-14-07.3 W 0000647730 OLYMPIA SCHOOL DISTRICT 16 Atlanta 11/02/2001 06286.19000 40-15-52.1 N IL NE 089-25-07.3 W 0000647731 OLYMPIA SCHOOL DISTRICT 16 Hopedale 11/02/2001 06345.49000 40-25-08.1 N KS RM WHC475 097-54-04.1 W 0000642281 The Burlington Northern and Santa Fe Railway Co Hutchinson 10/29/2001 06755.00000 38-03-10.0 N KS RM WHC475 097-54-04.1 W 0000642281 The Burlington Northern and Santa Fe Railway Co Hutchinson 10/29/2001 06815.00000 38-03-10.0 N KS RM WHC476 098-19-35.2 W 0000642339 The Burlington Northern and Santa Fe Railway Co Alden 10/29/2001 06655.00000 38-07-47.0 N KS RM WHC476 098-19-35.2 W 0000642339 The 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217635A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217635A1.txt  
- State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI AM 087-26-00.0 W 0000619771 Great Lakes Radio, Inc. Marquette 11/05/2001 00944.15000 46-32-47.7 N WY AM 110-32-41.0 W 0000619784 Carroll, Jimmy R Kemmerer 11/08/2001 00948.00000 41-48-01.0 N WY AM 110-32-41.0 W 0000619784 Carroll, Jimmy R Kemmerer 11/09/2001 00948.00000 41-48-01.0 N CA MD WLI772 121-25-04.1 W 0000648374 PROMO RADIO CORP HOLLISTER 11/05/2001 00949.12500 36-50-12.8 N CA MD KMV30 119-03-51.4 W 0000648788 CLEAR CHANNEL BROADCASTING LICENSES, INC. BAKERSFIELD 11/05/2001 00944.50000 35-21-52.9 N OK MD WHA973 095-54-40.4 W 0000648818 CLEAR CHANNEL BROADCASTING LICENSES, INC. TULSA 11/05/2001 00945.37500 36-06-18.5 N OK MD WHA973 095-54-40.4 W 0000648818 CLEAR CHANNEL BROADCASTING LICENSES, INC. TULSA 11/05/2001 00950.62500 36-06-18.5 N MN MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217886A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-217886A1.txt  
- meters ANTENNA ID: DPVK-1634 71.00 dBW QPSK DIGITAL VIDEO 14000.0000 - 14500.0000 MHz 16M0G7W 0.00 dBW QPSK DIGITAL VIDEO 11700.0000 - 12200.0000 MHz 16M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E930214 SES-MOD-20011120-02111 Prophecy Countdown, Inc. Application for Modification Class of Station: Temporary Fixed Earth Station Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 76.00 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 72.90 dBW DIGITAL TRAFFICE - VARIOUS INFO. COMBINATIONS 5925.0000 - 6425.0000 MHz 36M0G7W 48.90 dBW DIGITAL TRAFFICE - VARIOUS INFO. COMBINATIONS 5925.0000 - 6425.0000 MHz 51K2G7W 72.90 dBW DIGITAL DATA 5925.0000 - 6425.0000 MHz 36M0G7D 48.90 dBW DIGITAL DATA 5925.0000 - 6425.0000 MHz 51K2G7D 72.90 dBW DIGITAL VIDEO 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218067A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218067A1.txt  
- iim mppaacctt uuppoonn tthhee eennvviirroonnm meenntt.. SSeeee 4477 C C..FF.. R R.. §§ 11..11330088((dd)).. A Accccoorrddiinnggllyy,, tthhee aapppplliiccaattiioonn((ss)) lliisstteedd hheerreeiinn ffoorr m maajjoorr eennvviirroonnm meennttaall aaccttiioonnss aarree G GR RA AN NTTEED D.. A Apppplliiccaanntt FFiillee N Nuum mbbeerr C Coooorrddiinnaatteess D Daattee R Reecc''dd SBA Towers Inc. A0194180 38-14-1.0/121-10-33.0 5/30/01 GeoNet Towers,Inc. A0216549 30-14-56.1/92-10-23.9 10/04/01 Crown Communication Inc. A0216658 31-33-4.1/92-58-0.3 10/05/01 Signal One, LLC A0217230 30-43-16.5/88-7-8.9 10/10/01 American Tower Limited Partnership A0217451 29-33-11.0/98-54-29.5 10/11/01 -FCC- 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218761A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-218761A1.txt  
- Lafayette 12/19/2001 00950.00000 40-25-27.1 N Page 2 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD NE 076-44-00.0 W 0000704070 WCBM Maryland, Inc. Pikesville 12/19/2001 00947.50000 39-22-45.0 N IL NE 089-38-51.0 W 0000704594 Regent Broadcasting of Peoria, Inc. Pekin 12/19/2001 00945.50000 40-36-25.0 N VA NE 079-50-04.1 W 0000706443 Base Communications, Inc. Martinsville 12/20/2001 00951.00000 36-42-16.4 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD KPD955 078-47-48.0 W 0000703131 Arch Communications Enterprises LLC LITTLE VALLEY 12/18/2001 00075.74000 42-14-06.0 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219552A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219552A1.txt  
- 05945.20000 40-35-10.0 N IL MD WLS604 089-43-34.0 W 0000745216 ILLINOIS RSA #3, INC. MAPLETON 01/24/2002 06034.15000 40-35-10.0 N IL MD WLS604 089-43-34.0 W 0000745216 ILLINOIS RSA #3, INC. MAPLETON 01/24/2002 06681.25000 40-35-10.0 N IL MD WLS604 089-43-34.0 W 0000745216 ILLINOIS RSA #3, INC. MAPLETON 01/24/2002 10558.12500 40-35-10.0 N AZ MD KPK30 113-08-06.6 W 0000745241 CNG COMMUNICATIONS, INC. MONTEZUMA 01/24/2002 03770.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000745241 CNG COMMUNICATIONS, INC. MONTEZUMA 01/24/2002 03850.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000745241 CNG COMMUNICATIONS, INC. MONTEZUMA 01/24/2002 03930.00000 33-03-04.1 N Page 12 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD KPK30 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219743A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-219743A1.txt  
- 00945.00000 21-17-28.4 N HI MD WAQ311 157-50-10.0 W 0000750858 NEW WAVE BROADCASTING LP HONOLULU 01/17/2002 00947.50000 21-17-28.4 N Page 3 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL AM WMV786 091-23-03.5 W 0000548602 BICK BROADCASTING COMPANY QUINCY 10/18/2001 00946.00000 39-56-20.1 N CA AM WLI772 121-25-04.1 W 0000648374 PROMO RADIO CORP HOLLISTER 01/28/2002 00949.12500 36-50-12.8 N MN AM WLO774 094-08-20.0 W 0000656401 RepCom, Inc. SAINT CLOUD 01/28/2002 00948.00000 45-33-36.0 N MN AM 094-08-20.0 W 0000656431 REPCOM, Inc. St. Cloud 01/28/2002 00949.50000 45-33-36.0 N MN AM WAW487 094-08-20.0 W 0000656485 Regent Licensee of St. Cloud, Inc. SAINT CLOUD 01/30/2002 00949.00000 45-33-36.0 N OK AM WMU552 097-56-19.1 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220113A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220113A1.txt  
- 02/11/2002 22025.00000 47-36-28.6 N WA MD WNEY272 117-22-18.7 W 0000767838 Spokane Television, Inc. SPOKANE 02/11/2002 22125.00000 47-36-28.6 N GA MD WNTB403 084-03-25.0 W 0000768982 GEORGIA POWER COMPANY LAWRENCEVILLE 02/12/2002 00928.76875 33-59-12.0 N GA MD WNTB403 084-03-25.0 W 0000768982 GEORGIA POWER COMPANY LAWRENCEVILLE 02/12/2002 00952.76875 33-59-12.0 N NC MD WPNC772 077-58-57.0 W 0000771986 Carolina Power and Light Company Wilmington 02/14/2002 00928.44375 34-17-04.1 N Page 21 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC MD WPNC772 077-58-57.0 W 0000771986 Carolina Power and Light Company Wilmington 02/14/2002 00952.44375 34-17-04.1 N AL MD WNTF288 086-39-56.9 W 0000773535 ALABAMA POWER COMPANY Inverness 02/15/2002 00928.66875 33-23-26.3 N AL MD WNTF288 086-39-56.9 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220118A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220118A1.txt  
- 6363.0000 MHz 18M0G1E Points of Communication: 1 - ALSAT - (ALSAT) E020024 SES-LIC-20020215-00177 Directrix, Inc. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 34 ° 6 ' 58.50 " N LAT. SITE ID: 1 3030 Andrita Street, Los Angeles, Los Angeles, CA 118 ° 14 ' 39.70 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: 5 Meter Offsat Standard Video 3700.0000 - 4200.0000 MHz 36M0F3F Compressed Digital Video and data carrier 3700.0000 - 4200.0000 MHz 4M00G7W Digital Video and Data Carrier 3700.0000 - 4200.0000 MHz 36M0G7W Digital Datal 3700.0000 - 4200.0000 MHz 4M00G7D Digital Data 3700.0000 - 4200.0000 MHz 36M0G7D 72.40 dBW Standard Video 5925.0000 - 6425.0000 MHz 36M0F3F 68.90 dBW Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220305A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220305A1.txt  
- WEG428 117-56-15.2 W 0000781876 WEST COVINA, CITY OF WEST COVINA 02/21/2002 19320.00000 34-04-19.0 N CA MD WEG429 117-53-30.2 W 0000781877 WEST COVINA, CITY OF WEST COVINA 02/21/2002 17760.00000 34-02-16.0 N CA MD WEG429 117-53-30.2 W 0000781877 WEST COVINA, CITY OF WEST COVINA 02/21/2002 23275.00000 34-02-16.0 N CA MD WNTQ678 118-10-11.2 W 0000782275 LONG BEACH, CITY OF LONG BEACH 02/22/2002 18695.00000 33-49-04.1 N CA MD WHC543 118-09-47.2 W 0000782314 LONG BEACH, CITY OF SIGNAL HILL 02/22/2002 17840.00000 33-47-58.1 N CA MD WNTQ679 118-08-55.1 W 0000782322 LONG BEACH, CITY OF LONG BEACH 02/22/2002 18975.00000 33-47-25.6 N CA MD WNTQ679 118-08-55.1 W 0000782322 LONG BEACH, CITY OF LONG BEACH 02/22/2002 19035.00000 33-47-25.6 N CA MD WNTQ679 118-08-55.1 W 0000782322 LONG BEACH, CITY OF LONG 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220569A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220569A1.txt  
- - Points of Communication: 1 - ALSAT - (ALSAT) E020044 SES-LIC-20020304-00271 RAY COMMUNICATIONS, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 36 ° 8 ' 8.60 " N LAT. SITE ID: 1 104 Radio Road, Currituck, Powells Point, NC 75 ° 49 ' 27.20 " W LONG. LOCATION: Comtech Ant. Corp. 1 4.1 meters ANTENNA ID: offsat Analog SCPC 3700.0000 - 4200.0000 MHz 50K0F3E 48.45 dBW Analog SCPC 5925.0000 - 6425.0000 MHz 50K0F3E Points of Communication: 1 - ALSAT - (ALSAT) E930195 SES-MOD-20020222-00260 Nebraska Educational Telecommunications Commission Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service "MOD" to relocate fixed station and to change assigned frequencies. 40 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220784A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220784A1.txt  
- Communications, Inc. Columbia 03/08/2002 00947.15000 34-00-19.0 N SC NE 080-49-17.3 W 0000802160 Glory Communications, Inc. Orangeburg 03/08/2002 00945.50000 33-28-46.6 N OH NE 080-46-51.0 W 0000802272 CLEAR CHANNEL BROADCASTING LICENSES, INC. ASHTABULA 03/08/2002 00946.00000 41-48-58.0 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI MD KNKJ322 084-20-04.1 W 0000793191 Superior Technologies, Inc. SAULT SAINT MARIE 03/04/2002 00152.84000 46-29-08.0 N MI MD KNKC315 086-38-08.0 W 0000793202 SUPERIOR TECHNOLOGIES, INC. DBA: SUPERIOR SPECTRUM MUNISING 03/04/2002 00152.84000 46-23-38.0 N MI MD KNKD286 088-32-50.4 W 0000793304 Superior Technologies, Inc. BARAGA 03/04/2002 00152.84000 46-46-29.7 N MI MD KNKD286 087-07-17.0 W 0000793304 Superior Technologies, Inc. ESCANABA 03/04/2002 00152.84000 45-45-43.0 N MI MD KNKD286 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220999A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-220999A1.txt  
- N CA MD KNO35 120-24-29.7 W 0000806420 CALIFORNIA, STATE OF KYBURZ 03/13/2002 06207.12000 38-50-30.7 N CA MD KNO35 120-24-29.7 W 0000806420 CALIFORNIA, STATE OF KYBURZ 03/13/2002 06765.00000 38-50-30.7 N CA MD KNO35 120-24-29.7 W 0000806420 CALIFORNIA, STATE OF KYBURZ 03/13/2002 06805.00000 38-50-30.7 N CA MD KNO35 120-24-29.7 W 0000806420 CALIFORNIA, STATE OF KYBURZ 03/13/2002 06845.00000 38-50-30.7 N CA MD WNET884 117-20-04.1 W 0000806427 CALIFORNIA, STATE OF SAN BERNARDINO 03/13/2002 06585.00000 34-12-21.0 N CA MD WNET884 117-20-04.1 W 0000806427 CALIFORNIA, STATE OF SAN BERNARDINO 03/13/2002 06615.00000 34-12-21.0 N CA MD WNEM965 122-57-39.3 W 0000807373 SONOMA, COUNTY OF GUERNEVILLE 03/13/2002 06197.24000 38-32-22.2 N CA MD WNEM965 122-57-39.3 W 0000807373 SONOMA, COUNTY OF GUERNEVILLE 03/13/2002 06595.00000 38-32-22.2 N CA MD WNEM965 122-57-39.3 W 0000807373 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221156A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221156A1.txt  
- OF CALIFORNIA, INC. 03/15/2002 00815.88750 CA MD WPNV372 X 0000812244 NEXTEL OF CALIFORNIA, INC. 03/15/2002 00812.91250 CA MD WPNV372 X 0000812244 NEXTEL OF CALIFORNIA, INC. 03/15/2002 00815.88750 CA MD WPNV372 120-28-36.1 W 0000812244 NEXTEL OF CALIFORNIA, INC. MERCED 03/15/2002 00857.91250 37-17-40.0 N CA MD WPNV372 120-28-36.1 W 0000812244 NEXTEL OF CALIFORNIA, INC. MERCED 03/15/2002 00857.91250 37-17-40.0 N CA MD WPNV372 122-39-04.1 W 0000812244 NEXTEL OF CALIFORNIA, INC. REDDING 03/15/2002 00860.88750 40-36-09.5 N CA MD WPNV372 122-39-04.1 W 0000812244 NEXTEL OF CALIFORNIA, INC. REDDING 03/15/2002 00860.88750 40-36-09.5 N CA MD WPNV372 122-41-29.0 W 0000812244 NEXTEL OF CALIFORNIA, INC. STONYFORD 03/15/2002 00857.91250 39-26-00.6 N CA MD WPNV372 122-41-29.0 W 0000812244 NEXTEL OF CALIFORNIA, INC. STONYFORD 03/15/2002 00857.91250 39-26-00.6 N MD WPNV374 A 0000812245 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221304A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221304A1.txt  
- N FL MD WLT726 082-16-44.0 W 0000829019 FLORIDA RSA #8, INC. GAINESVILLE 03/29/2002 06745.00000 29-38-31.0 N IL MD WMM680 088-32-55.2 W 0000829274 ILLINOIS VALLEY CELLULAR RSA 2, INC.PONTIAC 03/29/2002 06256.54000 40-55-06.1 N IL MD WMM680 088-32-55.2 W 0000829274 ILLINOIS VALLEY CELLULAR RSA 2, INC.PONTIAC 03/29/2002 06315.84000 40-55-06.1 N AZ MD KPK30 113-08-06.6 W 0000829304 CNG COMMUNICATIONS, INC. MONTEZUMA 03/29/2002 03770.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000829304 CNG COMMUNICATIONS, INC. MONTEZUMA 03/29/2002 03850.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000829304 CNG COMMUNICATIONS, INC. MONTEZUMA 03/29/2002 03930.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000829304 CNG COMMUNICATIONS, INC. MONTEZUMA 03/29/2002 04010.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000829304 CNG COMMUNICATIONS, INC. MONTEZUMA 03/29/2002 04090.00000 33-03-04.1 N AZ MD KPK30 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221613A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221613A1.txt  
- 72.90 dBW DIGITAL VIDEO WITH AUDIO SUBCARRIERS 5925.0000 - 6675.0000 MHz 24M0G7F 59.10 dBW DIGITAL VIDEO WITH AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 24M0G7F Points of Communication: 1 - ALSAT - (ALSAT) E020097 SES-LIC-20020410-00616 Revival Ministries International Application for Authority Class of Station: Temporary Fixed Earth Station Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 74.70 dBW ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 74.70 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M00G7D Points of Communication: 1 - ALSAT - (ALSAT) E020096 SES-LIC-20020416-00601 SES AMERICOM, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 39 ° 22 ' 36.00 " N LAT. SITE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221659A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221659A1.txt  
- NE 087-39-23.0 W 0000846463 AT&T CORP. CHICAGO 04/12/2002 18080.00000 41-52-40.0 N IA NE 091-39-57.6 W 0000847302 USCOC OF GREATER IOWA, INC. TIFFIN 04/12/2002 06660.00000 41-42-33.0 N CG - General Aviation Air-ground Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NM MD WPON853 106-46-48.1 W 0000846750 Stratophone, LLC Albuquerque 04/12/2002 00454.67500 35-04-04.1 N NM MD WPON853 106-46-48.1 W 0000846750 Stratophone, LLC Albuquerque 04/12/2002 00454.75000 35-04-04.1 N NM MD WPON853 106-27-08.0 W 0000846750 Stratophone, LLC SANDIA PARK 04/12/2002 00454.67500 35-13-02.0 N NM MD WPON853 106-27-08.0 W 0000846750 Stratophone, LLC SANDIA PARK 04/12/2002 00454.75000 35-13-02.0 N Page 22 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221667A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221667A1.txt  
- Florida's Radio Networks Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service "MOD" to add new emission designators and related service and to change company name. 25 ° 58 ' 45.00 " N LAT. SITE ID: 1 7201 RIVIERA BLVD, BROWARD, MIRAMAR, FL 80 ° 14 ' 37.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 53.10 dBW DIGITAL QPSK, 1/2 FEC, 256 KBPS 5925.0000 - 6425.0000 MHz 307KG7D 49.30 dBW DIGITAL QPSK, 1/2 FEC, 128 KBPS 5925.0000 - 6425.0000 MHz 154KG7D- 0.00 dBW DIGITAL QPSK, 1/2 FEC, 256 KBPS 3700.0000 - 4200.0000 MHz 307KG7D 0.00 dBW DIGITAL QPSK, 1/2 FEC, 128 3700.0000 - 4200.0000 MHz 154KG7D- Points of Communication: 1 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221823A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-221823A1.txt  
- 04/12/2002 00461.02500 46-52-27.9 N ND NE 096-47-02.3 W 0000847535 Midstates Wireless Fargo 04/12/2002 00461.43750 46-52-27.9 N ND NE 096-47-02.3 W 0000847535 Midstates Wireless Fargo 04/12/2002 00461.78750 46-52-27.9 N ND NE 096-47-02.3 W 0000847535 Midstates Wireless Fargo 04/12/2002 00462.03750 46-52-27.9 N NE A 0000853325 AZLE COMMUNICATIONS SOLUTIONS, LLC 04/17/2002 00485.72500 NE A 0000853325 AZLE COMMUNICATIONS SOLUTIONS, LLC 04/17/2002 00485.75000 TX NE 097-20-04.1 W 0000853325 AZLE COMMUNICATIONS SOLUTIONS, LLC FORT WORTH 04/17/2002 00482.72500 32-45-01.5 N TX NE 097-20-04.1 W 0000853325 AZLE COMMUNICATIONS SOLUTIONS, LLC FORT WORTH 04/17/2002 00482.75000 32-45-01.5 N NE A 0000855554 J & K Communications, Inc. 04/18/2002 00461.10000 Page 55 YK - Industrial/Business Pool - Commercial, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222214A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222214A1.txt  
- TX 103-I l-46.5 W TX 104-09-43.7 w TX 104-04-35.0 w TX 104-04-24.0 W TX 104-49-38.6 W TX 102-24-I 0.7 W TX 105-30-02.2 W TX 102-12-06.5 W TX 101-26-15.4 W TX 102-I I-10.5 w TX 102-21-10.0 w TX 102-11-11.5 W TX 100-35-09.3 w MD KNKN628 KNKN728 Corpus Christi SMSA Limited Partnership ALLAMORE 31-12-08.6 N MD Corpus Christi SMSA Limited Partnership Alpine 30-21-04.1 N MD KNKN728 MD KNKN728 Corpus Christi SMSA Limited Partnership CHANCELLOR 30-43-36.1 N MD KNKN728 Corpus Christi SMSA Limited PartnershipFORT DAVIS 30-33-50.5 N Corpus Christi SMSA Limited Partnership Kent 31-02-03.4 N MD KNKN728 KNKN728 Corpus Christi SMSA Limited Partnership Marfa 30-I 9-00.4 N MD MD KNKN728 Corpus Christi SMSA Limited PartnershipPine Springs 31-51-24.0 N Corpus Christi SMSA Limited Partnership SANDERSON 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222215A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222215A1.txt  
- INC. NUTALL RISE 05/03/2002 30-08-33.0 N FL MD KNKN628 083-30-30.0 W 0000874535 FLORIDA RSA #8, INC. PERRY 05/03/2002 30-05-59.0 N FL MD KNKN628 083-24-08.0 W 0000874535 FLORIDA RSA #8, INC. SALEM 05/03/2002 29-53-00.0 N TX MD KNKN728 104-56-45.5 W 0000874581 Corpus Christi SMSA Limited PartnershipALLAMORE 05/03/2002 31-12-08.6 N TX MD KNKN728 103-39-24.3 W 0000874581 Corpus Christi SMSA Limited PartnershipAlpine 05/03/2002 30-21-04.1 N Page 3 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD KNKN728 103-11-46.5 W 0000874581 Corpus Christi SMSA Limited PartnershipCHANCELLOR 05/03/2002 30-43-36.1 N TX MD KNKN728 104-09-43.7 W 0000874581 Corpus Christi SMSA Limited PartnershipFORT DAVIS 05/03/2002 30-33-50.5 N TX MD KNKN728 104-04-35.0 W 0000874581 Corpus Christi 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222497A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222497A1.txt  
- 4200.0000 MHz 230KG7W 51.56 dBW QPSK Digital, 1/2 FEC, 192kbps Data Rate 5925.0000 - 6425.0000 MHz 230KG7W Points of Communication: 1 - ALSAT - (ALSAT) E920477 SES-MOD-20011219-02378 WCTV LICENSEE CORP. Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service "MOD" to change emission designator and related service. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 73.80 dBW COMPRESSED DIGITAL VIDEO, DATA, TELEPHONY 5925.0000 - 6425.0000 MHz 4M00G7W 73.30 dBW COMPRESSED DIGITAL VIDEO, DATA, TELEPHONY 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E990291 SES-MOD-20020424-00650 Sirius Satellite Radio Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Satellite Digital Audio Radio Service Modification filed to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222731A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222731A1.txt  
- E020121 SES-LIC-20020423-00724 Bible Broadcasting Network Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Applicant wishes to utilize PAS-3R at 43 W.L. 35 ° 5 ' 11.00 " N LAT. SITE ID: 1 7315 PINEVILLE-MATTHEWS ROAD, MECKLENGURG, CHARLOTTE, NC 80 ° 50 ' 31.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 5 METER OFFSET 54.00 dBW DIGITAL DATA CARRIER 5925.0000 - 6425.0000 MHz 200KG7W DIGITAL DATA CARRIER 3700.0000 - 4200.0000 MHz 200KG7W Page 1 of 4 Points of Communication: 1 - ALSAT - (ALSAT) E020131 SES-LIC-20020515-00787 Cislunar Networks Corporation Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 37 ° 0 ' 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222893A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-222893A1.txt  
- TX MD KLN40 102-35-41.7 W 0000893451 EL PASO NATURAL GAS COMPANY PLAINS 05/20/2002 06735.00000 33-16-22.3 N TX MD KLN40 102-35-41.7 W 0000893451 EL PASO NATURAL GAS COMPANY PLAINS 05/20/2002 06775.00000 33-16-22.3 N NM MD KLC23 103-07-44.7 W 0000893486 EL PASO NATURAL GAS COMPANY LOVINGTON 05/20/2002 06765.00000 32-54-02.3 N TX MD KKY92 102-02-34.6 W 0000893497 COLORADO INTERSTATE GAS COMPANYETTER 05/20/2002 06645.00000 36-04-04.1 N TX MD KJT43 101-37-12.6 W 0000893506 Colorado Interstate Gas Co. FRITCH 05/20/2002 06555.62500 35-37-58.1 N CA MD WPUR715 117-47-46.3 W 0000893605 City of Los Angeles Department of Water & Power LONE PINE 05/20/2002 00928.76250 36-32-00.8 N CA MD WPUR715 117-47-46.3 W 0000893605 City of Los Angeles Department of Water & Power LONE PINE 05/20/2002 00952.76250 36-32-00.8 N TX MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223094A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223094A1.txt  
- NH MD WMV280 071-28-02.0 W 0000906086 Hearst-Argyle Properties, Inc. MANCHESTER 05/30/2002 19280.00000 42-59-07.0 N Page 26 TI - TV Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR NE 122-17-32.2 W 0000903172 Fisher Broadcasting - Portland TV, LLC COLTON / COUNTY OF C 05/28/2002 06987.50000 45-07-51.4 N CA NE 121-52-04.1 W 0000905047 KTVU Partnership San Jose 05/29/2002 18090.00000 37-21-22.7 N MA NE 072-42-12.0 W 0000906468 WWLP Broadcasting, LLC FEEDING HILLS 05/30/2002 12962.50000 42-05-05.0 N TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NH MD WPOP494 071-28-02.0 W 0000906957 HEARST-ARGYLE PROPERTIES, Inc. MANCHESTER 05/31/2002 19620.00000 42-59-07.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223320A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223320A1.txt  
- MEMPHIS 06/05/2002 00851.31250 35-06-45.3 N TN MD KNHA547 089-53-22.3 W 0000914449 NEXTEL LICENSE HOLDINGS 1, INC. MEMPHIS 06/05/2002 00851.31250 35-06-45.3 N MD KNHJ357 A 0000914451 NEXTEL LICENSE HOLDINGS 4, INC. 06/05/2002 00806.00000 - 00821.00000 MD KNHJ357 A 0000914451 NEXTEL LICENSE HOLDINGS 4, INC. 06/05/2002 00809.61250 NM MD KNHJ357 X 0000914451 NEXTEL LICENSE HOLDINGS 4, INC. 06/05/2002 00809.61250 NM MD KNHJ357 106-27-04.1 W 0000914451 NEXTEL LICENSE HOLDINGS 4, INC. ALBUQUERQUE 06/05/2002 00854.61250 35-12-54.2 N NM MD KNHJ357 106-27-04.1 W 0000914451 NEXTEL LICENSE HOLDINGS 4, INC. ALBUQUERQUE 06/05/2002 00854.61250 35-12-54.2 N MD WNJU401 A 0000914453 NEXTEL LICENSE HOLDINGS 4, INC. 06/05/2002 00806.00000 - 00821.00000 MD WNJU401 A 0000914453 NEXTEL LICENSE HOLDINGS 4, INC. 06/05/2002 00807.38750 IL MD WNJU401 X 0000914453 NEXTEL LICENSE HOLDINGS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223529A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223529A1.txt  
- 06345.49000 30-52-58.7 N LA AM WAH539 090-54-31.4 W 0000859425 BELL ATLANTIC MOBILE SYSTEMS OF ALLENTOWN INC CLINTON 06/12/2002 06345.50000 30-52-58.7 N LA AM WAH539 090-54-31.4 W 0000859425 BELL ATLANTIC MOBILE SYSTEMS OF ALLENTOWN INC CLINTON 06/12/2002 06375.14000 30-52-58.7 N LA AM WAH539 090-54-31.4 W 0000859425 BELL ATLANTIC MOBILE SYSTEMS OF ALLENTOWN INC CLINTON 06/12/2002 06375.20000 30-52-58.7 N WV AM WPTQ569 077-55-04.1 W 0000865871 Local Communications Network, Inc. Martinsburg 06/11/2002 05945.20000 39-23-47.0 N WV AM WPTQ569 077-55-04.1 W 0000865871 Local Communications Network, Inc. Martinsburg 06/11/2002 05974.85000 39-23-47.0 N WV AM WPTQ569 077-55-04.1 W 0000865871 Local Communications Network, Inc. Martinsburg 06/11/2002 06004.50000 39-23-47.0 N WV AM WPTQ569 077-55-04.1 W 0000865871 Local Communications Network, Inc. Martinsburg 06/11/2002 06034.15000 39-23-47.0 N WV AM WPTQ569 077-55-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223723A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-223723A1.txt  
- 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 080-17-23.1 W 0000933175 Aeronautical Radio Inc Miami 06/20/2002 00136.85000 25-46-55.3 N CA NE 121-35-26.7 W 0000933196 Aeronautical Radio Inc Sacramento 06/20/2002 00131.77500 38-41-43.5 N AZ NE 112-05-35.5 W 0000933214 Aeronautical Radio Inc Phoenix 06/20/2002 00129.67500 33-41-04.1 N OH NE 083-40-07.3 W 0000933299 Aeronautical Radio Inc Findlay 06/20/2002 00130.65000 41-08-48.7 N TX NE 095-24-52.0 W 0000933313 Aeronautical Radio Inc Conroe 06/20/2002 00130.50000 30-21-06.6 N AZ NE 112-08-49.0 W 0000933323 Aeronautical Radio Inc Grand Canyon 06/20/2002 00129.37500 35-57-08.4 N WY NE 110-44-15.8 W 0000933351 Aeronautical Radio Inc Jackson Hole 06/20/2002 00130.35000 43-36-26.3 N WI NE 088-33-25.4 W 0000933359 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224146A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224146A1.txt  
- File Number Frequency (MHz) Applicant Name Latitude City CA AM 120-27-26.8 W 0000896757 Federal Express Corporation Santa Maria 07/01/2002 00122.87500 34-53-56.1 N MA MD WJI9 071-00-19.2 W 0000949400 AERONAUTICAL RADIO INC BOSTON 07/03/2002 00130.20000 42-21-51.4 N OH NE 083-40-07.3 W 0000949422 Aeronautical Radio Inc Findlay 07/03/2002 00130.65000 41-08-48.7 N AZ NE 112-05-35.5 W 0000949424 Aeronautical Radio Inc Phoenix 07/03/2002 00129.67500 33-41-04.1 N CA NE 121-35-26.7 W 0000949429 Aeronautical Radio Inc Sacramento 07/03/2002 00131.77500 38-41-43.5 N TX NE 095-24-52.0 W 0000950158 Aeronautical Radio Inc Conroe 07/03/2002 00130.50000 30-21-06.6 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ NE 112-08-49.0 W 0000950208 Aeronautical Radio Inc Grand 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224621A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224621A1.txt  
- 102-16-56.5 W 0000963791 TXU Business Services Company Lamesa 07/16/2002 06855.00000 32-30-38.3 N NJ NE 074-28-12.0 W 0000963969 University of Medicine & Dentistry of NJ/Behavorial Healthcare Piscataway 07/16/2002 19540.00000 40-31-32.8 N NJ NE 074-28-10.2 W 0000964013 University of Medicine & Dentistry of NJ/Behavioral HealthCare Piscataway 07/16/2002 17980.00000 40-33-02.3 N NY NE 073-59-37.6 W 0000964400 New York University New York 07/16/2002 21975.00000 40-44-04.1 N NY NE 074-00-07.1 W 0000964505 New York University New York 07/16/2002 23175.00000 40-43-02.9 N GM NE 092-33-14.0 W 0000965354 EPEC Communications Corporation Offshore 07/17/2002 00943.52500 27-55-21.0 N GM NE 092-32-47.4 W 0000965438 EPEC Communications Corporation Offshore 07/17/2002 00934.52500 28-04-22.9 N TX NE 102-01-02.5 W 0000966097 TXU Business Services Company LAMESA 07/17/2002 06645.00000 32-44-23.3 N TX NE 102-01-02.5 W 0000966097 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224861A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-224861A1.txt  
- W 0000977102 Corban Communications, Inc. SPEARMAN 07/26/2002 06197.24000 36-15-23.1 N TX NE 101-07-46.6 W 0000977102 Corban Communications, Inc. SPEARMAN 07/26/2002 06226.89000 36-15-23.1 N TX NE 101-07-46.6 W 0000977102 Corban Communications, Inc. SPEARMAN 07/26/2002 06286.19000 36-15-23.1 N TX NE 101-07-46.6 W 0000977102 Corban Communications, Inc. SPEARMAN 07/26/2002 06315.84000 36-15-23.1 N TX NE 101-27-43.6 W 0000977103 Corban Communications, Inc. PRINGLE 07/26/2002 05945.20000 35-57-04.1 N TX NE 101-27-43.6 W 0000977103 Corban Communications, Inc. PRINGLE 07/26/2002 05974.85000 35-57-04.1 N Page 37 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 101-27-43.6 W 0000977103 Corban Communications, Inc. PRINGLE 07/26/2002 06034.15000 35-57-04.1 N TX NE 101-27-43.6 W 0000977103 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225135A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225135A1.txt  
- BALTIMORE CELLULAR LIMITED PARTNERSHIP MOOREFIELD 08/02/2002 06363.40400 39-02-14.4 N WV MD WMW260 079-05-24.5 W 0000984182 WASHINGTON BALTIMORE CELLULAR LIMITED PARTNERSHIP MOOREFIELD 08/02/2002 06620.62500 39-02-14.4 N WV MD WMW260 079-05-24.5 W 0000984182 WASHINGTON BALTIMORE CELLULAR LIMITED PARTNERSHIP MOOREFIELD 08/02/2002 06785.00000 39-02-14.4 N WV MD WMW259 078-42-59.7 W 0000984191 WASHINGTON BALTIMORE CELLULAR LIMITED PARTNERSHIP ROMNEY 08/02/2002 06625.00000 39-18-37.9 N WV MD WMW945 079-16-04.1 W 0000984194 WASHINGTON BALTIMORE CELLULAR LIMITED PARTNERSHIP PENDLETON 08/02/2002 05945.20000 38-47-27.0 N WV MD WMW945 079-16-04.1 W 0000984194 WASHINGTON BALTIMORE CELLULAR LIMITED PARTNERSHIP PENDLETON 08/02/2002 06111.36400 38-47-27.0 N NC MD WLS726 076-58-47.8 W 0000984274 NORTH CAROLINA RSA #9, INC. CROATAN 08/02/2002 02165.20000 34-58-55.6 N NC MD WLS726 076-58-47.8 W 0000984274 NORTH CAROLINA RSA #9, INC. CROATAN 08/02/2002 02178.00000 34-58-55.6 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225574A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225574A1.txt  
- Inc Gulf of Mexico 08/15/2002 00129.77500 28-03-09.9 N GM NE 093-44-00.5 W 0000998309 Aeronautical Radio Inc Gulf of Mexico 08/15/2002 00129.77500 28-28-00.9 N SC NE 082-13-07.8 W 0000998317 Aeronautical Radio Inc Greer 08/15/2002 00131.20000 34-53-44.4 N NH RM WBO7 071-11-48.3 W 0000997050 STATE OR NEW HAMPSHIRE DEPARTMENT OF TRANSPORTATION DIVISION OF AERONAUTICS GORHAM 08/14/2002 00122.80000 44-23-35.2 N WA RM WYC2 119-19-04.1 W 0000997739 AERONAUTICAL RADIO INC MOSES LAKE 08/15/2002 00131.95000 47-11-59.5 N RO WDC9 0000993436 PHILLIPS COMMUNICATIONS INC 08/12/2002 RO KKQ7 0000993981 HAWAII, STATE OF 08/12/2002 RO WRD9 0000994179 BERZ FLYING SERVICE INC 08/07/2002 RO WMU3 0000996106 ATLANTIC AIRCRAFT INC 08/08/2002 RO KDV4 0000996939 EXXON COMMUNICATIONS COMPANY 08/14/2002 RO WBK5 0000996940 EXXON COMMUNICATIONS COMPANY 08/14/2002 RO WKK8 0000998248 RHODE ISLAND, STATE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225742A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-225742A1.txt  
- 25M0F8F 80.30 dBW DIGITAL VIDEO 14000.0000 - 14500.0000 MHz 4M00G7F ANALOG VIDEO 11700.0000 - 12200.0000 MHz 25M0F8F DIGITAL VIDEO 11700.0000 - 12200.0000 MHz 4M00G7F Points of Communication: 1 - ALSAT - (ALSAT) Application for Authority Class of Station: Temporary Fixed Earth Station RCN License Subsidiary, Inc. E020219 SES-LIC-20020822-01387E Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates from 64kbps, Various information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates, 1/2 - 7/8, Various Data Rates to 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226134A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226134A1.txt  
- Frequency (MHz) Applicant Name Latitude City PA MD WPOR402 079-58-26.2 W 0001019944 PITTSBURGH, CITY OF PITTSBURGH 09/05/2002 10705.00000 40-27-40.2 N PA MD WPOR402 079-58-26.2 W 0001019944 PITTSBURGH, CITY OF PITTSBURGH 09/05/2002 19640.00000 40-27-40.2 N MN MD WPQL597 092-31-12.2 W 0001020486 Minnesota State of VIRGINIA 09/06/2002 06655.00000 47-29-14.3 N MI NE 083-57-57.6 W 0001017580 SAGINAW COUNTY 911 AUTHORITY SAGINAW 09/03/2002 10616.25000 43-25-04.1 N WA NE 117-22-03.6 W 0001018358 Spokane School District 81 Spokane 09/04/2002 19600.00000 47-37-09.6 N WA NE 117-18-01.7 W 0001018376 Spokane School District 81 Spokane 09/04/2002 18040.00000 47-34-33.6 N CO NE 107-16-55.5 W 0001018912 ROUTT COUNTY HAYDEN 09/04/2002 06615.00000 40-31-27.4 N CO NE 107-16-55.5 W 0001018912 ROUTT COUNTY HAYDEN 09/04/2002 06665.00000 40-31-27.4 N CO NE 107-16-55.5 W 0001018912 ROUTT COUNTY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226361A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226361A1.txt  
- - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO NE 090-21-35.9 W 0001028064 Aeronautical Radio Inc St Louis 09/13/2002 00130.10000 38-44-51.6 N MO NE 090-21-35.9 W 0001028064 Aeronautical Radio Inc St Louis 09/13/2002 00131.72500 38-44-51.6 N NJ NE 075-04-20.0 W 0001028141 Aeronautical Radio Inc Millville 09/13/2002 00131.10000 39-22-04.1 N IL NE 087-54-16.0 W 0001028148 Aeronautical Radio Inc Chicago 09/13/2002 00130.30000 41-58-46.5 N FL NE 081-03-29.0 W 0001028154 Aeronautical Radio Inc Daytona 09/13/2002 00130.00000 29-10-47.7 N WI NE 087-53-47.7 W 0001028161 Aeronautical Radio Inc Milwaukee 09/13/2002 00131.20000 42-56-50.0 N AR NE 094-10-12.2 W 0001028167 Aeronautical Radio Inc Fayetteville 09/13/2002 00129.67500 36-00-18.3 N GA NE 081-57-52.2 W 0001028171 Aeronautical Radio 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-226838A20.doc  
- that focus on the operating performance of radio companies (i.e., EBIT margins and net profit margins). Ratios that shed light on the financing of radio companies are then explored (i.e., total debt as a percentage of total capital, fixed charge coverage after taxes, market to book ratio, and stock market returns). All charts appear at the end of this section. 4.1 EBIT Margins The earnings before interest and taxes margin (EBIT Margin) is defined as the ratio of a firm's earnings (before subtracting out interest and taxes) to the firm's total sales. As such, this ratio reflects how efficiently the firm generates profits from its sales, or alternatively stated, how well the firm minimizes the operating, personnel and administrative costs of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227907A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-227907A1.txt  
- KANSAS INC ABILENE 10/24/2002 06404.79000 38-57-34.9 N CA AM 115-29-56.0 W 0001043982 Cellco Partnership EL CENTRO 10/22/2002 06130.51000 32-47-45.2 N CA AM 115-29-56.0 W 0001043982 Cellco Partnership EL CENTRO 10/22/2002 06168.75000 32-47-45.2 N CA AM 115-29-56.0 W 0001043982 Cellco Partnership EL CENTRO 10/22/2002 10628.12500 32-47-45.2 N CA AM WMQ712 118-11-22.3 W 0001065315 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 10/23/2002 10588.12500 33-53-04.1 N FL MD WMM918 081-39-42.0 W 0001064001 FLORIDA RSA #8, INC. PALATKA 10/21/2002 02115.20000 29-36-45.0 N FL MD WMM918 081-39-42.0 W 0001064001 FLORIDA RSA #8, INC. PALATKA 10/21/2002 02118.40000 29-36-45.0 N FL MD WMM918 081-39-42.0 W 0001064001 FLORIDA RSA #8, INC. PALATKA 10/21/2002 06745.00000 29-36-45.0 N FL MD WMM918 081-39-42.0 W 0001064001 FLORIDA RSA #8, INC. PALATKA 10/21/2002 10618.12500 29-36-45.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228552A1.pdf  
- Spectrum...........................................................................3 2.1 Flexibility of Use............................................................................................................3 2.2 Exhaustive assignment of spectrum rights......................................................................4 2.3 Exclusive licenses...........................................................................................................5 2.4 Proper definition of interference rights...........................................................................6 2.5 Special provisions for low-power devices......................................................................7 3 Elements of an Efficient Transition to Spectrum Markets......................................................8 3.1 Speed...............................................................................................................................9 3.2 Low transaction costs......................................................................................................9 3.3 Transparency...................................................................................................................9 3.4 Liquidity........................................................................................................................10 3.5 Participation..................................................................................................................10 3.6 Simultaneity..................................................................................................................11 3.7 Package Bidding...........................................................................................................14 4 A Proposed Transition Market Mechanism: Band-Restructuring Auctions........................16 4.1 Simultaneous two-sided auction with package bidding................................................16 4.2 Voluntary participation is the quid pro quo for flexibility............................................19 4.3 An incumbent need not sell its license..........................................................................21 4.4 Efficient and fair division of auction proceeds.............................................................22 4.5 FCC conducted band restructuring auctions................................................................23 5 What Spectrum Should be Restructured?.............................................................................24 5.1 300 MHz to 3000 MHz.................................................................................................25 5.2 Eliminating difficult bands from the initial implementation........................................26 Federal government 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228686A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228686A1.txt  
- (ALSAT) REMOTE 7 - ALSAT - (ALSAT) REMOTE 8 - ALSAT - (ALSAT) REMOTE 9 - ALSAT - (ALSAT) Page 18 of 35 Application for Authority 11/18/2002 - 11/18/2017 Date Effective: 11/18/2002 Class of Station: Temporary Fixed Earth Station Grant of Authority RCN License Subsidiary, Inc. E020219 SES-LIC-20020822-01387E Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates from 64kbps, Various information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates, 1/2 - 7/8, Various Data Rates to 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228691A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228691A1.txt  
- BROADCASTING LICENSES, INC. CHARLES CITY 11/13/2002 00944.87500 43-03-05.0 N IA MD WPUN386 092-40-01.0 W 0001089333 CLEAR CHANNEL BROADCASTING LICENSES, INC. CHARLES CITY 11/13/2002 00945.12500 43-03-05.0 N IL MD WMU683 089-34-56.0 W 0001089451 Saga Communications of Illinois, Inc. Springfield 11/13/2002 00946.50000 39-49-54.0 N AZ MD WLG277 112-04-27.5 W 0001090790 Emmis Radio License Corporation PHOENIX 11/14/2002 00944.50000 33-30-56.1 N FL MD WPOL496 080-08-04.1 W 0001091743 Clear Channel Broadcasting Licenses, Inc.West Palm Beach 11/15/2002 00948.00000 26-45-26.2 N FL MD WPOL665 080-08-04.1 W 0001091930 Clear Channel Broadcasting Licenses, Inc.West Palm Beach 11/15/2002 00948.00000 26-45-26.2 N CA MD WBG611 120-29-29.5 W 0001092027 Mapleton Communications, LLC MERCED 11/15/2002 00951.00000 37-18-14.3 N CA MD WPNG772 120-29-29.5 W 0001092048 Mapleton Communications, LLC MERCED 11/15/2002 00950.00000 37-18-14.3 N CA MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228932A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228932A1.txt  
- 3 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO MD WGX214 094-32-48.8 W 0001099081 CALVARY BIBLE COLLEGE Kansas City 11/21/2002 00948.00000 38-50-19.0 N FL MD WPOU510 080-08-39.0 W 0001099287 CLEAR CHANNEL BROADCASTING LICENSES, INC. WEST PALM BEACH 11/21/2002 00951.75000 26-45-34.0 N FL MD WHG433 080-08-04.1 W 0001099306 CLEAR CHANNEL BROADCASTING LICENSES, INC. WEST PALM BEACH 11/21/2002 00949.50000 26-45-26.2 N WI MD WPNF357 091-14-07.5 W 0001099528 State of Wisconsin - Educational Communications Board LA CROSSE 11/22/2002 00945.73750 43-48-59.9 N FL MD WLG407 080-12-19.2 W 0001099936 WQAM LICENSE LP MIAMI 11/22/2002 00951.50000 25-57-41.3 N FL MD WLG407 080-12-19.2 W 0001099936 WQAM LICENSE LP MIAMI 11/22/2002 00951.50000 25-57-41.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228964A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-228964A1.txt  
- E850092 SES-MOD-20021014-01766E Nature of Service:Domestic Fixed Satellite Service "MOD" to add new emission designator and related service, to increase EIRP and EIRP density and to remove remote control point. 43 ° 5 ' 25.00 " N LAT. SITE ID: 1 720 EAST CAPITOL DRIVE, MILWAUKEE, MILWAUKEE, WI 87 ° 54 ' 5.30 " W LONG. LOCATION: COMTECH ANT CORP 1 4.1 meters ANTENNA ID: OFFSAT "18FT" 57.88 dBW 5925.0000 - 6425.0000 MHz 200KF3E 59.80 dBW QPSK DIGITAL, 1/2 FEC, 256 KBPS 5925.0000 - 6425.0000 MHz 307KG7W Points of Communication: 1 - ALSAT - (ALSAT) Application for Modification Class of Station: Mobile Earth Station Vistar Data Communications, Inc. E990316 SES-MOD-20021112-01973E Page 6 of 14 Nature of Service:Mobile Satellite Service Vistar proposes to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229048A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229048A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229048A1.txt  
- process on a case by case basis. The core elements of the three stage consultation process, however, are never dispensed. They serve as the minimum procedural safeguard to ensure the transparency of the rulemaking process. Canada. Conflict of Interest and Post Employment, Appendix A, Part II. Hong Kong. Civil Service Branch Circular No. 17/92. United Kingdom. Civil Service Management Code, 4.1.3. United States. Standards of Ethical Conduct. Canada. Conflict of Interest and Post Employment, Appendix A, Part II. Hong Kong. OFTA Standing Circular No. 1/99, Civil Service Branch Circular No. 19/92 for general guidance to prevent conflict of interest. United Kingdom. Civil Service Management Code, 4.1.3(a),(c). United States. FCC. ``Ethics Program Topics.'' United States. Standards of Ethical Conduct. Canada. Conflict of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229150A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229150A1.txt  
- 11/26/2002 00956.39375 31-30-39.0 N IN NE P 085-29-37.0 W 0001103456 CITY OF HUNTINGTON HUNTINGTON 11/18/2002 00956.43125 40-53-02.0 N IA NE 091-38-40.0 W 0001103623 SECOND GENERATION OF IOWA, LTDCEDAR RAPIDS 11/26/2002 21925.00000 42-02-43.0 N IA NE 091-38-26.0 W 0001103629 SECOND GENERATION OF IOWA, LTDCEDAR RAPIDS 11/26/2002 23125.00000 42-01-39.6 N TX NE P 100-00-40.0 W 0001104208 CITY OF MERKEL MERKEL 11/18/2002 00956.44375 32-28-04.1 N TX NE P 096-28-36.1 W 0001104211 CITY OF CORSICANA CORSICANA 11/18/2002 00956.39375 32-05-37.3 N NM NE P 107-58-12.0 W 0001104217 CITY OF BLOOMFIELD BLOOMFIELD 11/18/2002 00952.31875 36-42-51.1 N OR NE P 123-17-42.0 W 0001104218 CITY OF SUTHERLIN SUTHERLIN 11/18/2002 00956.41875 43-23-33.0 N AZ NE P 111-47-18.0 W 0001104223 TOWN OF GILBERT GILBERT 11/18/2002 00956.34375 33-21-10.0 N IL NE P 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229201A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229201A1.txt  
- 11/26/2002 00956.39375 31-30-39.0 N IN NE P 085-29-37.0 W 0001103456 CITY OF HUNTINGTON HUNTINGTON 11/18/2002 00956.43125 40-53-02.0 N IA NE 091-38-40.0 W 0001103623 SECOND GENERATION OF IOWA, LTDCEDAR RAPIDS 11/26/2002 21925.00000 42-02-43.0 N IA NE 091-38-26.0 W 0001103629 SECOND GENERATION OF IOWA, LTDCEDAR RAPIDS 11/26/2002 23125.00000 42-01-39.6 N TX NE P 100-00-40.0 W 0001104208 CITY OF MERKEL MERKEL 11/18/2002 00956.44375 32-28-04.1 N TX NE P 096-28-36.1 W 0001104211 CITY OF CORSICANA CORSICANA 11/18/2002 00956.39375 32-05-37.3 N NM NE P 107-58-12.0 W 0001104217 CITY OF BLOOMFIELD BLOOMFIELD 11/18/2002 00952.31875 36-42-51.1 N OR NE P 123-17-42.0 W 0001104218 CITY OF SUTHERLIN SUTHERLIN 11/18/2002 00956.41875 43-23-33.0 N AZ NE P 111-47-18.0 W 0001104223 TOWN OF GILBERT GILBERT 11/18/2002 00956.34375 33-21-10.0 N IL NE P 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229301A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229301A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229301A1.txt  
- (UNE) loops leased from other carriers. The remainder of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 29% more UNE loops with switching to other carriers at the end of June 2002 than they reported six months earlier (7.5 million compared to 5.8 million) and about 10% more UNE loops without switching (about 4.1 million compared to 3.7 million). At least one CLEC was serving local telephone service end-user customers in 67% of the nation's zip codes at the end of June 2002, up from 60% a year earlier. About 93% of United States households resided in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229376A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229376A1.txt  
- Latitude City FL AM 081-12-10.0 W 0001038133 University Of Central Florida Orlando 12/04/2002 00945.87500 28-36-13.0 N IL AM WMU747 090-40-43.7 W 0001043625 WESTERN ILLINOIS UNIVERSITY MACOMB 12/02/2002 00945.00000 40-28-13.6 N IL AM WMU747 090-40-43.7 W 0001043625 WESTERN ILLINOIS UNIVERSITY MACOMB 12/02/2002 00945.00000 40-28-13.6 N IL AM 090-40-21.7 W 0001043661 WESTERN ILLINOIS UNIVERSITY Macomb 12/02/2002 00951.50000 40-28-39.1 N FL AM WPOL496 080-05-04.1 W 0001091743 Clear Channel Broadcasting Licenses, Inc.West Palm Beach 12/06/2002 00948.00000 26-45-26.2 N FL AM WPOL665 080-05-04.1 W 0001091930 Clear Channel Broadcasting Licenses, Inc.West Palm Beach 12/06/2002 00948.00000 26-45-26.2 N FL AM WPOL666 080-05-04.1 W 0001092155 Clear Channel Broadcasting Licenses, Inc.West Palm Beach 12/06/2002 00946.25000 26-45-26.2 N FL AM 080-05-04.1 W 0001092301 CLEAR CHANNEL BROADCASTING LICENSES, INC. WEST PALM BEACH 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229413A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229413A1.txt  
- ' 44.00 " N LAT. SITE ID: 1 Vernon Crossing Road, SUSSEX, GLENWOOD, NJ 74 ° 29 ' 40.00 " W LONG. LOCATION: HARRIS 1 13 meters ANTENNA ID: 5270 91.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F8W Page 29 of 33 3700.0000 - 4200.0000 MHz 36M0F3F COMTECH 2 4.1 meters ANTENNA ID: "18 FT." OFFSAT 91.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) Renewal 01/29/2003 - 01/29/2018 Date Effective: 12/10/2002 Class of Station: Temporary Fixed Earth Station Grant of Authority CNG Communications, Inc. E920021 SES-RWL-20021209-02096E 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229616A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229616A1.txt  
- 122-28-01.0 W 0001048816 Tribune Television Northwest, Inc. TACOMA 12/13/2002 06912.50000 47-14-31.0 N WA AM 122-18-30.4 W 0001048845 Tribune Television Northwest, Inc. Seattle 12/13/2002 07012.50000 47-36-56.3 N CA AM WLE980 122-27-10.0 W 0001107302 KGO Television, Inc. SAN FRANCISCO 12/10/2002 07075.00000 - 07100.00000 37-45-19.0 N NH MD WPOP493 071-35-17.2 W 0001114654 HEARST-ARGYLE PROPERTIES, Inc. GOFFSTOWN 12/09/2002 18080.00000 42-58-59.3 N CA MD WPNB973 117-19-04.1 W 0001116618 SUNBELT TELEVISION INC CRESTLINE 12/10/2002 00770.00000 - 00776.00000 34-14-10.0 N CA MD WPNB973 117-19-04.1 W 0001116618 SUNBELT TELEVISION INC CRESTLINE 12/10/2002 07100.00000 - 07125.00000 34-14-10.0 N CA MD WPNB973 117-19-04.1 W 0001116618 SUNBELT TELEVISION INC CRESTLINE 12/10/2002 07100.00000 - 07125.00000 34-14-10.0 N CA MD WPNA879 115-27-50.4 W 0001122405 ENTRAVISION HOLDINGS LLC BRAWLEY 12/13/2002 06875.00000 - 06900.00000 32-58-41.2 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229950A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-229950A1.txt  
- 5295.0000 - 5930.0000 MHz 1M23G2W QPSK, DIGITAL COMPRESSED VIDEO & DATA 3700.0000 - 4200.0000 MHz 3M69G2W QPSK, DIGITAL COMPRESSED VIDEO & DATA 3700.0000 - 4200.0000 MHz 1M23G2W 40 ° 46 ' 11.80 " N LAT. SITE ID: 1 5 TRIAD CENTER, SALT LAKE, SALT LAKE CITY, UT 111 ° 54 ' 5.80 " W LONG. LOCATION: COMTECH ANTENNA SYS 1 4.1 meters ANTENNA ID: OFFSAT 60.10 dBW QPSK, DIGITAL COMPRESSED VIDEO & DATA 6360.7000 - 6425.0000 MHz 3M69G2W 60.10 dBW QPSK, DIGITAL COMPRESSED VIDEO & DATA 6108.6000 - 6330.3000 MHz 3M69G2W 53.70 dBW QPSK, DIGITAL COMPRESSED VIDEO & DATA 6108.6000 - 6330.3000 MHz 1M23G2W QPSK, DIGITAL COMPRESSED VIDEO & DATA 3700.0000 - 4200.0000 MHz 3M69G2W 53.70 dBW QPSK, DIGITAL COMPRESSED VIDEO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230091A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230091A1.txt  
- (ALSAT) Application for Modification 02/06/1998 - 02/06/2008 Date Effective: 01/07/2003 Class of Station: Fixed Earth Stations Grant of Authority Norlight, Inc. E850092 SES-MOD-20021014-01766E Nature of Service:Domestic Fixed Satellite Service 43 ° 5 ' 25.00 " N LAT. SITE ID: 1 720 EAST CAPITOL DRIVE, MILWAUKEE, MILWAUKEE, WI 87 ° 54 ' 5.30 " W LONG. LOCATION: COMTECH ANT CORP 1 4.1 meters ANTENNA ID: OFFSAT "18FT" 57.88 dBW 5925.0000 - 6425.0000 MHz 200KF3E 59.80 dBW QPSK DIGITAL, 1/2 FEC, 256 KBPS 5925.0000 - 6425.0000 MHz 307KG7W Points of Communication: 1 - ALSAT - (ALSAT) Page 6 of 10 Application for Modification 07/31/2002 - 07/31/2017 Date Effective: 01/07/2003 Class of Station: Fixed Earth Stations Grant of Authority EDUCATIONAL MEDIA FOUNDATION E920417 SES-MOD-20021022-01806E 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230456A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230456A1.txt  
- Aeronautical Radio Inc Medford 01/13/2003 00130.52500 42-22-27.2 N OR NE 123-13-07.3 W 0001154518 Aeronautical Radio Inc Eugene 01/13/2003 00130.52500 44-07-23.7 N WY NE 110-44-15.9 W 0001154533 Aeronautical Radio Inc Jackson Hole 01/13/2003 00129.92500 43-36-26.4 N CO NE 105-55-58.9 W 0001154567 Aeronautical Radio Inc Gunnison 01/13/2003 00129.92500 38-22-02.2 N MN NE 093-03-35.9 W 0001154575 Aeeronautical Radio Inc St Paul 01/13/2003 00129.95000 44-56-04.1 N MI NE 090-07-53.0 W 0001154580 Aeronautical Radio Inc Ironwood 01/13/2003 00136.60000 46-31-38.9 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 095-20-23.0 W 0001154588 Aeronautical Radio Inc Houston 01/13/2003 00129.42500 29-58-49.7 N GA NE 083-57-44.0 W 0001154592 Aeronautical Radio Inc Lawrenceville 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230619A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-230619A1.txt  
- Georgia Power Company Grantville 01/22/2003 00956.39375 33-12-39.0 N GA NE P 085-04-42.0 W 0001167071 Georgia Power Company Buchanan 01/22/2003 00956.39375 33-53-19.0 N GA NE P 084-15-52.0 W 0001167193 Georgia Power Company Atlanta 01/22/2003 00956.39375 33-40-39.0 N CA NE 117-05-39.7 W 0001167885 AirFiber, Inc. San Diego 01/22/2003 22175.00000 33-00-53.6 N CA NE 117-05-53.8 W 0001167987 AirFiber, Inc. San Diego 01/22/2003 23375.00000 33-01-04.1 N IL NE 088-56-49.0 W 0001168255 AMEREN SERVICES MARION 01/22/2003 00928.68125 37-43-58.0 N IL NE 088-56-49.0 W 0001168255 AMEREN SERVICES MARION 01/22/2003 00952.68125 37-43-58.0 N NY NE 073-40-20.4 W 0001168468 Northeast Health Troy 01/22/2003 19680.00000 42-44-01.8 N NY NE 073-44-53.8 W 0001168480 Northeast Health Albany 01/22/2003 18120.00000 42-40-26.5 N GA NE P 082-58-04.0 W 0001169614 Georgia Power Company Dupont 01/23/2003 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231163A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231163A1.txt  
- Co OSKALOOSA 02/07/2003 06093.45000 41-13-35.0 N IA MD KYH27 092-45-14.7 W 0001189283 The Burlington Northern and Santa Fe Railway Co OSKALOOSA 02/07/2003 06123.10000 41-13-35.0 N NM NE 108-44-30.7 W 0001182213 GTECH CORPORATION Gallup 01/29/2003 00928.70625 35-32-32.5 N NM NE 108-44-30.7 W 0001182213 GTECH CORPORATION Gallup 01/29/2003 00952.70625 35-32-32.5 N TX NE 099-15-01.1 W 0001182462 HOUSTON EXPLORATION COMPANY ZAPATA 02/03/2003 00928.05625 26-55-04.1 N TX NE 099-15-01.1 W 0001182462 HOUSTON EXPLORATION COMPANY ZAPATA 02/03/2003 00952.05625 26-55-04.1 N AZ NE 112-05-12.0 W 0001182466 BLACK MOUNTAIN BROADBAND LLC PHOENIX 02/03/2003 19560.00000 33-35-39.0 N AZ NE 111-58-59.1 W 0001182505 BLACK MOUNTAIN BROADBAND LLC CAVE CREEK 02/03/2003 18000.00000 33-46-15.4 N TX NE 106-23-32.3 W 0001182714 BRK ELECTRONICS INC. EL PASO 02/03/2003 23325.00000 31-49-00.4 N OH NE 082-58-14.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231527A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231527A1.txt  
- 0001204221 UNITED STATES CELLULAR OPERATING COMPANY LLC OSHKOSH 02/20/2003 06256.54000 43-56-27.0 N WI MD WPSG305 088-37-23.0 W 0001204221 UNITED STATES CELLULAR OPERATING COMPANY LLC OSHKOSH 02/20/2003 06315.84000 43-56-27.0 N WI MD WPSG305 088-37-23.0 W 0001204221 UNITED STATES CELLULAR OPERATING COMPANY LLC OSHKOSH 02/20/2003 06375.14000 43-56-27.0 N CA MD WMQ712 118-11-22.3 W 0001204294 LOS ANGELES SMSA LIMITED PARTNERSHIP COMPTON 02/20/2003 10591.25000 33-53-04.1 N CA MD WPQQ341 117-02-34.9 W 0001204591 Los Angeles SMSA Limited Partnership RANCHO CALIFORNIA 02/20/2003 10643.75000 33-33-12.0 N NC MD WPQT518 077-46-37.6 W 0001204597 North Carolina RSA #9, Inc. Beulaville 02/20/2003 06226.89000 34-54-32.3 N NC MD WPQT518 077-46-37.6 W 0001204597 North Carolina RSA #9, Inc. Beulaville 02/20/2003 06315.84000 34-54-32.3 N NC MD WPQT518 077-46-37.6 W 0001204597 North Carolina RSA #9, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231722A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231722A1.txt  
- - ALSAT - (ALSAT) Renewal 04/23/2003 - 04/23/2018 Date Effective: 03/04/2003 Class of Station: Fixed Earth Stations Grant of Authority PANAMSAT LICENSEE CORP. E930088 SES-RWL-20030228-00251E Nature of Service:Domestic Fixed Satellite Service 34 ° 24 ' 22.00 " N LAT. SITE ID: 1 33 EAST TELEGRAPH ROAD, VENTURA, FILLMORE, CA 118 ° 53 ' 34.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 847130-63 69.10 dBW 5925.0000 - 6425.0000 MHz 700KF3D 55.00 dBW 5925.0000 - 6425.0000 MHz 700KF2D 3700.0000 - 4200.0000 MHz 700KF2D Points of Communication: 1 - ALSAT - (ALSAT) CORRECTIONS E980103 SES-LIC-19971219-01760 Northern Broadcasting System Inc "Correction" Licensee name has been changed to reflect the original licensee. Application appeared on PN Report No. SES-00466, released January 22, 2003 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231723A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-231723A1.txt  
- WV MD WPNB808 080-14-55.0 W 0001213060 HARDY CELLULAR TELEPHONE COMPANY IDAMAY 02/27/2003 06780.00000 39-30-05.0 N IL MD WPRU837 088-30-08.0 W 0001213820 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS LOUISVILLE 02/27/2003 06152.75000 38-44-41.0 N IL MD WPRU837 088-30-08.0 W 0001213820 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS LOUISVILLE 02/27/2003 06845.00000 38-44-41.0 N IL MD WMS899 088-26-04.1 W 0001213828 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS CISNE 02/27/2003 02118.40000 38-30-21.1 N IL MD WMS899 088-26-04.1 W 0001213828 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS CISNE 02/27/2003 06226.89000 38-30-21.1 N IL MD WMS899 088-26-04.1 W 0001213828 SOUTHERN ILLINOIS RSA PARTNERSHIP D/B/A FIRST CELLULAR OF SOUTHERN ILLINOIS CISNE 02/27/2003 06404.79000 38-30-21.1 N IL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232494A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232494A1.txt  
- - (ALSAT) Renewal 04/09/2003 - 04/09/2018 Date Effective: 03/20/2003 Class of Station: Fixed Earth Stations Grant of Authority VERESTAR, INC. E930089 SES-RWL-20030303-00298E Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service 38 ° 47 ' 39.00 " N LAT. SITE ID: 1 6461 Stephenson Way, FAIRFAX, ALEXANDRIA, VA 77 ° 10 ' 0.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18 FT." OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 69.10 dBW 5925.0000 - 6425.0000 MHz 1M54G7D 54.90 dBW 5925.0000 - 6425.0000 MHz 200KF8E Page 42 of 50 3700.0000 - 4200.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 1M54G7D 3700.0000 - 4200.0000 MHz 200KF8E PRODELIN 2 3.8 meters ANTENNA ID: 1381 67.30 dBW 5925.0000 - 6425.0000 MHz 2M00F8W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232514A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232514A1.txt  
- FALLS CELLTELCOSUMNER 03/19/2003 06660.00000 42-50-13.0 N IA MD WPWR424 093-29-52.7 W 0001240426 UNITED STATES CELLULAR OPERATING COMPANY-DES MOINES MILO 03/19/2003 05945.20000 41-12-48.8 N IA MD WPWR424 093-29-52.7 W 0001240426 UNITED STATES CELLULAR OPERATING COMPANY-DES MOINES MILO 03/19/2003 06004.50000 41-12-48.8 N IA MD WPWR424 093-29-52.7 W 0001240426 UNITED STATES CELLULAR OPERATING COMPANY-DES MOINES MILO 03/19/2003 06665.00000 41-12-48.8 N IA MD WPWX236 091-43-04.1 W 0001240710 USCOC OF GREATER IOWA, INC. KALONA 03/19/2003 05974.85000 41-27-27.1 N IA MD WPWX236 091-43-04.1 W 0001240710 USCOC OF GREATER IOWA, INC. KALONA 03/19/2003 06152.75000 41-27-27.1 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IA MD WPWX236 091-43-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232868A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-232868A1.txt  
- KSZ42 123-54-29.3 W 0001247995 CALIFORNIA, STATE OF KLAMATH 03/25/2003 06685.00000 41-31-27.4 N CA MD KCU92 123-43-57.2 W 0001247996 CALIFORNIA, STATE OF WILLOW CREEK 03/25/2003 06765.00000 40-52-28.5 N CA MD KCU92 123-43-57.2 W 0001247996 CALIFORNIA, STATE OF WILLOW CREEK 03/25/2003 06785.00000 40-52-28.5 N CA MD KCU92 123-43-57.2 W 0001247996 CALIFORNIA, STATE OF WILLOW CREEK 03/25/2003 06805.00000 40-52-28.5 N CA MD KCU89 122-45-04.1 W 0001247997 CALIFORNIA, STATE OF LEWISTON 03/25/2003 06595.00000 40-41-07.5 N Page 32 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD KCU89 122-45-04.1 W 0001247997 CALIFORNIA, STATE OF LEWISTON 03/25/2003 06665.00000 40-41-07.5 N MO MD WPOQ263 090-22-02.4 W 0001250491 SAINT LOUIS, CITY OF ST 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233092A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233092A1.txt  
- LINC Birmingham 04/02/2003 00860.81250 33-30-09.0 N AL AM 086-47-22.0 W 0001256641 Southern Communications Services Inc dba Southern LINC Birmingham 04/02/2003 00860.83750 33-30-09.0 N AL AM 086-47-22.0 W 0001256641 Southern Communications Services Inc dba Southern LINC Birmingham 04/02/2003 00860.88750 33-30-09.0 N AL AM 086-47-22.0 W 0001256641 Southern Communications Services Inc dba Southern LINC Birmingham 04/02/2003 00860.91250 33-30-09.0 N OR MD KNNM810 122-42-04.1 W 0001255471 SLATER, ALAN D ASHLAND 03/31/2003 00856.16250 42-04-59.5 N OR MD KNNM810 122-42-04.1 W 0001255471 SLATER, ALAN D ASHLAND 03/31/2003 00857.16250 42-04-59.5 N OR MD KNNM810 122-42-04.1 W 0001255471 SLATER, ALAN D ASHLAND 03/31/2003 00858.16250 42-04-59.5 N OR MD KNNM810 122-42-04.1 W 0001255471 SLATER, ALAN D ASHLAND 03/31/2003 00859.16250 42-04-59.5 N OR MD KNNM810 122-42-04.1 W 0001255471 SLATER, ALAN 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233093A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233093A1.txt  
- 082-26-47.0 W 0001262834 FLORIDA RSA #8, INC. GAINESVILLE 04/04/2003 06555.62500 29-41-13.0 N Page 2 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM KNKN728 104-56-45.5 W 0001026183 Corpus Christi SMSA Limited PartnershipALLAMORE 04/04/2003 31-12-08.6 N TX AM KNKN728 103-39-24.3 W 0001026183 Corpus Christi SMSA Limited PartnershipAlpine 04/04/2003 30-21-04.1 N TX AM KNKN728 103-11-46.5 W 0001026183 Corpus Christi SMSA Limited PartnershipChancellor 04/04/2003 30-43-36.1 N TX AM KNKN728 104-09-43.7 W 0001026183 Corpus Christi SMSA Limited PartnershipFORT DAVIS 04/04/2003 30-33-50.5 N TX AM KNKN728 104-04-35.0 W 0001026183 Corpus Christi SMSA Limited PartnershipKent 04/04/2003 31-02-03.4 N TX AM KNKN728 104-04-24.0 W 0001026183 Corpus Christi SMSA Limited PartnershipMarfa 04/04/2003 30-19-00.4 N TX AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233265A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233265A1.txt  
- Points of Communication: 1 - ALSAT - (ALSAT) Application for Authority Class of Station: Fixed Earth Stations Jefferson-Pilot Communications Company of North Carolina E030078 SES-LIC-20030411-00451E Nature of Service:Domestic Fixed Satellite Service 35 ° 13 ' 33.00 " N LAT. SITE ID: 1 One Julian Price Place, Mechlenburg, Charlotte, NC 80 ° 52 ' 20.00 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat QPSK digital, 1/2 FEC, 128 Kbps, various information 3700.0000 - 4200.0000 MHz 154KG7W - QPSK digital, 1/2 FEC, 196 kbps, various information 3700.0000 - 4200.0000 MHz 235KG7W Page 3 of 11 59.10 dBW QPSK digital, 1/2 FEC, 128 Kbps, various information 5925.0000 - 6425.0000 MHz 154KG7W - 60.90 dBW QPSK digital, 1/2 FEC, 196 kbps, various 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233490A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-233490A1.txt  
- W 0001274400 EAST TENNESSEE PUBLIC COMMUNICATIONS CORP. Knoxville 04/14/2003 06925.00000 - 06950.00000 35-58-44.2 N TN NE 089-49-19.0 W 0001274480 MID-SOUTH PUBLIC COMMUNICATIONS FOUNDATION MEMPHIS 04/14/2003 06962.50000 35-09-14.0 N WY NE 106-55-51.1 W 0001274667 SUNBELT COMMUNICATIONS COMPANY Sheridan 04/14/2003 07050.00000 - 07075.00000 44-47-54.4 N UT NE 111-50-13.0 W 0001275638 UNIVERSITY OF UTAH Salt Lake City 04/15/2003 07012.50000 40-46-02.5 N OK NE 097-29-04.1 W 0001275702 VIACOM STATIONS GROUP OF OKC LLCOklahoma City 04/15/2003 13025.00000 - 13050.00000 35-35-22.2 N NE NE 102-41-51.0 W 0001275811 DUHAMEL BROADCASTING ENTERPRISES Hay Springs 04/15/2003 06887.50000 42-39-05.0 N NE NE 103-39-40.0 W 0001275913 DUHAMEL BROADCASTING ENTERPRISES Scottsbluff 04/15/2003 06887.50000 41-51-44.0 N NE NE 103-39-40.0 W 0001275913 DUHAMEL BROADCASTING ENTERPRISES Scottsbluff 04/15/2003 06937.50000 41-51-44.0 N OR NE 123-03-26.0 W 0001276187 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234180A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234180A1.txt  
- Fixed Satellite Service Modification filed to add a Ku-band transmit/receive antenna to an existing license. The antenna will be used for the domestic transmission of data and compressed digital video. 34 ° 9 ' 27.00 " N LAT. SITE ID: 1 2813 W. Alameda Avenue, LOS ANGELES, BURBANK, CA 118 ° 19 ' 53.00 " W LONG. LOCATION: COMTECH 3 4.1 meters ANTENNA ID: "18FT OFFSAT"-847130 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 75.70 dBW 5925.0000 - 6425.0000 MHz 4M50G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 9M00G1W 75.70 dBW 5925.0000 - 6425.0000 MHz 26M0G7W 75.70 dBW QPSK DIGITAL VIDEO AND DATA 5925.0000 - 6425.0000 MHz 36M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 4M50G1W 3700.0000 - 4200.0000 MHz 9M00G1W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234913A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-234913A1.txt  
- Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD WHC696 085-25-52.9 W 0001317713 INDIANA, STATE OF - HWY DEPT. TOLLHOWE 05/20/2003 10835.00000 41-45-21.1 N IN MD WHC696 085-25-52.9 W 0001317713 INDIANA, STATE OF - HWY DEPT. TOLLHOWE 05/20/2003 11115.00000 41-45-21.1 N IN MD WPOT793 085-53-07.9 W 0001317718 INDIANA, STATE OF - HWY DEPT. TOLLELKHART 05/20/2003 06004.50000 41-44-04.1 N IN MD WPOT793 085-53-07.9 W 0001317718 INDIANA, STATE OF - HWY DEPT. TOLLELKHART 05/20/2003 10875.00000 41-44-04.1 N IN MD WHC691 087-18-12.1 W 0001317750 INDIANA, STATE OF - HWY DEPT. TOLLGARY 05/20/2003 06093.45000 41-35-32.1 N IN MD WHC691 087-18-12.1 W 0001317750 INDIANA, STATE OF - HWY DEPT. TOLLGARY 05/20/2003 11285.00000 41-35-32.1 N IN MD WHC687 086-44-02.0 W 0001317766 INDIANA, STATE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235102A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235102A1.txt  
- - 12200.0000 MHz 230KG7W 52.80 dBW QPSK DIGITAL, 1/2 FEC, 192 KBPS, VARIOUS INFORMATION 14000.0000 - 14500.0000 MHz 230KG7W Points of Communication: 1 - ALSAT - (ALSAT) Application for Authority Class of Station: Temporary Fixed Earth Station RCN License Subsidiary, Inc. E030125 SES-LIC-20030529-00719E Page 1 of 23 Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, VARIOUS DATA RATES FROM 45MBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS. 5925.0000 - 6425.0000 MHz 36M0F3F Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235295A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235295A1.txt  
- 03/18/2011 Date Effective: 06/10/2003 Class of Station: Fixed Earth Stations Grant of Authority Ascent Media Network Services, Inc. E2941 SES-MOD-20030502-00570E Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service 34 ° 9 ' 27.00 " N LAT. SITE ID: 1 2813 W. Alameda Avenue, LOS ANGELES, BURBANK, CA 118 ° 19 ' 53.00 " W LONG. LOCATION: COMTECH 3 4.1 meters ANTENNA ID: "18FT OFFSAT"-847130 72.40 dBW ANALOG 5925.0000 - 6425.0000 MHz 36M0F3F 72.43 dBW DIGITAL 5925.0000 - 6425.0000 MHz 4M50G1W Page 11 of 21 72.43 dBW DIGITAL 5925.0000 - 6425.0000 MHz 9M00G1W 72.43 dBW DIGITAL 5925.0000 - 6425.0000 MHz 26M0G7W 72.43 dBW QPSK DIGITAL VIDEO AND DATA 5925.0000 - 6425.0000 MHz 36M0G7W ANALOG 3700.0000 - 4200.0000 MHz 36M0F3F DIGITAL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235340A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235340A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-235340A1.txt  
- other carriers. The remainder of CLEC lines was provided over local-loop facilities owned by the CLECs. ILECs reported providing about 37% more UNE loops with switching to other carriers at the end of December 2002 than they reported six months earlier (10.2 million compared to 7.5 million) and about 5% more UNE loops without switching (about 4.3 million compared to 4.1 million). At least one CLEC was serving local telephone service end-user customers in 69% of the nation's zip codes at the end of December 2002, up from 62% a year earlier. About 94% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico. As additional information becomes 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236624A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236624A1.txt  
- of Communication: 1 - ALSAT - (ALSAT) TRI-STATE CHRISTIAN TV INC E000046 SES-MOD-20030708-00933E Class of Station: Fixed Earth Stations Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to add antenna. 37 ° 45 ' 54.00 " N LAT. SITE ID: 1 11717 ROUTE 37, WILLIAMSON, MARION, IL 88 ° 57 ' 3.00 " W LONG. LOCATION: COMTECH 2 4.1 meters ANTENNA ID: OFFSAT MN: 847130 58.90 dBW COMPRESSED DIGITAL VIDEO/QPSK 5925.0000 - 6425.0000 MHz 3M50G7F COMTECH 1 4.1 meters ANTENNA ID: OFFSAT MN: 847130 68.90 dBW COMPRESSED DIGITAL VIDEO/QPSK 5925.0000 - 6425.0000 MHz 3M50G7F Points of Communication: 1 - ALSAT - (ALSAT) Arkansas Television Company E900084 SES-MOD-20030711-00966E Class of Station: Temporary Fixed Earth Station Application for Modification Nature of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236625A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236625A1.txt  
- FEC, 192 KBPS, VARIOUS INFORMATION 14000.0000 - 14500.0000 MHz 230KG7W Points of Communication: Page 3 of 15 1 - ALSAT - (ALSAT) RCN LICENSE SUBSIDIARY, INC. E030125 SES-LIC-20030529-00719E Date Effective: 07/15/2003 Class of Station: Temporary Fixed Earth Station Grant of Authority 07/15/2003 - 07/15/2018 Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, VARIOUS DATA RATES FROM 45MBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS. 5925.0000 - 6425.0000 MHz 36M0F3F Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236850A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236850A1.txt  
- Communications Company of North Carolina E030078 SES-LIC-20030411-00451E Date Effective: 07/18/2003 Class of Station: Fixed Earth Stations Grant of Authority 07/18/2003 - 07/18/2018 Application for Authority Nature of Service:Domestic Fixed Satellite Service 35 ° 13 ' 33.00 " N LAT. SITE ID: 1 One Julian Price Place, Mechlenburg, Charlotte, NC 80 ° 52 ' 20.00 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat QPSK digital, 1/2 FEC, 128 Kbps, various information 3700.0000 - 4200.0000 MHz 154KG7W - Page 2 of 23 QPSK digital, 1/2 FEC, 196 kbps, various information 3700.0000 - 4200.0000 MHz 235KG7W 59.10 dBW QPSK digital, 1/2 FEC, 128 Kbps, various information 5925.0000 - 6425.0000 MHz 154KG7W - 60.90 dBW QPSK digital, 1/2 FEC, 196 kbps, various 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236852A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-236852A1.txt  
- AM WPYC583 070-45-41.0 W 0001350596 WMTW BROADCAST GROUP, LLC BALDWIN 07/17/2003 06962.50000 43-50-44.0 N OH MD WPOQ481 083-04-05.6 W 0001381334 CENTRAL OHIO ASSOCIATION OF CHRDELAWARE 07/14/2003 00650.00000 - 00656.00000 40-17-51.2 N OH MD WPOQ481 083-04-05.6 W 0001381334 CENTRAL OHIO ASSOCIATION OF CHRDELAWARE 07/14/2003 00662.00000 - 00668.00000 40-17-51.2 N TX MD WPXI257 101-50-02.6 W 0001384148 AMARILLO JUNIOR COLLEGE DISTRICTAmarillo 07/16/2003 07037.50000 35-12-04.1 N Page 32 YK - Industrial/Business Pool - Commercial, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AM A 0001375891 GALESBURG COMMUNICATIONS, INC. 07/14/2003 00466.48750 AM A 0001375891 GALESBURG COMMUNICATIONS, INC. 07/14/2003 00466.71250 AM A 0001375891 GALESBURG COMMUNICATIONS, INC. 07/14/2003 00467.01250 AM A 0001375891 GALESBURG COMMUNICATIONS, INC. 07/14/2003 00468.41250 AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237354A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-237354A1.txt  
- 090-42-21.3 W 0001398742 Minnesota, State of Lutsen 07/29/2003 06795.00000 47-39-41.6 N Page 30 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN NE 085-23-14.9 W 0001399045 DELAWARE, COUNTY OF MUNCIE 07/29/2003 00958.35000 40-11-43.2 N IN NE 085-20-47.9 W 0001399244 DELAWARE, COUNTY OF MUNCIE 07/29/2003 00954.75000 40-17-04.1 N NV NE 114-51-42.1 W 0001399412 State of Nevada Dept. of Information Technology Ely 07/29/2003 02183.20000 39-15-29.8 N NV NE 114-51-42.1 W 0001399412 State of Nevada Dept. of Information Technology Ely 07/29/2003 06805.00000 39-15-29.8 N MN NE 092-42-54.3 W 0001399545 Minnesota, State of Brookston 07/29/2003 06755.00000 46-50-02.3 N NV NE 115-47-18.0 W 0001399656 State of Nevada Dept. of Information technology 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238007A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238007A1.txt  
- - (ALSAT) TRI-STATE CHRISTIAN TV INC E000046 SES-MOD-20030708-00933E Date Effective: 08/19/2003 Class of Station: Fixed Earth Stations Grant of Authority 03/14/2000 - 03/14/2010 Application for Modification Nature of Service:Domestic Fixed Satellite Service 37 ° 45 ' 54.10 " N LAT. SITE ID: 1 11717 ROUTE 37, WILLIAMSON, MARION, IL 88 ° 57 ' 3.20 " W LONG. LOCATION: COMTECH 2 4.1 meters ANTENNA ID: OFFSAT MN: 847130 65.90 dBW COMPRESSED DIGITAL VIDEO/QPSK 5925.0000 - 6425.0000 MHz 3M50G7F COMPRESSED DIGITAL VIDEO/QPSK 3700.0000 - 4200.0000 MHz 3M50G7F COMTECH 1 4.1 meters ANTENNA ID: OFFSAT MN: 847130 65.90 dBW COMPRESSED DIGITAL VIDEO/QPSK 5925.0000 - 6425.0000 MHz 3M50G7F COMPRESSED DIGITAL VIDEO/QPSK 3700.0000 - 4200.0000 MHz 3M50G7F Points of Communication: 1 - ALSAT - (ALSAT) Texas 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238830A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-238830A1.txt  
- N CA NE 120-28-58.0 W 0001438066 SOUTHWESTERN BELL MOBILE SYSTEEL NIDO 09/03/2003 10556.25000 37-08-04.2 N NV NE 119-56-39.1 W 0001438115 Southwestern Bell Mobile Systems, LLCIncline Village 09/03/2003 19465.00000 39-19-23.7 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV NE 119-53-04.1 W 0001438272 Southwestern Bell Mobile Systems, LLCIncline Village 09/03/2003 17905.00000 39-18-48.2 N ND NE 097-53-41.9 W 0001438880 WWC HOLDING CO., INC. Oriska 09/03/2003 06197.24000 46-56-08.4 N ND NE 097-53-41.9 W 0001438880 WWC HOLDING CO., INC. Oriska 09/03/2003 06226.89000 46-56-08.4 N ND NE 097-53-41.9 W 0001438880 WWC HOLDING CO., INC. Oriska 09/03/2003 06256.54000 46-56-08.4 N ND NE 097-53-41.9 W 0001438880 WWC 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239131A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-239131A1.txt  
- City MN AM 092-42-54.3 W 0001399545 Minnesota, State of Brookston 09/15/2003 06755.00000 46-50-02.3 N IL MD KJV88 088-46-23.3 W 0001452390 State of Illinois, Department of TransportaSTREATOR 09/16/2003 06590.62500 41-07-19.1 N IL MD KJV89 088-38-29.3 W 0001452391 State of Illinois, Department of TransportaPontiac 09/16/2003 06750.62500 40-52-09.3 N CA MD WNTQ678 118-10-11.2 W 0001452698 LONG BEACH, CITY OF LONG BEACH 09/16/2003 17760.00000 33-49-04.1 N CA MD WNTQ678 118-10-11.2 W 0001452698 LONG BEACH, CITY OF LONG BEACH 09/16/2003 17760.00000 33-49-04.1 N CA MD WNTQ679 118-08-55.1 W 0001452837 LONG BEACH, CITY OF LONG BEACH 09/16/2003 19320.00000 33-47-25.6 N CA MD WNTQ679 118-08-55.1 W 0001452837 LONG BEACH, CITY OF LONG BEACH 09/16/2003 19320.00000 33-47-25.6 N ID MD KPL56 114-24-47.1 W 0001454151 IDAHO, STATE OF JEROME 09/17/2003 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240202A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240202A1.txt  
- Inc. MOSSY HEAD 10/16/2003 06123.10000 30-44-16.0 N FL NE 086-21-42.0 W 0001485131 AT&T Wireless Services of Florida, Inc. MOSSY HEAD 10/16/2003 06123.10000 30-44-16.0 N FL NE 086-21-42.0 W 0001485131 AT&T Wireless Services of Florida, Inc. MOSSY HEAD 10/16/2003 06152.75000 30-44-16.0 N FL NE 086-21-42.0 W 0001485131 AT&T Wireless Services of Florida, Inc. MOSSY HEAD 10/16/2003 06152.75000 30-44-16.0 N CA NE 117-04-04.1 W 0001485133 Verizon Wireless (VAW) LLC San Diego 10/16/2003 10598.75000 32-44-57.2 N MA NE 071-02-54.0 W 0001485511 TowerStream, Inc. QUINCY 10/16/2003 17960.00000 42-14-49.0 N FL NE 084-55-54.7 W 0001485562 AT&T Wireless Services of Florida, Inc. SNEADS 10/16/2003 06197.24000 30-38-31.1 N FL NE 084-55-54.7 W 0001485562 AT&T Wireless Services of Florida, Inc. SNEADS 10/16/2003 06197.24000 30-38-31.1 N FL NE 084-55-54.7 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240203A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-240203A1.txt  
- - 02008.00000 44-58-09.0 N MN MD KS9471 O 0001483913 HUBBARD BROADCASTING, INC. ST PAUL 10/15/2003 02467.00000 - 02484.00000 MN MD KS9757 O 0001483968 HUBBARD BROADCASTING, INC. ST PAUL 10/15/2003 01990.00000 - 02008.00000 MN MD KU2533 O 0001484019 HUBBARD BROADCASTING, INC. SAINT PAUL 10/15/2003 01990.00000 - 02008.00000 OH MD KW8562 P 083-32-07.7 W 0001484477 LibCo, Inc. TOLEDO 10/15/2003 02042.00000 - 02059.00000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0001484477 LibCo, Inc. TOLEDO 10/15/2003 02059.00000 - 02076.00000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0001484477 LibCo, Inc. TOLEDO 10/15/2003 02076.00000 - 02093.00000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0001484477 LibCo, Inc. TOLEDO 10/15/2003 02093.00000 - 02110.00000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0001484477 LibCo, Inc. TOLEDO 10/15/2003 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241381A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241381A1.txt  
- N Page 9 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD KKY45 099-44-54.2 W 0001513398 TEXAS ELECTRONIC TRANSPORT COMUVALDE 11/12/2003 06375.14000 29-15-40.8 N TX MD KKY45 099-44-54.2 W 0001513398 TEXAS ELECTRONIC TRANSPORT COMUVALDE 11/12/2003 06404.79000 29-15-40.8 N TX MD KLR38 099-16-04.1 W 0001513408 TEXAS ELECTRONIC TRANSPORT COMD'HANIS 11/12/2003 05945.20000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0001513408 TEXAS ELECTRONIC TRANSPORT COMD'HANIS 11/12/2003 05945.20000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0001513408 TEXAS ELECTRONIC TRANSPORT COMD'HANIS 11/12/2003 05974.85000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0001513408 TEXAS ELECTRONIC TRANSPORT COMD'HANIS 11/12/2003 06004.50000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0001513408 TEXAS ELECTRONIC 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241826A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-241826A1.txt  
- EDEN 11/24/2003 06815.00000 28-16-37.0 N FL MD WNTK757 081-01-12.2 W 0001525540 OSCEOLA, COUNTY OF HALOPAW 11/24/2003 06565.00000 27-59-52.0 N FL MD WNTK757 081-01-12.2 W 0001525540 OSCEOLA, COUNTY OF HALOPAW 11/24/2003 06595.00000 27-59-52.0 N FL MD WNTK757 081-01-12.2 W 0001525540 OSCEOLA, COUNTY OF HALOPAW 11/24/2003 06655.00000 27-59-52.0 N FL MD WNTK756 080-56-52.2 W 0001525550 OSCEOLA, COUNTY OF YEEHAW JUNCTIO 11/24/2003 06815.00000 27-43-04.1 N FL MD WNTK752 081-15-21.2 W 0001525579 OSCEOLA, COUNTY OF SAINT CLOUD 11/24/2003 06735.00000 28-04-38.0 N Page 21 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL MD WNTK752 081-15-21.2 W 0001525579 OSCEOLA, COUNTY OF SAINT CLOUD 11/24/2003 06755.00000 28-04-38.0 N FL MD WNTK753 081-25-13.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242030A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242030A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242030A1.txt  
- devices are to be measured for compliance using ANSI C63.17-1998: `Methods of Measurement of the Electromagnetic and Operational Compatibility of Unlicensed Personal Communications Services (UPCS) Devices' (incorporated by reference, see § 15.38).'' Revise paragraph 15.31(a)(3) of Appendix A: Final Rule Changes to read, ``Other intentional and unintentional radiators are to be measured for compliance using the following procedure excluding sections 4.1.5.2, 5.7, 9 and 14: ANSI C63.4-2001: `Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the Range of 9 kHz to 40 GHz' (incorporated by reference, see § 15.38).'' Add paragraph 15.38(b)(6) to Appendix A: Final Rule Changes to read, ``ANSI C63.4-2001: `Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242688A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242688A1.txt  
- VIDEO 11700.0000 - 12200.0000 MHz 36M0G7F Points of Communication: 1 - AMC-5 (formerly GE-5 - (79 W.L.) 1 - SBS-6 - (74 DEG. WL) 1 - TELSTAR 6 - (93 W.L.) RCN LICENSE SUBSIDIARY, INC. E040002 SES-LIC-20031226-01856E Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 - 6425.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242869A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242869A1.txt  
- 8PSK, DIGITAL DATA, VIDEO, AND AUDIO 14000.0000 - 14500.0000 MHz 6M00G7W QPSK, 8PSK, DIGITAL DATA, VIDEO, AND AUDIO 11700.0000 - 12200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) RCN License Subsidiary, Inc. E040001 SES-LIC-20031226-01855E Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 - 6425.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242874A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-242874A1.txt  
- 11665.00000 33-34-10.1 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WLU304 097-45-13.0 W 0001569151 AT&T Wireless Services of Florida, Inc. KILLEEN 01/06/2004 06063.80000 31-05-52.6 N AZ MD KPK30 113-08-06.6 W 0001569176 CNG COMMUNICATIONS, INC. MONTEZUMA 01/06/2004 03770.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0001569176 CNG COMMUNICATIONS, INC. MONTEZUMA 01/06/2004 03850.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0001569176 CNG COMMUNICATIONS, INC. MONTEZUMA 01/06/2004 03930.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0001569176 CNG COMMUNICATIONS, INC. MONTEZUMA 01/06/2004 04010.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0001569176 CNG COMMUNICATIONS, INC. MONTEZUMA 01/06/2004 04090.00000 33-03-04.1 N AZ MD KPK30 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243215A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243215A1.txt  
- 42-11-15.7 N UT NE 110-48-59.0 W 0001588584 Nextel License Holdings 4, Inc PRICE 01/21/2004 06555.62500 39-32-42.0 N UT NE 110-48-59.0 W 0001588584 Nextel License Holdings 4, Inc PRICE 01/21/2004 06625.62500 39-32-42.0 N UT NE 110-48-59.0 W 0001588584 Nextel License Holdings 4, Inc PRICE 01/21/2004 10551.25000 39-32-42.0 N UT NE 110-51-45.0 W 0001588682 Nextel License Holdings 4, Inc Murray 01/21/2004 10616.25000 39-41-04.1 N UT NE 110-24-03.9 W 0001588725 Nextel License Holdings 4, Inc Emery 01/21/2004 06785.62500 39-25-14.7 N UT NE 110-08-32.0 W 0001588862 Nextel License Holdings 4, INc Castle Dale 01/21/2004 06725.62500 32-12-32.0 N NH NE 071-29-45.0 W 0001588975 MANCHESTER-NASHUA CELLULAR TEMerrimack 01/21/2004 06256.54000 42-51-04.0 N NH NE 071-29-45.0 W 0001588975 MANCHESTER-NASHUA CELLULAR TEMerrimack 01/21/2004 06404.79000 42-51-04.0 N NH NE 071-29-45.0 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243419A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243419A1.txt  
- adjacent satellite interf'erence increases, slightly reducing the rain margin. When the adjacent satellite drifts in the opposite direction the satellite spacing increases and adjacent satellite interference decreases, slightly increasing the rain margin. The overall effect is a negligible decrease in rain margins. The same effect is true for subscriber antenna misalignment, if the misalignment mrs are random. 4.0 TWEENER SATELLmS. 4.1 TWEENER SATELLITE IMPLEMENTATION. Tweener satellites that cause no unacceptable interfkrence should be permitted to co-exist between existing BSS satellites. Interference hm Tweener satellites can be decreased by implementation of PFD limitations. Such restrictions will be temporary, effective until all BSS space stations can operate at the reduced orbital spacing. A Tweener satellite may be launched as soon as the Region 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243431A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243431A1.txt  
- 1 and 3 List or into new or modified assignments in the Regions 1 and 3 List Limits for the interference into frequency assignments in conformity with the Under assumed free-space propagation conditions, the power flux-density of a proposed new or modified assignment in the List shall not exceed the value of -103.6 dB(W/(m2 e27 MHz)). With respect to 4 4.1.1 a) or b) of Article 4, an administration in Region 1 or 3 shall be considered by the Bureau as being affected if the minimum orbital spacing between the wanted and interfering space stations, under worst-case station-keeping conditions, is less than 9". However, an administration shall not be considered as affected if either of the following two conditions are met: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243476A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243476A1.txt  
- 12200.0000 MHz 36M0F3F DIGITAL DATA, QPSK, 8PSK 11700.0000 - 12200.0000 MHz 35M9G7W DIGITAL DATA, QPSK, 8PSK 11700.0000 - 12200.0000 MHz 54K6G7W Points of Communication: 1 - ALSAT - (ALSAT) RCN License Subsidiary, Inc. E040046 SES-LIC-20040126-00120E Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various, Various, Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates from 64 kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates from 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243479A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-243479A1.txt  
- Stations Grant of Authority 03/02/2004 - 03/02/2019 Renewal Nature of Service:Domestic Fixed Satellite Service 25 ° 54 ' 49.00 " N LAT. SITE ID: 1 DADE, MIAMI, FL 80 ° 9 ' 33.00 " W LONG. LOCATION: ANDREW CORPORATION 1 9.3 meters ANTENNA ID: MODEL ESA93-46 83.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0F8W COMTECH 2 4.1 meters ANTENNA ID: OFFSAT 71.90 dBW DIGITAL VIDEO 6359.0000 - 6425.0000 MHz 36M0G7F 63.00 dBW DIGITAL VIDEO 6359.0000 - 6425.0000 MHz 3M00G7F- 71.90 dBW DIGITAL VIDEO 6359.0000 - 6425.0000 MHz 36M0G7F 63.00 dBW DIGITAL VIDEO 6067.4000 - 6243.0000 MHz 3M00G7F- Page 19 of 21 DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 36M0G7F DIGITAL VIDEO 3600.0000 - 4200.0000 MHz 3M00G7F Points of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244391A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244391A1.pdf  
- in markets where pools exist, a working committee should take the pool to the higher level of security, isolating it from the traditional news coverage pool concerns. Local media should consider the creation of an Emergency Communications Coordinator position to serve as single media point of contact for government and develop a cooperative relationship with the local government lead agency. 4.1.2 State and Local government should consider equipping their Emergency Operating Centers (EOCs) with the basic audio and/or video equipment that allows them to provide feeds of local government officials to the local media. 4.1.3 Government and Media representatives from their technical staffs should meet regularly to ensure that joint plans and procedures have been implemented properly and that the supporting 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244523A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244523A1.pdf  
- as a major concern associated with the new technologies. It was suggested that MCAP (Media Common Alert Protocol) was needed as a way for government to communicate with broadcast media, as well as a need to coordinate with the print media. There were suggestions to reword 6.1 Recommendation #4 Encourage private industry collaboration and planning to meet community needs. Commentary: 4.1 and 4.1.1 Significant concern expressed, with overall ambivalence about notion of a ``single media point of contact for government'' - consensus was this item needs further development and explanation. ``Perhaps an EOC pool feed would be acceptable'' ``Miami pool coordinator for Hurricanes seems to work'' ``Perhaps joint media participation in conference calls to coordinate press planning would be a step 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244534A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244534A1.txt  
- adjacent satellite interference increases, slightly reducing the rain margin. When the adjacent satellite drifts in the opposite direction the satellite spacing increases and adjacent satellite interference decreases, slightly increasing the rain margin. The overall effect is a negligible decrease in rain margins. The same effect is true for subscriber antenna misalignment, if the misalignment errors are random. 4.0 TWEENER SATELLITES. 4.1 'IWEENER SATELLITE IMPLEMENTATION. Tweener satellites that cause no unacceptable interference should be permitted to co-exist between existing BSS satellites. Interference fiom Tweener satellites can be decreased by implementation of PFD limitations. Such restrictions will be temporary, effective until all BSS space stations can operate at the reduced orbital spacing. A Tweener satellite may be launched as soon as the Region 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244558A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244558A1.txt  
- Latitude City NE MD WHB269 096-39-30.0 W 0001627242 MONTEREY LICENSES, LLC Lincoln 02/23/2004 00947.50000 40-48-48.0 N IL MD WDD727 087-43-22.0 W 0001629532 ENTRAVISION HOLDINGS, LLC UNIVERSITY PARK 02/24/2004 00951.50000 41-27-15.0 N NE NE 096-39-30.0 W 0001627293 MONTEREY LICENSES, LLC Lincoln 02/23/2004 00946.50000 40-48-48.0 N FL NE 084-17-16.0 W 0001632191 WAY-FM MEDIA GROUP, INC. TALLAHASSEE 02/26/2004 00951.00000 30-28-12.0 N CO NE 105-06-04.1 W 0001632287 WAY-FM MEDIA GROUP, INC. Longmont 02/26/2004 00948.50000 40-11-20.1 N LA NE 092-38-25.1 W 0001634830 COMMUNICATIONS CAPITAL COMPANYRuston 02/27/2004 00950.00000 32-31-58.5 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WLL912 116-26-03.0 W 0001532531 LOS ANGELES SMSA LIMITED PARTNEDESERT 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244685A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-244685A1.txt  
- 1 and 3 List or into new or modified assignments in the Regions 1 and 3 List Limits for the interference into frequency assignments in conformity with the Under assumed free-space propagation conditions, the power flux-density of a proposed new or modified assignment in the List shall not exceed the value of -103.6 dB(W/(m2 e27 MHz)). With respect to 4 4.1.1 a) or b) of Article 4, an administration in Region 1 or 3 shall be considered by the Bureau as being affected if the minimum orbital spacing between the wanted and interfering space stations, under worst-case station-keeping conditions, is less than 9". However, an administration shall not be considered as affected if either of the following two conditions are met: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245057A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245057A1.txt  
- Date Effective: 03/10/2004 Class of Station: Fixed Earth Stations Grant of Authority 01/21/2000 - 01/21/2010 Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to change remote control point. 42 ° 37 ' 30.10 " N LAT. SITE ID: 1 SR99, 4240 N. MICHIGAN ROAD, EATON, DIMONDALE, MI 84 ° 37 ' 29.90 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M60G1F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 8M60G1F Points of Communication: 1 - ALSAT - (ALSAT) MMT LICENSE LLC E040037 SES-REG-20040115-00053E Date Effective: 03/11/2004 Class of Station: Fixed Earth Stations Grant of Authority 01/15/2004 - 01/15/2019 Registration Page 29 of 42 Nature of Service:Domestic Fixed Satellite 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245058A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245058A1.txt  
- N WY MD WPNA599 109-59-10.5 W 0001648746 UNION PACIFIC RAILROAD COMPANYGRANGER 03/10/2004 00928.40625 41-35-59.8 N WY MD WPNA599 109-59-10.5 W 0001648746 UNION PACIFIC RAILROAD COMPANYGRANGER 03/10/2004 00952.40625 41-35-59.8 N GM MD WPYB586 088-47-50.1 W 0001650852 Devon Energy Corporation Offshore 03/11/2004 00934.93750 29-36-23.7 N GM MD WPYB586 088-47-50.1 W 0001650852 Devon Energy Corporation Offshore 03/11/2004 00953.05000 29-36-23.7 N CA MD WAK200 117-19-04.1 W 0001651389 SOUTHERN CALIFORNIA GAS COMPANCRESTLINE 03/11/2004 06635.00000 34-14-10.0 N CA MD WEH481 117-17-09.1 W 0001651390 SOUTHERN CALIFORNIA GAS COMPANRIVERSIDE 03/11/2004 06785.00000 33-57-58.0 N WI NE 090-08-19.0 W 0001645220 DAIRYLAND POWER COOPERATIVE Darlington 03/08/2004 06548.75000 42-40-00.0 N NY NE 077-38-52.3 W 0001645304 Diamond Packaging Rochester 03/08/2004 21975.00000 43-04-48.6 N NY NE 073-56-31.9 W 0001645492 Columbia University Medical School New York 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245297A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245297A1.txt  
- AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH NE 080-40-44.8 W 0001656064 Aeronautical Radio Inc Youngstown 03/15/2004 00129.65000 41-15-38.7 N OK NE 095-53-17.7 W 0001656080 Aeronautical Radio Inc Tulsa 03/15/2004 00130.30000 36-11-54.1 N FL NE 082-00-08.3 W 0001658912 Piedmont Hawthorne Aviation Inc. Lakeland 03/17/2004 00122.95000 27-59-04.1 N IL RM KQJ7 089-34-48.4 W 0001659465 FREEPORT, CITY OF FREEPORT 03/04/2004 00122.80000 42-14-48.1 N RO WBX4 0001655256 CHILDRENS HOSPITAL MEDICAL CENT 03/15/2004 RO KQN2 0001655477 TEX AIR HELICOPTERS INC 03/15/2004 RO WIT3 0001655894 GRIFFITH AVIATION INC 03/15/2004 RO WJH9 0001656013 SILOAM SPRINGS, CITY OF 03/15/2004 RO WJQ2 0001656971 MADISONVILLE FLYING SERVICE INC 03/16/2004 RO KPG5 0001657318 GRAFTON MUNICIPAL AIRPORT 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245572A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245572A1.txt  
- 6425.0000 MHz 4M50G7W Analog Video, Audio, & Data 3700.0000 - 4200.0000 MHz 36M0F8F Digital, Compressed Digital Video, Audio, & Data 3700.0000 - 4200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) MRN Radio E040159 SES-LIC-20040326-00467E Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Comtech 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW Standard video with associated audio subcarriers 5925.0000 - 6425.0000 MHz 36M0F3F 65.90 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 3M00G1F 72.40 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 36M0G1F Page 4 of 13 52.90 dBW Digital, various FEC, data rates, modulation and information types 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW Digital, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245574A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245574A1.txt  
- ONE 36 MBIT MCPC DIGITAL CARRIER FOR VOICE/PICTURE DATA 14000.0000 - 14500.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) RCN LICENSE SUBSIDIARY, INC. E040001 SES-LIC-20031226-01855E Date Effective: 03/30/2004 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/30/2004 - 03/30/2019 Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 -7/8, Various Data Rates from 45 Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 - 6425.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245856A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-245856A1.txt  
- N AZ MD WAY536 109-34-28.3 W 0001682143 Salt River Project Agricultural ImprovemenSPRINGERVILLE 04/01/2004 06315.84000 34-06-39.1 N AZ MD WAY536 109-34-28.3 W 0001682143 Salt River Project Agricultural ImprovemenSPRINGERVILLE 04/01/2004 06765.00000 34-06-39.1 N AZ MD WAY536 109-34-28.3 W 0001682143 Salt River Project Agricultural ImprovemenSPRINGERVILLE 04/01/2004 06835.00000 34-06-39.1 N VA MD WPNN331 078-15-07.4 W 0001682519 CENTRAL VIRGINIA ELECTRIC COOPEZions Cross Roads 04/01/2004 00928.38125 37-59-04.1 N VA MD WPNN331 078-15-07.4 W 0001682519 CENTRAL VIRGINIA ELECTRIC COOPEZions Cross Roads 04/01/2004 00952.38125 37-59-04.1 N CO NE P 106-52-00.0 W 0001674699 BUTTERMILK METROPOLITAN DISTRICASPEN 03/12/2004 00956.29375 39-13-00.0 N IL NE 088-56-22.0 W 0001676332 Southern Illinois Power Cooperative Marion 03/29/2004 00928.78125 37-37-33.0 N IL NE 088-56-22.0 W 0001676332 Southern Illinois Power Cooperative Marion 03/29/2004 00952.78125 37-37-33.0 N TX NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246301A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246301A1.txt  
- 18-27-21.4 N PR NE 066-07-05.0 W 0001696250 SAN JUAN CELLULAR TELEPHONE COGUAYNABO 04/14/2004 10617.50000 18-25-23.4 N PR NE 066-03-38.0 W 0001696319 SAN JUAN CELLULAR TELEPHONE COCAGUAS 04/14/2004 10667.50000 18-17-53.7 N PR NE 066-10-28.4 W 0001696406 SAN JUAN CELLULAR TELEPHONE COCAYEY 04/14/2004 11245.00000 18-06-15.6 N PR NE 066-02-12.4 W 0001696472 SAN JUAN CELLULAR TELEPHONE COCAGUAS 04/14/2004 11035.00000 18-13-54.1 N NE NE 098-34-04.1 W 0001698404 ALLTEL Communications of Nebraska, IncGreeley 04/15/2004 06628.75000 41-29-39.1 N NE NE 098-27-07.2 W 0001698434 ALLTEL Communications of Nebraska, IncST. PAUL 04/15/2004 06788.75000 41-17-21.2 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE 077-25-28.0 W 0001699228 AT&T 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246534A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-246534A1.txt  
- 00931.33750 42-39-41.1 N MI RM KNKO294 085-50-22.0 W 0001704627 AMERITECH MOBILE SERVICES, INC.ALLEGAN 04/21/2004 00931.33750 42-36-40.1 N MI RM KNKO294 083-27-00.9 W 0001704627 AMERITECH MOBILE SERVICES, INC.ALPENA 04/21/2004 00931.33750 45-04-43.0 N MI RM KNKO294 083-40-59.7 W 0001704627 AMERITECH MOBILE SERVICES, INC.ANN ARBOR EAST 04/21/2004 00931.33750 42-17-45.1 N MI RM KNKO294 083-43-12.7 W 0001704627 AMERITECH MOBILE SERVICES, INC.ANN HARBOR 04/21/2004 00931.33750 42-17-04.1 N MI RM KNKO294 083-14-29.7 W 0001704627 AMERITECH MOBILE SERVICES, INC.AUBURN HILLS 04/21/2004 00931.33750 42-39-00.1 N MI RM KNKO294 083-14-30.7 W 0001704627 AMERITECH MOBILE SERVICES, INC.AUBURN HILLS 04/21/2004 00931.33750 42-39-01.1 N MI RM KNKO294 082-54-25.7 W 0001704627 AMERITECH MOBILE SERVICES, INC.BAD AXE 04/21/2004 00931.33750 43-48-15.0 N MI RM KNKO294 085-50-23.2 W 0001704627 AMERITECH MOBILE SERVICES, INC.BALDWIN 04/21/2004 00931.33750 43-58-50.0 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247083A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247083A1.txt  
- - 4200.0000 MHz 36M0F8F Digital, Compressed Digital Video, Audio, & Data 3700.0000 - 4200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) MRN Radio E040159 SES-LIC-20040326-00467E Date Effective: 05/06/2004 Class of Station: Temporary Fixed Earth Station Grant of Authority 05/06/2004 - 05/06/2019 Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Comtech 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW Standard video with associated audio subcarriers 5925.0000 - 6425.0000 MHz 36M0F3F 65.90 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 3M00G1F 72.40 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 36M0G1F 52.90 dBW Digital, various FEC, data rates, modulation and information types 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW Digital, various FEC, data rates, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247089A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247089A1.txt  
- AM 097-42-44.0 W 0001726086 FIBERTOWER CORPORATION AUSTIN 05/07/2004 19320.00000 30-12-35.0 N TX AM 097-42-44.0 W 0001726086 FIBERTOWER CORPORATION AUSTIN 05/07/2004 19400.00000 30-12-35.0 N TX AM 097-42-44.0 W 0001726086 FIBERTOWER CORPORATION AUSTIN 05/07/2004 19480.00000 30-12-35.0 N TX AM 097-36-09.0 W 0001726089 FIBERTOWER CORPORATION AUSTIN 05/07/2004 10572.50000 30-11-36.0 N PR MD WPTA576 066-08-52.5 W 0001726829 SprintCom, Inc. (Puerto Rico) CATANO 05/06/2004 19485.00000 18-27-04.1 N CA MD WMM709 118-00-23.2 W 0001727141 FRESNO MSA LIMITED PARTNERSHIPCALIFORNIA CITY 05/06/2004 05974.85000 35-02-17.8 N CA MD WMM709 118-00-23.2 W 0001727141 FRESNO MSA LIMITED PARTNERSHIPCALIFORNIA CITY 05/06/2004 06315.84000 35-02-17.8 N CA MD WMT850 121-01-06.7 W 0001727816 AT&T Wireless Services of Florida, Inc. LINDEN 05/07/2004 10622.50000 38-01-58.7 N CA MD WMM933 121-15-06.8 W 0001727840 AT&T Wireless Services of Florida, Inc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247633A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247633A1.txt  
- 0001741944 USCOC OF NORTH CAROLINA RSA #7,REIDSVILLE 05/19/2004 06063.80000 36-21-47.0 N NC MD WML588 079-36-50.0 W 0001741944 USCOC OF NORTH CAROLINA RSA #7,REIDSVILLE 05/19/2004 06590.00000 36-21-47.0 N PR MD WPTG858 065-40-16.4 W 0001741982 SprintCom, Ins (Puerto Rico) Fajardo 05/19/2004 06685.00000 18-19-49.0 N PR MD WPTG858 065-40-16.4 W 0001741982 SprintCom, Ins (Puerto Rico) Fajardo 05/19/2004 11115.00000 18-19-49.0 N LA MD WPJE872 089-02-04.1 W 0001742036 Stratos Offshore Services Company VENICE 05/19/2004 02162.00000 29-12-24.7 N ME MD WMW970 068-53-44.0 W 0001742287 MAINE RSA #1, INC. BUCKSPORT 05/19/2004 06197.24000 44-34-50.0 N ME MD WMW970 068-53-44.0 W 0001742287 MAINE RSA #1, INC. BUCKSPORT 05/19/2004 06256.54000 44-34-50.0 N ME MD WMW970 068-53-44.0 W 0001742287 MAINE RSA #1, INC. BUCKSPORT 05/19/2004 10617.50000 44-34-50.0 N PR MD WPSQ488 066-04-11.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247892A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-247892A1.txt  
- 104-58-25.3 W 0001747329 FIBERTOWER CORPORATION DENVER 05/24/2004 23170.00000 39-40-13.0 N Page 15 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO NE 104-56-28.6 W 0001747332 FIBERTOWER CORPORATION DENVER 05/24/2004 23120.00000 39-40-06.5 N CO NE 104-57-44.2 W 0001747337 FIBERTOWER CORPORATION DENVER 05/24/2004 23520.00000 39-41-04.1 N CO NE 104-56-21.0 W 0001747342 FIBERTOWER CORPORATION DENVER 05/24/2004 22170.00000 39-41-09.0 N CO NE 104-56-21.0 W 0001747342 FIBERTOWER CORPORATION DENVER 05/24/2004 22320.00000 39-41-09.0 N CO NE 104-56-30.4 W 0001747349 FIBERTOWER CORPORATION DENVER 05/24/2004 23070.00000 39-41-08.7 N CO NE 104-56-30.4 W 0001747349 FIBERTOWER CORPORATION DENVER 05/24/2004 23370.00000 39-41-08.7 N CO NE 104-47-36.0 W 0001747357 FIBERTOWER CORPORATION AURORA 05/24/2004 21970.00000 39-37-38.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248467A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248467A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248467A1.txt  
- issues. Unlike its rulemaking process for Telecom issues, if the Broadcasting issue is a matter of great public importance, public hearings are held in place of the three stage consultation process. in 2002. in 2002. Canada. Conflict of Interest and Post Employment, Appendix A, Part II. Hong Kong. Civil Service Branch Circular No. 17/92. United Kingdom. Civil Service Management Code, 4.1.3. No licenses are required in New Zealand. Daniel Kaufmann and Aart Kray. ``Growth Without Governance.'' Washington, D.C.: World Bank Working Paper No. 2928. November 19, 2002. B ł ´ Ľ h‰ h‰ Â^ gd‰ gd‰ 1 B C D E F h } `` ť ž µ ¶ · ¸ ą ş " Ľ Ľ ˝ ľ ż Ŕ Á 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248658A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-248658A1.txt  
- 06/18/2004 02192.80000 42-14-19.2 N NY AM WNEM944 078-51-03.1 W 0001703357 CATTARAUGUS, COUNTY OF NAPOLI 06/18/2004 06585.62500 42-14-19.2 N Page 32 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY AM WNEM944 078-51-03.1 W 0001703357 CATTARAUGUS, COUNTY OF NAPOLI 06/18/2004 06670.62500 42-14-19.2 N NY AM WNEM943 078-48-04.1 W 0001703367 CATTARAUGUS, COUNTY OF LITTLE VALLEY 06/18/2004 06745.62500 42-15-08.2 N MT AM WBM595 113-27-26.2 W 0001760033 MISSOULA, COUNTY OF MISSOULA 06/14/2004 06034.15000 47-00-12.7 N MT AM WBM595 113-27-26.2 W 0001760033 MISSOULA, COUNTY OF MISSOULA 06/14/2004 06063.80000 47-00-12.7 N MT AM WBM595 113-27-26.2 W 0001760033 MISSOULA, COUNTY OF MISSOULA 06/14/2004 06063.80000 47-00-12.7 N MT AM KOV71 113-55-45.4 W 0001763046 MISSOULA, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249123A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249123A1.txt  
- 097-25-00.0 W 0001781378 FIBERTOWER CORPORATION FORT WORTH 06/22/2004 19600.00000 32-43-28.0 N TX NE 097-25-00.0 W 0001781378 FIBERTOWER CORPORATION FORT WORTH 06/22/2004 19600.00000 32-43-28.0 N TX NE 097-25-00.0 W 0001781378 FIBERTOWER CORPORATION FORT WORTH 06/22/2004 19640.00000 32-43-28.0 N TX NE 097-25-00.0 W 0001781378 FIBERTOWER CORPORATION FORT WORTH 06/22/2004 19680.00000 32-43-28.0 N NM NE 103-13-20.0 W 0001782608 Qwest Corporation CLOVIS 06/23/2004 17760.00000 34-19-04.1 N NM NE 103-12-12.0 W 0001782622 Qwest Corporation Clovis 06/23/2004 19320.00000 34-24-17.6 N NM NE 105-16-28.4 W 0001783020 ALLTEL Communications of New Mexico, Inc. MONTEZUMA 06/23/2004 06855.00000 35-40-26.7 N NM NE 104-57-28.1 W 0001783026 ALLTEL Communications of New Mexico, Inc. WATROUS 06/23/2004 06695.00000 35-46-06.5 N TX NE 097-23-58.1 W 0001784173 Central Telephone Company of Texas Laguna Park 06/24/2004 06197.24000 31-52-14.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249262A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249262A1.txt  
- Miscellaneous Total International Total Toll Facilities- Based, Facilities- Pure Telephone Record TelexTelegraphOther End Carrier's End Carrier's EndCarrier's Resale, and Resale User Carrier & User Carrier & UserCarrier & ISR 3/ 3/ 4/ End User 4/ End User 4/ End User 4/ 1950 $9.0 $0.2 $1.1 $39.3 $49.5 $49.5 $1,245 4.0 % 1951 12.1 0.3 1.9 $0.2 42.6 54.9 57.2 1,403 4.1 1952 15.4 0.3 2.8 0.4 41.3 57.2 60.3 1,535 3.9 1953 13.1 0.3 3.7 0.7 42.5 56.2 60.2 1,642 3.7 1954 13.7 0.2 4.3 0.8 45.0 59.5 64.0 1,796 3.6 1955 15.7 0.2 4.8 1.2 46.6 63.6 68.6 2,049 3.3 1956 18.7 0.3 5.3 1.9 49.8 70.4 76.0 2,277 3.3 1957 22.7 0.6 6.0 2.8 50.3 75.8 82.4 2,525 3.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249318A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249318A1.txt  
- 081-15-54.0 W 0001637120 EAST OHIO GAS COMPANY CHARDON 06/30/2004 06775.00000 41-35-00.2 N OH AM WQU53 081-15-54.0 W 0001637120 EAST OHIO GAS COMPANY CHARDON 06/30/2004 06855.00000 41-35-00.2 N IN AM KYP34 086-38-31.0 W 0001642801 HOOSIER ENERGY REC, INC ELLETTSVILLE 06/28/2004 06226.89000 39-12-34.2 N IN AM KYP34 086-38-31.0 W 0001642801 HOOSIER ENERGY REC, INC ELLETTSVILLE 06/28/2004 06635.00000 39-12-34.2 N CA AM WAK200 117-19-04.1 W 0001651389 SOUTHERN CALIFORNIA GAS COMPANCRESTLINE 06/29/2004 06256.54000 34-14-10.0 N CA AM WAK200 117-19-04.1 W 0001651389 SOUTHERN CALIFORNIA GAS COMPANCRESTLINE 06/29/2004 06635.00000 34-14-10.0 N OR AM 121-51-50.0 W 0001749076 UNION PACIFIC CORPORATION ODELL BUTTE 06/29/2004 00932.36875 43-28-13.4 N OR AM 121-51-50.0 W 0001749076 UNION PACIFIC CORPORATION ODELL BUTTE 06/29/2004 00941.36875 43-28-13.4 N Page 29 MG - Microwave Industrial/Business Pool State 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249615A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249615A1.txt  
- ° 23 ' 40.00 " N LAT. SITE ID: 1 200 TELEGRAPH HILL ROAD, MONMOUTH, HOLMDEL, NJ 74 ° 10 ' 26.00 " W LONG. LOCATION: SCIENTIFIC ATLANTA 1 11 meters ANTENNA ID: 8840-A 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMTECH 2 4.1 meters ANTENNA ID: 18 FT. "OFFSAT" Page 17 of 24 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMSAT/RSI 3 11.3 meters ANTENNA ID: 110 OCS 83.95 dBW QPSK DIGITAL, VOICE & DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK DIGITAL, VOICE & DATA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249616A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-249616A1.txt  
- - ALSAT - (ALSAT) University of Kansas E940245 SES-RWL-20040706-00938E Date Effective: 07/07/2004 Class of Station: Fixed Earth Stations Grant of Authority 08/12/2004 - 08/12/2019 Renewal Nature of Service:Domestic Fixed Satellite Service 38 ° 57 ' 55.00 " N LAT. SITE ID: 1 1120 WEST 11TH STREET, DOUGLAS, LAWRENCE, KS 95 ° 15 ' 0.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 847130-G2 52.50 dBW 5925.0000 - 6425.0000 MHz 50K0F3E 52.50 dBW 5925.0000 - 6425.0000 MHz 30K0F1D 58.50 dBW 5925.0000 - 6423.0000 MHz 200KF3E 3700.0000 - 4200.0000 MHz 200KF3E 3700.0000 - 4200.0000 MHz 50K0F3E 3700.0000 - 4200.0000 MHz 30K0F1D Points of Communication: 1 - ALSAT - (ALSAT) BRIGHAM YOUNG UNIVERSITY E7476 SES-RWL-20040707-00954E Date Effective: 07/09/2004 Class of Station: Fixed 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250198A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250198A1.txt  
- E030078 SES-MOD-20040713-01028P Date Effective: 07/23/2004 Class of Station: Fixed Earth Stations Grant of Authority 07/18/2003 - 07/18/2018 Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" Extension of Contruction permit. 35 ° 13 ' 33.00 " N LAT. SITE ID: 1 One Julian Price Place, Mechlenburg, Charlotte, NC 80 ° 52 ' 20.00 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 60.90 dBW QPSK digital, 1/2 FEC, 196 kbps, various information 5925.0000 - 6425.0000 MHz 235KG7W 59.10 dBW QPSK digital, 1/2 FEC, 128 Kbps, various information 5925.0000 - 6425.0000 MHz 154KG7W - QPSK digital, 1/2 FEC, 196 kbps, various information 3700.0000 - 4200.0000 MHz 235KG7W QPSK digital, 1/2 FEC, 128 Kbps, various information 3700.0000 - 4200.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250384A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250384A1.txt  
- % total int'l PSTN traffic Federal Communications Commission Federal Communications Commission 44 International VoIP Growth, 2001-2002 Source: Telegeography 2004 200% 160% 95% 50% 0% 50% 100% 150% 200% 250% Africa Latin America Asia Europe Federal Communications Commission Federal Communications Commission 55 Top 10 destinations for US-originated VoIP traffic Sources: Telegeography 2004, FCC Trends Int'l Teleom 2004 2 1.9 1.8 4.3 4.1 3.5 2.9 3.2 5.8 18.3 0.4 0.4 0.4 0.8 1 1 2.2 4.2 6.3 13.8 0 2 4 6 8 10 12 14 16 18 20 Russia Thailand Peru Poland China Colombia Brazil India Philippines Mexico % total outgoing VoIP minutes % total outgoing PSTN minutes VoIP VoIPtraffic between the United States and traffic between the United States and other 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250483A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-250483A1.txt  
- GENESEE COUNTY 911 ORTONVILLE 07/30/2004 06786.25000 42-53-56.0 N MI NE 083-51-26.8 W 0001825423 GENESEE COUNTY 911 MONTROSE 07/30/2004 06796.25000 43-11-51.8 N MI NE 083-48-11.0 W 0001825424 GENESEE COUNTY 911 SWARTZ CREEK 07/30/2004 06745.00000 42-52-11.0 N MI NE 083-48-11.0 W 0001825424 GENESEE COUNTY 911 SWARTZ CREEK 07/30/2004 06825.00000 42-52-11.0 N MI NE 083-35-41.8 W 0001825425 GENESEE COUNTY 911 ROGERSVILLE 07/30/2004 06781.25000 43-08-04.1 N Page 21 TI - TV Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPNN727 121-52-19.8 W 0001821522 NBC TELEMUNDO LICENSE CO. FREMONT 07/27/2004 12750.00000 37-29-55.7 N CT MD WQAR235 072-49-55.0 W 0001825459 CONNECTICUT PUBLIC BROADCASTINFARMINGTON 07/30/2004 06875.00000 - 06900.00000 41-42-13.0 N CA NE 121-52-19.8 W 0001821540 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251059A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251059A1.txt  
- nBALTIMORE 08/10/2004 11075.00000 39-17-05.0 N MD NE 076-40-13.3 W 0001835846 Department of Budget and Management, nHereford 08/10/2004 05945.20000 39-35-38.7 N MD NE 076-57-24.9 W 0001835896 Department of Budget and Management, nWestminister 08/10/2004 06197.24000 39-33-17.4 N CA NE 118-35-11.6 W 0001835974 GLENDALE, CITY OF CHATSWORTH 08/10/2004 06555.00000 34-19-31.5 N CA NE 118-19-17.5 W 0001835975 GLENDALE, CITY OF LOS ANGELES 08/10/2004 19585.00000 34-08-04.1 N CA NE 118-11-02.3 W 0001835977 GLENDALE, CITY OF LOS ANGELES 08/10/2004 17825.00000 34-09-35.4 N CA NE 118-11-20.8 W 0001835980 GLENDALE, CITY OF GLENDALE 08/10/2004 06795.00000 34-10-39.9 N CA NE 118-11-20.8 W 0001835980 GLENDALE, CITY OF GLENDALE 08/10/2004 19385.00000 34-10-39.9 N CA NE 118-23-28.2 W 0001835982 GLENDALE, CITY OF BEVERLY HILLS 08/10/2004 06705.00000 34-06-34.6 N CA NE 118-15-23.0 W 0001835985 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251260A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251260A1.txt  
- AUTHORITYBOSTON 08/18/2004 11445.00000 42-21-04.3 N MA MD WPOU259 071-02-10.1 W 0001845433 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 11525.00000 42-21-04.3 N MA MD WPOU259 071-02-10.1 W 0001845433 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 11605.00000 42-21-04.3 N MA MD WPOU259 071-02-10.1 W 0001845433 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 22235.00000 42-21-04.3 N MA MD WPOU259 071-02-10.1 W 0001845433 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 23125.00000 42-21-04.3 N MA MD WPOU393 071-01-04.1 W 0001845443 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 10795.00000 42-21-55.3 N MA MD WPOU393 071-01-04.1 W 0001845443 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 10955.00000 42-21-55.3 N MA MD WPOU393 071-01-04.1 W 0001845443 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 11035.00000 42-21-55.3 N MA MD WPOU393 071-01-04.1 W 0001845443 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 11115.00000 42-21-55.3 N MA MD WPOU393 071-01-04.1 W 0001845443 MASSACHUSETTS PORT AUTHORITYBOSTON 08/18/2004 19440.00000 42-21-55.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251666A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251666A1.txt  
- ° 23 ' 40.00 " N LAT. SITE ID: 1 200 TELEGRAPH HILL ROAD, MONMOUTH, HOLMDEL, NJ 74 ° 10 ' 26.00 " W LONG. LOCATION: SCIENTIFIC ATLANTA 1 11 meters ANTENNA ID: 8840-A 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMTECH 2 4.1 meters ANTENNA ID: 18 FT. "OFFSAT" 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMSAT/RSI 3 11.3 meters ANTENNA ID: 110 OCS 83.95 dBW QPSK DIGITAL, VOICE & DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK DIGITAL, VOICE & DATA SERVICES 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251886A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251886A1.txt  
- Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL NE 088-03-14.6 W 0001856875 GRAYSLAKE HIGH SCHOOL DISTRICT Round Lake 08/30/2004 19460.00000 42-22-34.6 N IL NE 088-03-14.6 W 0001856875 GRAYSLAKE HIGH SCHOOL DISTRICT Round Lake 08/30/2004 19620.00000 42-22-34.6 N CO NE 105-10-13.4 W 0001858333 JEFFERSON, COUNTY OF GOLDEN 08/31/2004 23125.00000 39-43-22.3 N CO NE 105-12-04.1 W 0001858340 JEFFERSON, COUNTY OF GOLDEN 08/31/2004 21925.00000 39-43-42.1 N CO NE 105-13-22.8 W 0001858348 JEFFERSON, COUNTY OF GOLDEN 08/31/2004 23175.00000 39-44-35.6 N UT NE 111-22-00.7 W 0001860514 UTAH, COUNTY OF SPANISH FORK 09/02/2004 06555.00000 40-01-27.8 N UT NE 111-49-19.3 W 0001860518 UTAH, COUNTY OF SPANISH FORK 09/02/2004 06725.00000 40-05-25.8 N UT NE 111-49-19.3 W 0001860518 UTAH, COUNTY OF SPANISH 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251940A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251940A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-251940A2.txt  
- Consumer) In the United States, the two most popular consumer services provided directly by satellites are television and radio. Slide 8: U.S. DBS and DARS - Subscriber Growth Subscribers to satellite television have doubled from 1999 to 2003. Over two and one-half million subscribers now enjoy the benefits of nationwide satellite radio. In fact, projections indicate that there will be 4.1 million subscribers by the end of 2004. Looking ahead, the challenge to BSS providers is to meet growing consumer demand. Slide 9: Mobile Satellite Services In MSS, global satellite phone use is growing. Slide 10: Mobile Satellite Phone Use is Growing According to industry estimates, worldwide subscribers to satellite phones reached 885,000 in 2004, a 27% increase from 2003. The 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252367A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252367A1.txt  
- 39-49-50.3 N CO AM 104-57-39.5 W 0001747275 FIBERTOWER CORPORATION DENVER 09/14/2004 23120.00000 39-49-50.3 N CO AM 104-59-02.5 W 0001747284 FIBERTOWER CORPORATION ARVADA 09/14/2004 18000.00000 39-48-39.2 N CO AM 104-59-02.5 W 0001747284 FIBERTOWER CORPORATION ARVADA 09/14/2004 21820.00000 39-48-39.2 N CO AM 104-56-28.6 W 0001747332 FIBERTOWER CORPORATION DENVER 09/14/2004 23170.00000 39-40-06.5 N CO AM 104-57-44.2 W 0001747337 FIBERTOWER CORPORATION DENVER 09/14/2004 23170.00000 39-41-04.1 N CO AM 104-56-21.0 W 0001747342 FIBERTOWER CORPORATION DENVER 09/14/2004 21820.00000 39-41-09.0 N CO AM 104-56-21.0 W 0001747342 FIBERTOWER CORPORATION DENVER 09/14/2004 21920.00000 39-41-09.0 N CO AM 104-56-21.0 W 0001747342 FIBERTOWER CORPORATION DENVER 09/14/2004 21970.00000 39-41-09.0 N CO AM 104-56-30.4 W 0001747349 FIBERTOWER CORPORATION DENVER 09/14/2004 23020.00000 39-41-08.7 N Page 10 CF - Common Carrier Fixed Point to Point Microwave 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252523A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252523A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Note 1 to Table 1. 47 C.F.R. § 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1310. Guidelines, Second Memorandum Opinion and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252662A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252662A1.txt  
- N NY MD WPYY871 077-34-20.0 W 0001881424 MONROE, COUNTY OF ROCHESTER 09/23/2004 17965.00000 43-08-23.0 N NY MD WPYU303 077-39-03.0 W 0001881431 MONROE, COUNTY OF HENRIETTA 09/23/2004 06705.62500 43-01-22.0 N CA MD WNET281 115-50-21.1 W 0001881643 IMPERIAL IRRIGATION DISTRICT SEELEY 09/23/2004 00958.75000 32-57-29.3 N CA MD WNET281 115-50-21.1 W 0001881643 IMPERIAL IRRIGATION DISTRICT SEELEY 09/23/2004 06685.62500 32-57-29.3 N CA MD WPQL652 115-26-04.1 W 0001881941 Imperial Irrigation District Niland 09/23/2004 10553.12500 33-11-30.5 N CA MD WNEY557 116-06-58.1 W 0001881942 IMPERIAL IRRIGATION DISTRICT COACHELLA 09/23/2004 10563.12500 33-40-21.3 N CA MD WNET657 114-28-12.8 W 0001881943 IMPERIAL IRRIGATION DISTRICT BARD 09/23/2004 10623.12500 32-53-02.3 N CA MD WNET659 114-31-03.0 W 0001881944 IMPERIAL IRRIGATION DISTRICT BARD 09/23/2004 00958.35000 32-49-59.6 N CA MD WNET659 114-31-03.0 W 0001881944 IMPERIAL IRRIGATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252663A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-252663A1.txt  
- W 0001879275 Cellco Partnership W. BRIDGEWATER 09/22/2004 42-02-50.4 N MA RM KNKA201 071-03-58.2 W 0001879275 Cellco Partnership W. BRIDGEWATER 09/22/2004 42-02-50.4 N MA RM KNKA201 071-03-58.2 W 0001879275 Cellco Partnership W. BRIDGEWATER 09/22/2004 42-02-50.4 N Page 30 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA RM KNKA201 070-44-04.1 W 0001879275 Cellco Partnership WAREHAM 09/22/2004 41-46-56.4 N MA RM KNKA201 070-44-04.1 W 0001879275 Cellco Partnership WAREHAM 09/22/2004 41-46-56.4 N MA RM KNKA201 070-44-04.1 W 0001879275 Cellco Partnership WAREHAM 09/22/2004 41-46-56.4 N MA RM KNKA201 071-17-29.2 W 0001879275 Cellco Partnership WRENTHAM 09/22/2004 42-03-31.4 N MA RM KNKA201 071-17-29.2 W 0001879275 Cellco Partnership WRENTHAM 09/22/2004 42-03-31.4 N MA RM KNKA201 071-17-29.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253062A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253062A1.txt  
- - 4200.0000 MHz 308KG7W Points of Communication: 1 - AMC-3 - (87 W.L.) E873910 SES-MOD-20040924-01426E Class of Station: Temporary Fixed Earth Station Application for Modification RCN License Subsidiary, Inc. Nature of Service:Domestic Fixed Satellite Service "MOD" to change emission designator and related service, to increase EIRP and EIRP density and to replace antenna. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 71.93 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 71.93 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 64KBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 51K2G7W Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253617A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253617A1.txt  
- 00949.00000 34-00-04.4 N KS NE 097-08-49.0 W 0001909889 TAYLOR COMMUNICATIONS, INC. CLAY CENTER 10/22/2004 00950.00000 39-22-53.0 N KS NE 097-07-36.1 W 0001909930 TAYLOR COMMUNICATIONS, INC. CLAY CENTER 10/22/2004 00944.50000 39-29-14.0 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City LA AM WPJE872 089-02-04.1 W 0001742036 Stratos Offshore Services Company VENICE 10/18/2004 06286.19000 29-12-24.7 N LA AM WPJE872 089-02-04.1 W 0001742036 Stratos Offshore Services Company VENICE 10/18/2004 06345.49000 29-12-24.7 N IA AM WMK529 093-00-32.0 W 0001798141 USCOC OF GREATER IOWA, INC. REASNOR 10/21/2004 06063.80000 41-36-25.0 N IA AM WMK529 093-00-32.0 W 0001798141 USCOC OF GREATER IOWA, INC. REASNOR 10/21/2004 06093.45000 41-36-25.0 N IA AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253937A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-253937A1.txt  
- Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE 078-11-33.6 W 0001911466 Warren County, VA FRONT ROYAL 10/25/2004 00933.37500 38-54-59.2 N VA NE 078-11-33.6 W 0001911466 Warren County, VA FRONT ROYAL 10/25/2004 00934.17500 38-54-59.2 N CO NE 106-51-24.1 W 0001911624 EAGLE, COUNTY OF SHERIFF'S OFFICEAGLE 10/25/2004 06286.19000 39-46-34.0 N CO NE 106-48-04.1 W 0001911634 EAGLE, COUNTY OF SHERIFF'S OFFICEAGLE 10/25/2004 06226.89000 39-44-23.0 N CO NE 106-45-36.1 W 0001911641 EAGLE, COUNTY OF SHERIFF'S OFFICEAGLE 10/25/2004 06034.15000 39-55-41.9 N CO NE 106-30-32.1 W 0001911831 EAGLE, COUNTY OF SHERIFF'S OFFICAvon 10/25/2004 05974.85000 39-33-51.9 N IL NE 088-19-46.6 W 0001911838 Crystal Lake School District 47 Crystal Lake 10/25/2004 21825.00000 42-14-57.5 N IL NE 088-19-46.6 W 0001911838 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254329A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254329A1.txt  
- - ALSAT - (ALSAT) E873910 SES-MOD-20040924-01426E Date Effective: 11/16/2004 Class of Station: Temporary Fixed Earth Station Grant of Authority 12/19/1997 - 12/19/2007 Application for Modification RCN LICENSE SUBSIDIARY, INC. Nature of Service:Domestic Fixed Satellite Service "MOD" to change emission designator and related service, to increase EIRP and EIRP density and to replace antenna. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 71.93 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 71.93 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 64KBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 51K2G7W Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254343A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254343A1.txt  
- LLC CENTENNIAL 11/09/2004 22785.00000 39-35-53.5 N CA NE 117-40-23.2 W 0001928569 SOUTHWESTERN BELL MOBILE SYSTECHINO 11/09/2004 19455.00000 33-56-49.6 N CA NE 117-42-15.6 W 0001928592 SOUTHWESTERN BELL MOBILE SYSTECHINO 11/09/2004 17895.00000 34-00-02.0 N TX NE 097-02-03.0 W 0001928844 Partnership Wireless, LLC Lewisville 11/09/2004 17800.00000 33-04-23.2 N TX NE 097-07-46.1 W 0001928853 Partnership Wireless, LLC Argyle 11/09/2004 19360.00000 33-04-30.0 N TX NE 102-41-04.1 W 0001928873 WWC Texas RSA Limited Partnership Imperial 11/09/2004 06835.62500 31-16-28.5 N CO NE 104-17-12.0 W 0001929103 N.E. Colorado Wireless Technologies, IncCalhan (Fondis) 11/10/2004 06825.00000 39-15-42.0 N NY NE 078-52-35.1 W 0001930222 TRANSWAVE COMMUNICATION SYSTEBUFFALO 11/10/2004 05974.85000 42-52-48.4 N NY NE 078-39-05.0 W 0001930223 TRANSWAVE COMMUNICATION SYSTECLARENCE 11/10/2004 06197.24000 42-57-18.0 N CA NE 119-00-13.6 W 0001932709 SOUTHWESTERN BELL MOBILE SYSTEARVIN 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254381A1.pdf  
- T I O N FILE NUMBER STATE E/P 11/16/2004 Actions of: FM STATION APPLICATIONS FOR MINOR CHANGE TO A LICENSED FACILITY GRANTED , CASTLE ROCK 92.1 MHZ E CO Minor change in licensed facilities. Engineering Amendment filed 10/18/2004 ENTRAVISION HOLDINGS, LLC KJMN 10056 BPH-20040525AAS CO , LECANTO 88.3 MHZ E FL Minor change in licensed facilities. Engineering Amendment filed 11/12/2004. 4.1 kW ERP, 73 meters HAAT, 28 52 01 NL, 82 31 21 WL Granted 11/16/2004 BISHOP OF THE DIOCESE OF ST PETERSBURG WLMS 65474 BPED-20040816AAQ FL FM TRANSLATOR APPLICATIONS FOR ORIGINAL CONSTRUCTION PERMIT GRANTED , SILVER CREEK 98.9 MHZ E NY CP New Stn. EDGEWATER BROADCASTING, INC. W255BP 154509 BNPFT-20030827AQQ NY , KING CITY 92.9 MHZ E CA CP New 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254574A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254574A1.txt  
- W 0001903217 Aeronautical Radio Inc Tampa 11/18/2004 00136.50000 27-58-31.7 N WA AM 122-53-26.9 W 0001915552 Northwest Helicopters Olympia 11/16/2004 00122.80000 46-57-51.8 N WA AM 122-53-26.9 W 0001915552 Northwest Helicopters Olympia 11/16/2004 00123.07500 46-57-51.8 N IN AM 086-33-44.3 W 0001921402 Frankfort Airport Authority Frankfort 11/16/2004 00123.00000 40-16-37.3 N IL MD WSO8 087-54-57.2 W 0001939257 AERONAUTICAL RADIO INC Des Plaines 11/16/2004 00129.40000 42-01-04.1 N NY MD WFG5 078-43-14.1 W 0001939356 Lindsay Aviation, Inc. WEST SENECA 11/16/2004 00122.97500 42-52-00.2 N Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR NE 090-14-04.0 W 0001937525 West Memphis Municipal Airport City ofWest Memphis 11/15/2004 00123.05000 35-08-11.0 N MD NE 077-00-27.6 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254883A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-254883A1.txt  
- POWER COMCHESAPEAKE 11/22/2004 06780.00000 36-46-17.5 N NM MD WED671 108-25-31.1 W 0001946350 Tri State Generation & Transmission AssoWHITE SIGNAL 11/22/2004 00959.15000 32-34-56.2 N NM MD WED671 108-25-31.1 W 0001946350 Tri State Generation & Transmission AssoWHITE SIGNAL 11/22/2004 02185.60000 32-34-56.2 N NM MD WED671 108-25-31.1 W 0001946350 Tri State Generation & Transmission AssoWHITE SIGNAL 11/22/2004 02194.40000 32-34-56.2 N NM MD WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 11/22/2004 00954.35000 32-02-03.3 N NM MD WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 11/22/2004 00955.55000 32-02-03.3 N VA MD KBE20 077-23-22.0 W 0001946430 VIRGINIA ELECTRIC AND POWER COMCHESTER 11/22/2004 06635.00000 37-23-02.0 N TX MD WPNJ310 097-51-02.0 W 0001946503 Enterprise Products Operating L.P. BANQUETE 11/22/2004 05974.85000 27-45-11.1 N TX MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-255866A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-255866A1.txt  
- Voice 14000.0000 - 14500.0000 MHz 32M3G7W Digital Data and Video 11700.0000 - 12200.0000 MHz 32M3G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 1M54G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 32M3G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 1M54G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 32M3G7W RSI Satcom Technologies 5.5m Hub 4.1 meters ANTENNA ID: 551KS Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 1M77G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 22K0G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 30K0G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 4M33G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 89K0G7W Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256011A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256011A1.txt  
- 104-49-48.5 W 0001992586 FIBERTOWER CORPORATION AURORA 01/04/2005 23120.00000 39-38-15.8 N CO MD WQBR888 104-49-48.5 W 0001992586 FIBERTOWER CORPORATION AURORA 01/04/2005 23170.00000 39-38-15.8 N CO MD WQBQ638 104-51-07.7 W 0001992618 FIBERTOWER CORPORATION ENGLEWOOD 01/04/2005 23170.00000 39-35-53.1 N CO MD WQBQ850 104-52-27.1 W 0001992648 FIBERTOWER CORPORATION DENVER 01/04/2005 23070.00000 39-39-15.6 N CO MD WQBR762 104-57-44.2 W 0001993249 FIBERTOWER CORPORATION DENVER 01/04/2005 23120.00000 39-41-04.1 N CO MD WQBR891 105-03-19.5 W 0001993291 FIBERTOWER CORPORATION LAKEWOOD 01/04/2005 21870.00000 39-43-37.4 N CO MD WQBR891 105-03-19.5 W 0001993291 FIBERTOWER CORPORATION LAKEWOOD 01/04/2005 21920.00000 39-43-37.4 N CO MD WQBR722 105-10-24.5 W 0001993384 FIBERTOWER CORPORATION GOLDEN 01/04/2005 21520.00000 39-46-27.9 N CO MD WQBR722 105-10-24.5 W 0001993384 FIBERTOWER CORPORATION GOLDEN 01/04/2005 21820.00000 39-46-27.9 N CO MD WQBR722 105-10-24.5 W 0001993384 FIBERTOWER 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256084A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256084A1.pdf  
- 2004 Table of Contents Page Executive Summary 3 Section 1.0 Introduction 5 1.1 NeuStar's Petition 5 1.2 FCC/NANC Assignment 6 1.3 Scope 6 Section 2.0 NANC's Existing Oversight Requirement 7 Section 3.0 Neutrality 7 3.1 History i.e. LM transfer to NeuStar 7 3.2 Existing Requirements 8 3.3 Publicly Traded Company 11 3.4 Private Company 12 Section 4.0 Enforcement Tools 13 4.1 Audit Requirement 13 4.2 Penalties 13 4.3 Oversight Controls 14 Section 5.0 Summary and Recommendation 14 Section 6.0 List of References 16 Executive Summary On April 14, 2004, NeuStar filed a petition with the Federal Communications Commission (FCC) seeking a ruling for modification of some of the current FCC policies that prohibit NeuStar from undertaking certain types of transactions without 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256133A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256133A1.txt  
- 0002002113 Aeronautical Radio Inc Pasco 01/11/2005 00136.85000 46-15-52.9 N FL NE 084-21-01.2 W 0002002162 Aeronautical Radio Inc Tallahassee 01/11/2005 00136.85000 30-23-47.5 N GA NE 081-57-52.2 W 0002002188 Aeronautical Radio Inc Augusta 01/11/2005 00136.85000 33-22-11.8 N FL NE 087-11-14.8 W 0002002216 Aeronautical Radio Inc Pensacola 01/11/2005 00136.85000 30-28-23.9 N OH NE 083-58-46.8 W 0002002877 Putnam County Airport Authority Ottawa 01/11/2005 00122.70000 41-02-04.1 N OK NE 095-49-50.0 W 0002003729 Grosh Mr., Donald R Tulsa 01/12/2005 00122.80000 36-08-34.0 N IL NE 089-09-00.0 W 0002004155 Illinois Valley Regional Airport Peru 01/12/2005 00123.00000 41-21-09.0 N WA NE 123-29-54.0 W 0002006829 Port of Port Angeles Port Angeles 01/14/2005 00123.00000 48-07-13.0 N RO WCM3 0001999140 LOUISIANA, STATE OF 01/10/2005 RO KMR3 0001999508 Lane Aviation Corporation 01/10/2005 RO WKQ3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256267A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256267A1.txt  
- 27.0 49.9 2.6 $0 $0 600,560 11.9 0.9 49.4 35.4 2.4 Iceland $5,869,402 72.6 1.0 21.6 3.1 1.8 $574,093 53.1 0.0 23.9 23.0 0.0 $24,025 0.0 0.0 20.3 79.7 0.0 28,161,329 50.3 1.5 26.5 16.5 5.1 Ireland $59,790,898 45.3 5.1 13.9 34.3 1.4 $3,157,046 64.9 2.2 22.0 10.6 0.2 $1,060,832 0.1 99.5 0.4 0.1 0.0 393,513,974 32.3 15.2 20.1 28.3 4.1 Italy $196,009,374 65.1 1.5 16.9 13.9 2.6 $6,350,304 50.6 0.2 20.5 27.6 1.1 $11,130,708 3.9 93.7 0.0 2.4 0.0 965,784,266 33.4 2.5 19.8 27.7 16.7 Liechtenstein $471,637 23.9 1.5 6.8 59.2 8.7 $0 $0 7,270,691 8.2 1.6 59.0 21.2 10.0 Luxembourg $5,118,046 69.1 1.2 15.5 12.6 1.7 $225,587 56.1 0.0 20.4 22.6 0.8 $74,766 1.8 0.0 0.8 97.4 0.0 33,435,294 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256475A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256475A1.txt  
- 14000.0000 - 14500.0000 MHz 36M0F8F 68.62 dBW ANALOG VIDEO W/ASSOCIATED AUDIO SUBCARRIERS AND ATIS 14000.0000 - 14500.0000 MHz 24M0F8F Points of Communication: 1 - ALSAT - (ALSAT) E050013 SES-LIC-20050114-00074E Class of Station: Temporary Fixed Earth Station Application for Authority RCN License Subsidiary, Inc. Page 4 of 15 Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256582A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256582A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Note 1 to Table 1. 47 C.F.R. § 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1310. 47 C.F.R. § 1.1310. Guidelines, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256820A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256820A1.txt  
- Voice 14000.0000 - 14500.0000 MHz 32M3G7W Digital Data and Video 11700.0000 - 12200.0000 MHz 32M3G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 1M54G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 32M3G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 1M54G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 32M3G7W RSI Satcom Technologies 5.5m Hub 4.1 meters ANTENNA ID: 551KS Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 1M77G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 22K0G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 30K0G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 4M33G7W Digital QPSK (SCPC compressed digital data/video) 11700.0000 - 12200.0000 MHz 89K0G7W Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256927A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256927A1.txt  
- 088-16-07.2 W 0002051957 Ameritech Mobile Services, Inc. AURORA 02/17/2005 00931.71250 41-48-26.1 N IL RM KNKG720 088-57-48.5 W 0002051957 Ameritech Mobile Services, Inc. Bloomington 02/17/2005 00931.71250 40-27-08.2 N IL RM KNKG720 088-05-46.1 W 0002051957 Ameritech Mobile Services, Inc. CASEY 02/17/2005 00931.71250 39-16-59.1 N IL RM KNKG720 088-14-43.1 W 0002051957 Ameritech Mobile Services, Inc. CHAMPAIGN 02/17/2005 00931.71250 40-06-44.1 N IL RM KNKG720 088-19-04.1 W 0002051957 Ameritech Mobile Services, Inc. CHAMPAIGN 02/17/2005 00931.71250 40-10-51.1 N IL RM KNKG720 087-33-39.1 W 0002051957 Ameritech Mobile Services, Inc. CHICAGO 02/17/2005 00931.71250 41-45-53.1 N IL RM KNKG720 087-40-22.1 W 0002051957 Ameritech Mobile Services, Inc. CHICAGO 02/17/2005 00931.71250 41-52-51.1 N IL RM KNKG720 087-38-44.1 W 0002051957 Ameritech Mobile Services, Inc. CHICAGO 02/17/2005 00931.71250 41-57-17.1 N IL RM KNKG720 087-50-46.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256937A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-256937A1.txt  
- Communication: 1 - JCSAT-3 - (128 E.L.) E7900 SES-MOD-20050215-00183E Class of Station: Fixed Earth Stations Application for Modification Texas Infinity Broadcasting LP Nature of Service:Domestic Fixed Satellite Service "MOD" to relocate station. 32 ° 53 ' 25.00 " N LAT. SITE ID: 1 2124 SATURN ROAD, DALLAS, GARLAND, TX 96 ° 38 ' 44.00 " W LONG. LOCATION: PRODELIN 1 4.1 meters ANTENNA ID: 1383 51.16 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 230KG7W 0.00 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION 3700.0000 - 4200.0000 MHz 307KG7W Points of Communication: 1 - ALSAT - (ALSAT) E050043 SES-REG-20050218-00197E Class of Station: Fixed Earth Stations Registration State University of New York Nature of Service:Domestic Fixed Satellite Service Page 10 of 11 For more 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257084A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257084A1.txt  
- ID: 18QD 8.192 Mbps, QPSK, FEC 11700.0000 - 12200.0000 MHz 6M55G7W 55.50 dBW 8.192 Mbps, QPSK, FEC 14000.0000 - 14500.0000 MHz 6M55G7W Points of Communication: 1 - ALSAT - (ALSAT) E050047 SES-LIC-20050218-00210E Class of Station: Temporary Fixed Earth Station Application for Authority Hurst USA, Inc. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various, Various, Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates to 45Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard video with associated audio subcarriers. 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257265A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257265A1.txt  
- dBW Digital Compressed Video Carrier 14000.0000 - 14500.0000 MHz 27M0G7F Points of Communication: 1 - ALSAT - (ALSAT) E050013 SES-LIC-20050114-00074E Date Effective: 03/07/2005 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/07/2005 - 03/07/2020 Application for Authority RCN License Subsidiary, Inc. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Page 4 of 32 COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257272A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257272A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WQAX699 087-51-48.8 W 0002061660 Illinois Bell Telephone Company Kankakee 02/28/2005 18085.00000 41-07-11.5 N IL MD WQAX696 087-52-01.1 W 0002061756 Illinois Bell Telephone Company Kankakee 02/28/2005 19645.00000 41-07-59.0 N IL MD WQAX686 087-50-53.0 W 0002061779 IIlinois Bell Telephone Company Kankakee 02/28/2005 19605.00000 41-03-55.0 N WA MD WPJB542 119-53-04.1 W 0002061783 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 02/28/2005 02121.60000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0002061783 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 02/28/2005 06855.62500 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0002061783 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 02/28/2005 10563.75000 46-48-55.4 N WA MD WMM853 121-40-51.2 W 0002061810 OREGON RSA NO. 2 LIMITED PARTNERCARSON 02/28/2005 02112.00000 45-44-10.4 N WA MD WMM853 121-40-51.2 W 0002061810 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257592A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257592A1.txt  
- Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK MD WCG242 147-16-18.6 W 0002091260 ALASCOM, INC. NORTH POLE 03/18/2005 06315.84000 64-44-16.4 N AK MD WCG242 147-16-18.6 W 0002091260 ALASCOM, INC. NORTH POLE 03/18/2005 06345.49000 64-44-16.4 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, INC. VALDEZ 03/18/2005 05945.20000 61-05-04.1 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, INC. VALDEZ 03/18/2005 05974.85000 61-05-04.1 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, INC. VALDEZ 03/18/2005 06004.50000 61-05-04.1 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, INC. VALDEZ 03/18/2005 06063.80000 61-05-04.1 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, INC. VALDEZ 03/18/2005 11305.00000 61-05-04.1 N AK MD WAH393 146-23-39.2 W 0002091261 ALASCOM, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257820A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257820A1.txt  
- City PA AM WQCK797 075-09-55.8 W 0001744177 CBS Broadcasting Inc. Philadelphia 03/25/2005 22585.00000 39-54-05.0 N PA AM WQCK797 075-09-55.8 W 0001744177 CBS Broadcasting Inc. Philadelphia 03/25/2005 22635.00000 39-54-05.0 N PA AM WQCK799 075-08-51.6 W 0001744287 CBS Broadcasting Inc. Philadelphia 03/25/2005 21335.00000 39-57-00.4 N PA AM WQCK799 075-08-51.6 W 0001744287 CBS Broadcasting Inc. Philadelphia 03/25/2005 21435.00000 39-57-00.4 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/21/2005 00954.35000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/21/2005 00955.55000 32-02-03.3 N AK AM 145-05-10.8 W 0001985568 Teck-Pogo Inc. Delta Junction 03/23/2005 06630.62500 64-24-24.5 N AK AM 145-05-10.8 W 0001985568 Teck-Pogo Inc. Delta Junction 03/23/2005 06790.62500 64-24-24.5 N AK AM 145-43-46.3 W 0001985783 Teck-Pogo 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257982A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257982A1.txt  
- 36M0G7W 65.00 dBW DIGITAL AUDIO, VIDEO, AND DATA 14000.0000 - 14500.0000 MHz 4M00G7W Points of Communication: 1 - ALSAT - (ALSAT) E050047 SES-LIC-20050218-00210E Date Effective: 04/05/2005 Class of Station: Temporary Fixed Earth Station Grant of Authority 04/05/2005 - 04/05/2020 Application for Authority Hurst USA, Inc. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 Various, Various, Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC rates 1/2 - 7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2 - 7/8, Various Data Rates to 45Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard video with associated audio subcarriers. 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257989A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-257989A1.txt  
- WNTM366 114-24-34.1 W 0001898233 COLLEGE OF SOUTHERN IDAHO KETCHUM 03/31/2005 06645.00000 43-38-47.6 N ID AM WNTM366 114-24-34.1 W 0001898233 COLLEGE OF SOUTHERN IDAHO KETCHUM 03/31/2005 06695.00000 43-38-47.6 N ID AM WNTM366 114-24-34.1 W 0001898233 COLLEGE OF SOUTHERN IDAHO KETCHUM 03/31/2005 17880.00000 43-38-47.6 N ID AM 114-17-35.9 W 0001898261 College of Southern Idaho Hailey 04/01/2005 19440.00000 43-30-55.4 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/29/2005 00954.35000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/29/2005 00954.35000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/29/2005 00955.55000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 03/29/2005 00955.55000 32-02-03.3 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258113A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258113A1.txt  
- OF VIRGINIA, 04/06/2005 Page 27 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OK AM WQCM371 094-40-45.8 W 0001884299 American Electric Power Service CorporatPoteau 04/05/2005 06605.00000 35-04-12.4 N OK AM WQCM371 094-40-45.8 W 0001884299 American Electric Power Service CorporatPoteau 04/05/2005 06805.00000 35-04-12.4 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 04/04/2005 00954.35000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 04/04/2005 00954.35000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 04/04/2005 00955.55000 32-02-03.3 N NM AM WED670 108-34-04.1 W 0001946411 Tri State Generation & Transmission AssoANIMAS 04/04/2005 00955.55000 32-02-03.3 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258527A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258527A1.txt  
- N NM RM KNKA272 106-39-12.1 W 0002136704 Verizon Wireless (VAW) LLC RIO RANCHO 04/25/2005 35-13-56.2 N NM RM KNKA272 106-39-12.1 W 0002136704 Verizon Wireless (VAW) LLC RIO RANCHO 04/25/2005 35-13-56.2 N NM RM KNKA272 106-39-12.1 W 0002136704 Verizon Wireless (VAW) LLC RIO RANCHO 04/25/2005 35-13-56.2 N NM RM KNKA272 106-27-28.1 W 0002136704 Verizon Wireless (VAW) LLC SAN FELIPE PUEBL 04/25/2005 35-23-04.1 N NM RM KNKA272 106-27-28.1 W 0002136704 Verizon Wireless (VAW) LLC SAN FELIPE PUEBL 04/25/2005 35-23-04.1 N NM RM KNKA272 106-18-32.1 W 0002136704 Verizon Wireless (VAW) LLC Santo Domingo 04/25/2005 35-28-22.1 N NJ RM KNKA290 075-02-29.6 W 0002136808 ALLENTOWN SMSA LIMITED PARTNERBlairstown 04/25/2005 40-59-54.3 N NJ RM KNKA290 075-02-29.6 W 0002136808 ALLENTOWN SMSA LIMITED PARTNERBlairstown 04/25/2005 40-59-54.3 N PA RM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258528A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258528A1.txt  
- 117-07-45.1 W 0002139150 Verizon Wireless (VAW) LLC SAN MARCOS 04/27/2005 33-11-06.1 N CA RM KNKA236 117-07-45.1 W 0002139150 Verizon Wireless (VAW) LLC SAN MARCOS 04/27/2005 33-11-06.1 N CA RM KNKA236 117-31-27.2 W 0002139150 Verizon Wireless (VAW) LLC SAN ONOFRE 04/27/2005 33-21-16.1 N CA RM KNKA236 117-31-27.2 W 0002139150 Verizon Wireless (VAW) LLC SAN ONOFRE 04/27/2005 33-21-16.1 N CA RM KNKA236 116-19-04.1 W 0002139150 Verizon Wireless (VAW) LLC Whitestar 04/27/2005 32-38-48.2 N AZ RM KNKA286 110-57-25.3 W 0002139157 Verizon Wireless (VAW) LLC GREEN VALLEY 04/27/2005 31-50-30.3 N AZ RM KNKA286 110-57-15.4 W 0002139157 Verizon Wireless (VAW) LLC ORO VALLEY 04/27/2005 32-25-22.3 N AZ RM KNKA286 110-57-15.4 W 0002139157 Verizon Wireless (VAW) LLC ORO VALLEY 04/27/2005 32-25-22.3 N AZ RM KNKA286 110-58-47.3 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258636A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258636A1.txt  
- - 4200.0000 MHz 1M50F7D 3700.0000 - 4200.0000 MHz 200KF3E 3700.0000 - 4200.0000 MHz 36M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 1M50F7D 3700.0000 - 4200.0000 MHz 200KF3E Page 14 of 22 3700.0000 - 4200.0000 MHz 36M0G7W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 1M50F7D 3700.0000 - 4200.0000 MHz 200KF3E 3700.0000 - 4200.0000 MHz 36M0G7W COMTECH 4 4.1 meters ANTENNA ID: "18 FT." OFFSAT 84.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 77.50 dBW 5925.0000 - 6425.0000 MHz 1M50F7D 66.40 dBW 5925.0000 - 6425.0000 MHz 200KF3E 84.40 dBW 5925.0000 - 6425.0000 MHz 36M0G7W 83.00 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 76.10 dBW 5925.0000 - 6425.0000 MHz 1M50F7D 65.00 dBW 5925.0000 - 6425.0000 MHz 200KF3E 83.00 dBW 5925.0000 - 6425.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258640A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258640A1.txt  
- SMR, 896-901/935-940 MHz, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WPHT206 0002138783 GENERAL COMMUNICATIONS SYSTEM 04/26/2005 MD WPIU856 A 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIE 05/06/2005 00896.00000 - 00901.00000 MD WPIU856 A 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIE 05/06/2005 00897.72500 MD WPIU856 A 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIE 05/06/2005 00898.66250 FL MD WPIU856 080-03-04.1 W 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIEWEST PALM BEAC 05/06/2005 00935.25000 26-42-01.2 N FL MD WPIU856 080-03-04.1 W 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIEWEST PALM BEAC 05/06/2005 00936.72500 26-42-01.2 N FL MD WPIU856 080-03-04.1 W 0002151646 INDUSTRIAL WIRELESS TECHNOLOGIEWEST PALM BEAC 05/06/2005 00937.66250 26-42-01.2 N YX - SMR, 806-821/851-866 MHz, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258716A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-258716A1.txt  
- MI MD KQL44 088-02-30.4 W 0002154166 AMCI Acquisition, L.P. IRON MOUNTAIN 05/09/2005 06278.80000 45-49-14.8 N MI MD KQL44 088-02-30.4 W 0002154166 AMCI Acquisition, L.P. IRON MOUNTAIN 05/09/2005 06397.40000 45-49-14.8 N AZ MD WMR752 112-22-04.6 W 0002155357 Verizon Wireless (VAW) LLC MAYER 05/10/2005 06197.24000 34-14-03.1 N CA MD WMN364 117-38-35.1 W 0002155615 Los Angeles SMSA Limited Partnership SAN CLEMENTE 05/10/2005 06150.28000 33-27-04.1 N VA MD WMN350 078-17-47.8 W 0002156080 ALLTEL COMMUNICATIONS OF VIRGINMADISON 05/10/2005 05945.20000 38-23-43.2 N VA MD WMN350 078-17-47.8 W 0002156080 ALLTEL COMMUNICATIONS OF VIRGINMADISON 05/10/2005 06063.80000 38-23-43.2 N VA MD WPOT929 078-07-31.6 W 0002156090 ALLTEL COMMUNICATIONS OF VIRGINREVA 05/10/2005 06315.84000 38-27-41.7 N VA MD WPOT929 078-07-31.6 W 0002156090 ALLTEL COMMUNICATIONS OF VIRGINREVA 05/10/2005 11245.00000 38-27-41.7 N TX MD WQBP244 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259336A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259336A1.txt  
- - ALSAT - (ALSAT) E950289 SES-RWL-20050606-00694E Date Effective: 06/08/2005 Class of Station: Fixed Earth Stations Grant of Authority 06/02/2005 - 06/02/2020 Renewal VULCAN SPORTS MEDIA, INC. Nature of Service:Domestic Fixed Satellite Service 42 ° 6 ' 56.00 " N LAT. SITE ID: 1 1935 TECHNY ROAD, COOK, NORTHBROOK, IL 87 ° 49 ' 36.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 847130 56.10 dBW 5925.0000 - 6425.0000 MHz 154KG7D 56.10 dBW 5925.0000 - 6425.0000 MHz 76K8G7D 56.10 dBW 5925.0000 - 6425.0000 MHz 153KG7D 62.10 dBW 5925.0000 - 6425.0000 MHz 307KG7D 60.80 dBW 5925.0000 - 6425.0000 MHz 230KG7D 63.80 dBW 5925.0000 - 6425.0000 MHz 460KG7D 65.10 dBW 5925.0000 - 6425.0000 MHz 614KG7D Page 11 of 18 72.50 dBW 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259341A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259341A1.txt  
- BRAZOS ELECTRIC POWER COOPERABOWIE 06/09/2005 06550.00000 33-34-21.3 N Page 31 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WED542 097-47-57.1 W 0002192992 BRAZOS ELECTRIC POWER COOPERABOWIE 06/09/2005 06670.00000 33-34-21.3 N NC MD KIM73 077-58-57.0 W 0002193035 Carolina Power and Light Company WILMINGTON 06/09/2005 06226.89000 34-17-04.1 N NC MD WNEF280 077-51-20.6 W 0002193041 Carolina Power and Light Company Castle Haynes 06/09/2005 05974.85000 34-21-21.0 N CA MD KDJ61 122-07-53.8 W 0002193154 Pacific Gas and Electric Company SARATOGA 06/09/2005 06123.10000 37-18-30.7 N CA MD WQCM656 122-01-20.9 W 0002193155 Pacific Gas and Electric Company Cupertino 06/09/2005 06375.14000 37-20-12.8 N LA MD WIA482 090-02-52.5 W 0002194252 LOUISIANA GENERATING, L.L.C. MANDEVILLE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259697A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259697A1.txt  
- Page 4 of 19 QPSK, MCPC VIDEO 18300.0000 - 18800.0000 MHz 54M0G7W QPSK, MCPC VIDEO 18300.0000 - 18800.0000 MHz 36M0G7W QPSK, MCPC VIDEO 18300.0000 - 18800.0000 MHz 24M0G7W Points of Communication: E050151 SES-LIC-20050525-00656E Class of Station: Temporary Fixed Earth Station Application for Authority SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" OFFSAT 66.79 dBW DIGITAL TV AND AUDIO 5925.0000 - 6425.0000 MHz 36M0G7W 52.60 dBW DATA USING OPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E050152 SES-LIC-20050525-00657E Class of Station: Temporary Fixed Earth Station Application for Authority SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259829A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259829A1.txt  
- 21-57-24.7 N FL NE 081-24-01.8 W 0002217719 NEXTEL LICENSE HOLDINGS 1, INC. SUNNILAND 06/27/2005 06625.62500 26-18-36.8 N FL NE 081-24-01.8 W 0002217719 NEXTEL LICENSE HOLDINGS 1, INC. SUNNILAND 06/27/2005 06635.00000 26-18-36.8 N FL NE 081-24-01.8 W 0002217719 NEXTEL LICENSE HOLDINGS 1, INC. SUNNILAND 06/27/2005 06666.25000 26-18-36.8 N FL NE 081-34-10.3 W 0002217722 NEXTEL LICENSE HOLDINGS 1, INC. Immokalee 06/27/2005 06226.89000 26-22-04.1 N FL NE 081-34-10.3 W 0002217722 NEXTEL LICENSE HOLDINGS 1, INC. Immokalee 06/27/2005 06345.49000 26-22-04.1 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 081-34-10.3 W 0002217722 NEXTEL LICENSE HOLDINGS 1, INC. Immokalee 06/27/2005 06795.00000 26-22-04.1 N FL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259960A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259960A1.txt  
- 087-56-49.6 W 0002233737 MYRTLEWOOD WATER SYSTEM MYRTLEWOOD 07/08/2005 00956.31875 32-14-49.6 N WI NE P 090-20-21.1 W 0002233766 CITY OF MEDFORD MEDFORD 07/08/2005 00956.31875 45-08-38.8 N CO NE P 105-55-40.8 W 0002233781 TOWN OF GRANBY GRANBY 07/08/2005 00956.25625 40-05-30.8 N WI NE P 092-31-20.0 W 0002233846 CITY OF ST CROIX FALLS ST CROIX FALLS 07/08/2005 00956.43125 45-29-02.0 N MN NE P 095-28-04.1 W 0002234095 CITY OF MAYNARD MAYNARD 07/08/2005 00956.39375 44-54-23.4 N WI NE P 092-12-15.2 W 0002234348 ST CROIX TRIBE WEBSTER 07/08/2005 00956.40625 45-48-55.0 N MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO AM 091-37-36.6 W 0002155294 Missouri State Highway Patrol Americus 07/07/2005 06197.24000 38-46-21.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-259986A1.pdf  
- Actions of: FM STATION APPLICATIONS FOR MINOR MODIFICATION TO A CONSTRUCTION PERMIT GRANTED , BUHL 88.1 MHZ E ID Mod of CP to chg IDAHO CONFERENCE OF SEVENTH-DAY ADVENTISTS, INC. KTFY 91839 BMPED-20050308ABX ID FM STATION APPLICATIONS FOR MINOR CHANGE TO A LICENSED FACILITY GRANTED , OTTAWA 88.9 MHZ E IL Minor change in licensed facilities. 1.40 kW ERP (H), 4.1 kW ERP (V), 148 meters HAAT, 41 18 05 NL, 88 57 11 WL Granted 7/12/2005 AMERICAN FAMILY ASSOCIATION WWGN 13926 BPED-20050512AEP IL FM AUXILIARY TRANSMITTING ANTENNA APPLICATIONS FOR AUXILIARY PERMIT GRANTED , CAMUY 102.9 MHZ E PR CP for auxiliary purposes. Engineering Amendment filed 09/20/2002 HQ-103, INC. WDIN 27954 BXPH-20020207AAZ PR , HOUSTON 100.3 MHZ E TX CP for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260255A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260255A1.txt  
- temporary-fixed earth station, change emission designator and related service, increase EIRP and EIRP density, replace antenna, change frequencies, to be used for transmission of BPSK, QPSK, QAM, FEC rates 1/2 - 7/8, various data rates from 64 kbps, various data rates to 45 Mbps, various information, and Standard Video with Associated Audio Subcarriers. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 64 KBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260366A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260366A1.txt  
- Independence 07/28/2005 06565.00000 42-26-59.7 N IA NE 091-51-50.0 W 0002257583 Hawkeye Community College INDEPENDENCE 07/28/2005 06855.00000 42-29-23.0 N IA NE 092-19-21.0 W 0002257608 Hawkeye Community College WATERLOO 07/28/2005 06695.00000 42-25-44.0 N IA NE 092-19-21.0 W 0002257654 Hawkeye Community College WATERLOO 07/28/2005 06665.00000 42-25-44.0 N IA NE 092-46-47.0 W 0002257670 Hawkeye Community College GRUNDY CENTER 07/28/2005 06825.00000 42-21-18.0 N WA NE 117-09-04.1 W 0002257680 First Step Internet LLC Pullman 07/28/2005 19440.00000 46-44-48.5 N IA NE 092-19-21.0 W 0002257686 Hawkeye Community College WATERLOO 07/28/2005 06645.00000 42-25-44.0 N IA NE 092-26-04.0 W 0002257712 Hawkeye Community College WAVERLY 07/28/2005 06805.00000 42-45-27.0 N IA NE 092-26-04.0 W 0002257724 Hawkeye Community College WAVERLY 07/28/2005 06855.00000 42-45-27.0 N IA NE 092-47-27.0 W 0002257734 Hawkeye Community College ALLISON 07/28/2005 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260437A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260437A1.txt  
- 471 4,182 11.3 157 1,593 9.9 New Jersey 1,148 26,906 4.3 1,228 9,191 13.4 New Mexico 73 2,827 2.6 162 1,655 9.8 New York 2,540 43,280 5.9 3,660 17,410 21.0 North Carolina 587 18,870 3.1 632 9,499 6.7 North Dakota 6 786 0.8 4 342 1.2 Northern Marianas 0 0 NM 0 0 NM Ohio 898 26,284 3.4 502 12,375 4.1 Oklahoma 254 7,900 3.2 267 3,693 7.2 Oregon 197 7,632 2.6 374 3,375 11.1 Pennsylvania 2,086 32,604 6.4 1,393 10,761 12.9 Puerto Rico 14 1,306 1.1 240 2,649 9.1 Rhode Island 116 3,294 3.5 115 963 11.9 South Carolina 194 7,918 2.5 284 4,537 6.3 South Dakota 3 480 0.6 2 236 0.8 Tennessee 423 11,902 3.6 329 5,965 5.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260472A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260472A1.txt  
- 08/05/2005 06795.00000 36-41-28.0 N OK NE 097-19-09.0 W 0002266643 USCOC OF OKLAHOMA RSA #10, INC.NOBLE COUNTY 08/05/2005 06585.00000 36-33-04.0 N AK NE 149-49-33.6 W 0002266783 Fixed Wireless Holdings, LLC Anchorage 08/05/2005 21925.00000 61-12-39.6 N AK NE 149-44-03.9 W 0002266786 Fixed Wireless Holdings, LLC Anchorage 08/05/2005 23125.00000 61-11-15.0 N AK NE 149-53-34.8 W 0002266788 Fixed Wireless Holdings, LLC Anchorage 08/05/2005 21825.00000 61-13-04.1 N AK NE 149-53-34.8 W 0002266788 Fixed Wireless Holdings, LLC Anchorage 08/05/2005 21975.00000 61-13-04.1 N AK NE 149-53-16.2 W 0002266790 Fixed Wireless Holdings, LLC Anchorage 08/05/2005 23175.00000 61-10-40.2 N Page 11 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK NE 149-30-53.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260511A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260511A1.pdf  
- issues are in Final Closure: INC Issues 466: Update Central Office Code Administration Guidelines (COCAG) Appendix C for Code Holder Change in NPAC INC Issue 456: Jeopardy Declaration as a Result of Large Request for NXX Codes INC Issue 470: Revisiting Old Relief Plans INC Issue 467: Designation in COCAG Section 4.6 of 811 INC Issue 471: Edits to COCAG 4.1.4.1, 4.1.4, and TBPAG 8.2 INC Issue 437: document INC Procedural Agreements Reached. F. Billing and Collection Agent (B & C Agent) Report. Faith Marcotte, Welch and Company LLP, provided the report to the NANC. Ms. Marcotte reported that the B&C Agent filed the Contribution Factor Report with the FCC in early May 2005. She indicated that invoices will be sent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260567A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260567A1.txt  
- Boise City 08/09/2005 23075.00000 43-35-24.6 N AK NE 149-49-33.6 W 0002271406 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 19440.00000 61-12-39.6 N AK NE 149-49-33.6 W 0002271406 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 21925.00000 61-12-39.6 N AK NE 149-44-03.9 W 0002271408 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 23125.00000 61-11-15.0 N AK NE 149-53-34.8 W 0002271409 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 21825.00000 61-13-04.1 N AK NE 149-53-34.8 W 0002271409 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 21975.00000 61-13-04.1 N AK NE 149-48-19.0 W 0002271411 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 23025.00000 61-13-23.0 N AK NE 149-53-16.2 W 0002271412 Fixed Wireless Holdings, LLC Anchorage 08/09/2005 23175.00000 61-10-40.2 N AK NE 149-30-53.0 W 0002271415 Fixed Wireless Holdings, LLC Eagle River 08/09/2005 17880.00000 61-20-10.0 N CA NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260689A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260689A1.txt  
- 0002283662 FIBERTOWER CORPORATION NEWARK 08/18/2005 19440.00000 40-54-28.7 N NJ NE 074-13-12.1 W 0002283662 FIBERTOWER CORPORATION NEWARK 08/18/2005 19540.00000 40-54-28.7 N NJ NE 074-17-41.4 W 0002283663 FIBERTOWER CORPORATION NEWARK 08/18/2005 19320.00000 40-27-18.8 N NJ NE 074-17-58.4 W 0002283665 FIBERTOWER CORPORATION Port Reading 08/18/2005 19380.00000 40-32-20.7 N NJ NE 074-17-58.4 W 0002283665 FIBERTOWER CORPORATION Port Reading 08/18/2005 19540.00000 40-32-20.7 N MT NE 112-32-04.1 W 0002284024 International Communications Group, Inc. Butte 08/19/2005 11225.00000 46-00-49.9 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MT NE 112-32-04.1 W 0002284024 International Communications Group, Inc. Butte 08/19/2005 11385.00000 46-00-49.9 N NY NE 073-52-59.9 W 0002284076 FIBERTOWER CORPORATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260792A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260792A1.txt  
- earth station, change emission designator and related service, increase EIRP and EIRP density, replace antenna, change frequencies, to be used for transmission of BPSK, QPSK, QAM, FEC rates 1/2 - 7/8, various data rates from 64 kbps, various data rates to 45 Mbps, various information, and Standard Video with Associated Audio Subcarriers. SITE ID: 1 VARIOUS LOCATION: COMTECH "18FT" 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W Page 8 of 29 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 64 KBPS, VARIOUS INFORMATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260793A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260793A1.txt  
- 33-30-00.1 N VA AM 078-28-53.8 W 0002215570 CLEAR CHANNEL BROADCASTING LICCHARLOTTESVILLE 08/22/2005 00949.50000 38-04-03.2 N NY AM WBE796 075-59-42.6 W 0002285882 CLEAR CHANNEL BROADCASTING LICVESTAL 08/24/2005 00949.50000 42-06-06.4 N NY MD WBE796 075-59-42.6 W 0002285882 CLEAR CHANNEL BROADCASTING LICEndwell 08/22/2005 00949.50000 45-06-06.4 N NE MD WLG887 100-45-40.5 W 0002285886 TRI-STATE BROADCASTING ASSOCIATNORTH PLATTE 08/22/2005 00947.00000 41-07-55.9 N TX MD WHS602 098-32-04.1 W 0002285941 CCB TEXAS LICENSES, L.P. SAN ANTONIO 08/22/2005 00950.00000 29-28-46.8 N MI MD WAB319 087-28-37.5 W 0002286989 TACONITE BROADCASTING, INC. Marquette 08/23/2005 00949.00000 46-30-51.8 N CA MD WBE788 118-21-07.6 W 0002287276 INFINITY BROADCASTING EAST INC. LOS ANGELES 08/23/2005 00947.37500 34-03-43.3 N MI MD WLL421 085-53-45.0 W 0002288718 BOARD OF CONTROL, GRAND VALLEYALLENDALE 08/24/2005 00948.50000 42-57-35.0 N IN MD WHN340 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260887A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-260887A1.txt  
- LYON, COREY M 08/24/2005 00809.00000 - 00824.00000 NV AM WPHQ491 116-10-04.3 W 0002249173 LYON, COREY M CARLIN 08/24/2005 00856.51250 40-43-19.7 N AM WPHR491 A 0002249174 LYON, COREY M 08/24/2005 00809.00000 - 00824.00000 NV AM WPHR491 115-37-48.2 W 0002249174 LYON, COREY M ELKO 08/24/2005 00857.01250 40-53-39.7 N AM WPHS772 A 0002249175 LYON, COREY M 08/24/2005 00809.00000 - 00824.00000 NV AM WPHS772 114-34-04.1 W 0002249175 LYON, COREY M WELLS 08/24/2005 00858.51250 41-07-18.7 N AM WPHR294 A 0002249182 LYON, COREY M 08/24/2005 00809.00000 - 00824.00000 NV AM WPHR294 117-45-43.5 W 0002249182 LYON, COREY M WINNEMUCCA 08/24/2005 00857.01250 41-03-07.6 N AM WPHS588 A 0002249185 LYON, COREY M 08/24/2005 00809.00000 - 00824.00000 NV AM WPHS588 117-11-09.3 W 0002249185 LYON, COREY M TONOPAH 08/24/2005 00858.01250 38-06-23.8 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261024A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261024A2.txt  
- Total International Total Toll Facilities- Based, Facilities- Pure Telephone Record TelexTelegraphOther End Carrier's End Carrier's End Carrier's Resale, and Resale User Carrier & User Carrier & UserCarrier & ISR 3/ 3/ 4/ End User 4/ End User 4/ End User 4/ 1950 $9.0 $0.2 $1.1 $39.3 $49.5 $49.5 $1,245 4.0 % 1951 12.1 0.3 1.9 $0.2 42.6 54.9 57.2 1,403 4.1 1952 15.4 0.3 2.8 0.4 41.3 57.2 60.3 1,535 3.9 1953 13.1 0.3 3.7 0.7 42.5 56.2 60.2 1,642 3.7 1954 13.7 0.2 4.3 0.8 45.0 59.5 64.0 1,796 3.6 1955 15.7 0.2 4.8 1.2 46.6 63.6 68.6 2,049 3.3 1956 18.7 0.3 5.3 1.9 49.8 70.4 76.0 2,277 3.3 1957 22.7 0.6 6.0 2.8 50.3 75.8 82.4 2,525 3.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261169A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261169A1.txt  
- NC NE 077-53-56.6 W 0002310355 Conterra LLC Whitaker 09/13/2005 17960.00000 36-06-28.4 N NC NE 078-12-44.9 W 0002311012 Conterra LLC Middlesex 09/13/2005 11405.00000 35-47-12.2 N NC NE 078-06-58.2 W 0002311545 Conterra LLC Bailey 09/13/2005 11365.00000 35-46-55.8 N NC NE 078-05-24.8 W 0002313204 Conterra LLC Spring Hope 09/14/2005 22475.00000 35-52-33.2 N NC NE 077-56-54.6 W 0002313226 Conterra LLC Elm City 09/14/2005 10915.00000 35-53-04.1 N NC NE 078-05-23.3 W 0002314775 Conterra LLC BAILEY 09/14/2005 10715.00000 35-51-12.1 N NC NE 078-05-23.3 W 0002314775 Conterra LLC BAILEY 09/14/2005 10875.00000 35-51-12.1 N NC NE 078-05-23.3 W 0002314775 Conterra LLC BAILEY 09/14/2005 10915.00000 35-51-12.1 N NC NE 078-05-23.3 W 0002314775 Conterra LLC BAILEY 09/14/2005 21275.00000 35-51-12.1 N NC NE 077-57-29.0 W 0002314839 Conterra LLC Nashville 09/14/2005 22475.00000 35-57-24.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261303A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261303A1.txt  
- 17-58-57.9 N CA MD WMQ711 118-08-23.2 W 0002326516 Los Angeles SMSA Limited Partnership DOWNEY 09/23/2005 10617.50000 33-56-35.0 N NM MD WPUZ611 107-57-24.4 W 0002326605 CNG COMMUNICATIONS, INC. AZTEC 09/23/2005 17825.00000 36-51-19.0 N NM MD WPUZ611 107-57-24.4 W 0002326605 CNG COMMUNICATIONS, INC. AZTEC 09/23/2005 17845.00000 36-51-19.0 N CA MD WMQ712 118-11-22.3 W 0002326627 Los Angeles SMSA Limited Partnership COMPTON 09/23/2005 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0002326627 Los Angeles SMSA Limited Partnership COMPTON 09/23/2005 10578.75000 33-53-04.1 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPQP216 118-08-05.3 W 0002326663 Los Angeles SMSA Limited Partnership LONG BEACH 09/23/2005 10643.75000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261488A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261488A1.txt  
- WPJD396 117-56-47.2 W 0002329632 Los Angeles SMSA Limited Partnership ANAHEIM 09/27/2005 19360.00000 33-50-16.1 N CA MD WPJD396 117-56-47.2 W 0002329632 Los Angeles SMSA Limited Partnership ANAHEIM 09/27/2005 19630.00000 33-50-16.1 N CA MD WLK729 118-00-16.0 W 0002329713 Los Angeles SMSA Limited Partnershp ANAHEIM 09/27/2005 17800.00000 33-49-38.0 N CA MD WMS761 117-56-47.2 W 0002329930 Los Angeles SMSA Limited Partnership FULLERTON 09/27/2005 18070.00000 33-51-04.1 N OR MD WMM852 121-01-56.0 W 0002329946 OREGON RSA NO. 2 LIMITED PARTNERTHE DALLES 09/27/2005 05945.20000 45-38-18.0 N OR MD WMM852 121-01-56.0 W 0002329946 OREGON RSA NO. 2 LIMITED PARTNERTHE DALLES 09/27/2005 06645.00000 45-38-18.0 N OR MD WMM852 121-01-56.0 W 0002329946 OREGON RSA NO. 2 LIMITED PARTNERTHE DALLES 09/27/2005 06725.00000 45-38-18.0 N OR MD WMM852 121-01-56.0 W 0002329946 OREGON RSA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261555A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261555A1.txt  
- SMR (SMR, Site-specific) State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD WPHN367 X 0002340609 BOYAR, ADAM 10/06/2005 00809.00000 - 00824.00000 HI MD WPHN367 156-51-50.9 W 0002340609 BOYAR, ADAM LANAI CITY 10/06/2005 00857.51250 20-48-11.6 N MD WPHK871 A 0002340626 SOBOTA, CAROLYN L:SOBOTA, ROBIN 10/06/2005 00809.00000 - 00824.00000 NV MD WPHK871 114-34-04.1 W 0002340626 SOBOTA, CAROLYN L:SOBOTA, ROBINWELLS 10/06/2005 00860.18750 41-07-18.7 N GR - SMR, 896-901/935-940 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPIH493 0002336575 X.W., LLC. 10/03/2005 GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261665A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261665A1.txt  
- 105-01-53.3 W 0002347992 FIBERTOWER CORPORATION DENVER 10/14/2005 21970.00000 39-42-41.4 N CO MD WQBR927 105-01-34.3 W 0002347994 FIBERTOWER CORPORATION DENVER 10/14/2005 19560.00000 39-41-34.9 N CO MD WQBR927 105-01-34.3 W 0002347994 FIBERTOWER CORPORATION DENVER 10/14/2005 21870.00000 39-41-34.9 N CO MD WQBR927 105-01-34.3 W 0002347994 FIBERTOWER CORPORATION DENVER 10/14/2005 21920.00000 39-41-34.9 N CO MD WQBR762 104-57-44.2 W 0002347998 FIBERTOWER CORPORATION DENVER 10/14/2005 23120.00000 39-41-04.1 N CO MD WQBR762 104-57-44.2 W 0002347998 FIBERTOWER CORPORATION DENVER 10/14/2005 23125.00000 39-41-04.1 N CO MD WQBR762 104-57-44.2 W 0002347998 FIBERTOWER CORPORATION DENVER 10/14/2005 23170.00000 39-41-04.1 N AZ MD KPY74 111-36-18.6 W 0002348271 CNG Communications, Inc. FLAGSTAFF 10/14/2005 03790.00000 35-14-39.0 N AZ MD KPY74 111-36-18.6 W 0002348271 CNG Communications, Inc. FLAGSTAFF 10/14/2005 03970.00000 35-14-39.0 N AZ MD KPY74 111-36-18.6 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261822A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-261822A1.txt  
- COMMUNITY CONSOLIDATPLAINFIELD 10/18/2005 17980.00000 41-36-03.5 N MD NE 077-22-28.9 W 0002351160 State of Maryland, SHA Frederick 10/18/2005 06685.00000 39-24-24.3 N MD NE 077-24-31.1 W 0002351203 State of Maryland, SHA Frederick 10/18/2005 06845.00000 39-22-23.4 N NJ NE 075-09-13.1 W 0002351682 Woodbury Public School District Woodbury 10/18/2005 23325.00000 39-50-23.7 N NJ NE 075-09-42.9 W 0002351702 Woodbury Public School District Woodbury 10/18/2005 22125.00000 39-50-04.1 N NJ NE 075-09-14.0 W 0002351705 Woodbury Public School District Woodbury 10/18/2005 23225.00000 39-50-22.3 N Page 32 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NJ NE 075-09-32.7 W 0002351854 Woodbury Public School District Woodbury 10/19/2005 22025.00000 39-50-19.6 N NJ NE 075-09-12.2 W 0002351909 Woodbury 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262084A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262084A1.txt  
- 94.7 0.6 New Mexico 85.3 91.9 6.6 * New York 90.8 92.7 1.9 * North Carolina 89.3 93.8 4.5 * North Dakota 95.1 97.5 2.4 * Ohio 92.2 95.0 2.8 * Oklahoma 91.5 89.1 -2.4 Oregon 91.2 96.3 5.1 * Pennsylvania 95.1 96.7 1.6 * Rhode Island 93.3 95.7 2.4 South Carolina 81.8 94.8 13.0 * South Dakota 92.7 96.8 4.1 * Tennessee 87.6 93.8 6.2 * Texas 89.0 92.2 3.2 * Utah 90.3 96.8 6.5 * Vermont 92.7 95.6 2.9 Virginia 93.1 93.2 0.1 Washington 92.5 97.3 4.8 * West Virginia 88.1 93.3 5.2 * Wisconsin 94.8 95.1 0.3 Wyoming 89.7 96.2 6.5 * Total United States 91.4 94.0 2.6 * * Increase is statistically significant at the 95% confidence 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262086A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262086A1.txt  
- Year Ending December 31, 2003. . . . . . . . . . 109 Table 3.3 -2003 U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . .111 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . . . . . . 115 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2004. . . . . . . . . . . . . . . . . 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262143A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262143A1.txt  
- MHz 54K6G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 6M84G7W Page 9 of 19 54.50 dBW 5925.0000 - 6425.0000 MHz 81K9G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 11M2G7W 55.70 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 35M9G7W 66.40 dBW 5925.0000 - 6425.0000 MHz 618KG7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 20M3G7W 3700.0000 - 4200.0000 MHz ANDREW 4.1M 4.1 meters ANTENNA ID: "18 FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 18M0F8F- 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 72.40 dBW 5925.0000 - 6425.0000 MHz 9M00G1F 72.40 dBW 5925.0000 - 6425.0000 MHz 24M0G7F 56.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 53.50 dBW 5925.0000 - 6425.0000 MHz 38K4G7E 54.50 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 72.40 dBW 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262210A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262210A1.txt  
- MD WLC202 096-32-27.0 W 0002373220 UNITED STATES CELLULAR TELEPHONDEPEW 11/07/2005 05935.32000 35-47-01.0 N OK MD WLC202 096-32-27.0 W 0002373220 UNITED STATES CELLULAR TELEPHONDEPEW 11/07/2005 06755.00000 35-47-01.0 N CA MD WLW366 122-20-04.9 W 0002373518 SACRAMENTO VALLEY LIMITED PARTNSITES 11/07/2005 06845.00000 39-17-15.5 N TX MD WLC215 095-37-08.8 W 0002373543 GTE MOBILNET OF SOUTH TEXAS LIMITOMBALL 11/07/2005 06375.14000 30-07-09.8 N WA MD WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 11/07/2005 02121.60000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 11/07/2005 06421.25000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 11/07/2005 06855.62500 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 11/07/2005 10563.75000 46-48-55.4 N CA MD WMQ891 121-42-27.8 W 0002373721 SACRAMENTO VALLEY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262330A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262330A1.txt  
- in Tables 1(d) and1(e) are straightforward and reflect the data in the format filed. Complete data descriptions are available in several Commission orders.18 4. Qualifications Overall, we caution readers to be aware of potential inconsistencies in the service quality data and methodological shortcomings affecting both the collection and interpretation of the data. Some common sources of issues are described below. 4.1 Data Re-filings Commission staff generally screen company-filed service quality data for irregularities and provide feedback to reporting companies on suspected problems. The reporting companies are then 17 Calculations to normalize data and derive percentages in charts 1, 2A, 2B and 8 in this year's report were performed directly on company provided composite data rather than from recalculated composites in the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262351A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262351A1.txt  
- DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS FEC, VARIOUS MODULATION, VARIOUS COMBINATIONS OF INFORMATION 11700.0000 - 12200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E050339 SES-LIC-20051115-01581E Class of Station: Temporary Fixed Earth Station Application for Authority VISION ACCOMPLISHED, INC. D/B/A TRANSVISION INTERNATIONAL Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH "OFFSAT" 1 4.1 meters ANTENNA ID: "18FT." 5.5M. 72.40 dBW ANALOG AND DIGITAL VIDEO. 5925.0000 - 6425.0000 MHz 36M0F9F Points of Communication: 1 - ALSAT - (ALSAT) E050340 SES-LIC-20051116-01582E Class of Station: Fixed Earth Stations Application for Authority DIRECTV Enterprises, LLC Page 5 of 16 Nature of Service:Direct Broadcast Satellite Service 39 ° 33 ' 36.00 " N LAT. SITE ID: CRDUF D1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262368A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262368A1.txt  
- " N LAT. SITE ID: 1 200 TELEGRAPH HILL ROAD, MONMOUTH, HOLMDEL, NJ 74 ° 10 ' 26.00 " W LONG. LOCATION: SCIENTIFIC ATLANTA 1 11 meters ANTENNA ID: 8840-A 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W Page 10 of 18 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMTECH 2 4.1 meters ANTENNA ID: 18 FT. "OFFSAT" 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMSAT/RSI 3 11.3 meters ANTENNA ID: 110 OCS 83.95 dBW QPSK DIGITAL, VOICE & DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK DIGITAL, VOICE & DATA SERVICES 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262498A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262498A1.txt  
- 097-52-53.9 W 0002387066 SOUTH TEXAS ELECTRIC COOPERATIVE INC ORANGE GROVE 11/21/2005 06815.00000 27-54-15.0 N TX MD WNTL481 097-44-27.9 W 0002387142 SOUTH TEXAS ELECTRIC COOPERATIVE INC DRISCOLL 11/21/2005 06555.00000 27-37-35.1 N TX MD WNTL481 097-44-27.9 W 0002387142 SOUTH TEXAS ELECTRIC COOPERATIVE INC DRISCOLL 11/21/2005 06655.00000 27-37-35.1 N TX MD WNTT351 097-48-36.9 W 0002387199 SOUTH TEXAS ELECTRIC COOPERATIVE INC RIVIERA 11/21/2005 06725.00000 27-19-04.1 N TX MD WPTF413 097-21-48.9 W 0002387218 SOUTH TEXAS ELECTRIC COOPERATIVE INC GOLIAD 11/21/2005 06725.00000 28-37-58.9 N HI MD WPYT761 156-14-40.9 W 0002388000 MAUI ELECTRIC COMPANY LTD KAHULUI 11/21/2005 06805.00000 20-46-21.5 N OK MD WNTB200 098-58-03.3 W 0002388032 PUBLIC SERVICE COMPANY OF OKLAHOMA CLINTON 11/21/2005 06690.00000 35-30-46.1 N IA MD WNEI329 095-19-00.9 W 0002388344 NORTHWEST IOWA POWER COOPERATIVE HARLAN 11/22/2005 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262551A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262551A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262551A2.txt  
- FCC's designee, without charge. System and Equipment Inventory Inventory data (hardware model, serial numbers and descriptions) on equipment shall be reported as part of the contractor's annual reporting requirements, as well as any upgrades or replacements, including the license numbers of any Commercial Off-the-Shelf (COTS) software. Reserved Contract Data Requirements List (CDRL) All CDRLs shall be approved by the FCC. 4.1 Reserved Security Plan The contractor shall furnish a Security Plan within 45 calendar days of contract award per Sections 3.1, 3.7, and 3.16.1. System Documentation Plan The contractor shall furnish a System Documentation Plan within 60 calendar days of contract award per Section 3.19. Disaster/Continuity of Operations Plan The contractor shall furnish a Disaster/Continuity of Operations Plan within 60 calendar 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262590A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262590A1.txt  
- 073-59-09.0 W 0002392884 RSK World, Inc. NEW YORK CITY 11/29/2005 00855.58750 40-44-54.0 N NY MD WNIA635 073-59-09.0 W 0002392884 RSK World, Inc. NEW YORK CITY 11/29/2005 00860.01250 40-44-54.0 N NY MD WNIA635 073-59-09.0 W 0002392884 RSK World, Inc. NEW YORK CITY 11/29/2005 00860.58750 40-44-54.0 N MD WPHK871 A 0002398231 SOBOTA, CAROLYN L:SOBOTA, ROBIN 12/02/2005 00806.00000 - 00821.00000 NV MD WPHK871 114-34-04.1 W 0002398231 SOBOTA, CAROLYN L:SOBOTA, ROBINWELLS 12/02/2005 00851.43750 41-07-18.7 N MD WNLM301 A 0002398578 Nextel License Holdings 4, Inc 12/02/2005 00806.00000 - 00821.00000 UT MD WNLM301 112-12-07.8 W 0002398578 Nextel License Holdings 4, Inc GARFIELD 12/02/2005 00855.43750 40-43-01.8 N GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262700A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262700A1.txt  
- Points of Communication: 1 - ALSAT - (ALSAT) 1 - TELSTAR 12 - (15 W.L.) E030046 SES-MOD-20051205-01682E Class of Station: Temporary Fixed Earth Station Application for Modification MOBILE SATELLITE CONNECTION,LLC Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service, International Fixed Satellite Service Modification filed to increase EIRP and EIRP density, to replace the 2.4 meter Prodelin antenna with a 4.1 meter Comtech RSI antennas and to add ALSAT as a point of communication. 0 ° 0 ' 0.00 " N LAT. SITE ID: 1 CONUS U.S. and it's territories 0 ° 0 ' 0.00 " W LONG. LOCATION: Comtech RSI 1 4.1 meters ANTENNA ID: Offsat 65.50 dBW Compressed Digital Video, 45 Mbps, 3/4 FEC. Emission range: 4M00G7F -36M0G7F 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262837A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262837A1.txt  
- Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO AM WQBR963 104-51-49.9 W 0002290324 FIBERTOWER CORPORATION AURORA 12/13/2005 23120.00000 39-42-57.0 N CO AM WQBR963 104-51-49.9 W 0002290324 FIBERTOWER CORPORATION AURORA 12/13/2005 23170.00000 39-42-57.0 N CO AM 104-52-26.0 W 0002290506 FIBERTOWER CORPORATION Denver 12/13/2005 21920.00000 39-42-28.0 N NC AM 077-56-54.6 W 0002313226 Conterra LLC Elm City 12/16/2005 10915.00000 35-53-04.1 N NC AM WMG765 082-33-07.5 W 0002323400 North Carolina RSA #4, Inc. MARS HILL 12/16/2005 06595.00000 35-49-15.4 N NC AM WMG765 082-33-07.5 W 0002323400 North Carolina RSA #4, Inc. MARS HILL 12/16/2005 06705.00000 35-49-15.4 N NC AM WMG765 082-33-07.5 W 0002323400 North Carolina RSA #4, Inc. MARS HILL 12/16/2005 10552.50000 35-49-15.4 N NC AM WMG765 082-33-07.5 W 0002323400 North Carolina 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262933A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262933A1.txt  
- Voice & Video 48.38 kbps 3700.0000 - 4200.0000 MHz 36M0G7W QPSK, FEC 1/2 FEC, Data, Voice & Video 256 kbps 3700.0000 - 4200.0000 MHz 360KG7W Points of Communication: E050339 SES-LIC-20051220-01776E Class of Station: Temporary Fixed Earth Station Application for Authority Vision Accomplished, Inc. d/b/a Transvision International Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Prim Comtech 1 4.1 meters ANTENNA ID: OFFSAT ("18FT") 70.20 dBW ANALOG AND DIGITAL 5925.0000 - 6425.0000 MHz 36M0F9F Points of Communication: 1 - ALSAT - (ALSAT) E020074 SES-MFS-20051202-01665E Class of Station: Mobile Earth Station Modification Satamatics, Inc. Nature of Service:Mobile Satellite Service Modification filed to add the new Inmarsat 4F2 satellite at 52.75 W as a point of communication using L-band frequencies in 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262963A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262963A1.txt  
- Name Latitude City UT NE S 0002419282 CREEK BROADCASTING CORPORATIO 12/21/2005 00450.15000 UT NE S 0002419282 CREEK BROADCASTING CORPORATIO 12/21/2005 00455.15000 CA NE P 116-46-11.9 W 0002419291 EAST COUNTY BROADCASTING, INC.Alpine 12/21/2005 00455.23750 32-50-08.4 N TI - TV Intercity Relay State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City SC AM WGX288 079-00-04.1 W 0002195411 GRAND STRAND COMMUNICATIONS CONWAY 12/19/2005 06975.00000 - 07000.00000 33-47-59.6 N SC AM 079-50-16.0 W 0002195461 GRAND STRAND COMMUNICATIONS FLORENCE 12/20/2005 07075.00000 - 07100.00000 34-09-51.0 N SC AM 079-50-16.0 W 0002195461 GRAND STRAND COMMUNICATIONS FLORENCE 12/20/2005 07075.00000 - 07100.00000 34-09-51.0 N TN MD WGR753 087-08-09.0 W 0002416147 HUNTSVILLE TV, L.L.C. MINOR HILL 12/19/2005 07100.00000 - 07125.00000 35-00-09.0 N CO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A1.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A11.txt  
- 3.2 14.8 23.0 18.3 3.6 3.1 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 97.4 95.9 99.8 95.1 97.6 98.4 96.5 98.2 Residence 97.7 96.0 99.9 95.3 98.1 98.4 96.8 98.2 Business 94.3 95.5 99.5 94.3 95.2 97.4 94.5 98.1 Average Installation Interval (days) 1.8 1.9 2.2 4.0 5.3 2.1 1.8 1.6 Residence 1.6 1.6 1.7 4.1 5.2 2.0 1.7 1.6 Business 3.0 1.7 4.7 3.7 6.4 3.4 2.7 1.6 Average Out of Service Repair Interval (hours) 15.1 15.2 26.7 16.9 22.0 10.8 22.2 17.1 Residence 15.4 18.4 28.2 16.7 22.3 11.1 22.5 17.3 Business 13.6 13.8 16.2 17.8 19.8 8.6 20.1 15.4 Initial Trouble Reports per Thousand Lines 193.1 230.5 113.6 296.0 257.2 157.2 216.1 422.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A2.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A6.txt  
- of Funding Year 2003 funds.6 As of the same date, USAC had committed over $2.0 billion, and disbursed over $254 million of Funding Year 2004 funds. 7 USAC supplies the Commission with funding commitments and disbursements information for the Schools and Libraries mechanism for all active funding years. USAC provided the Commission with data as of June 6, 2005. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A8.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A8.txt  
- 3.8% * Alaska 86.5 95.6 9.1 * Arizona 86.9 91.8 4.9 * Arkansas 86.6 88.6 2.0 California 92.5 96.0 3.5 * Colorado 93.2 95.8 2.6 * Connecticut 95.5 95.5 0.0 Delaware 94.3 96.0 1.8 * District of Columbia 94.9 91.9 -3.0 # Florida 88.7 93.4 4.7 * Georgia 86.2 91.2 5.0 * Hawaii 93.5 95.4 1.8 * Idaho 90.7 94.8 4.1 * Illinois 94.2 90.1 -4.1 # Indiana 91.6 91.8 0.3 Iowa 96.2 95.4 -0.8 Kansas 94.3 94.8 0.4 Kentucky 88.1 91.4 3.3 * Louisiana 89.7 90.9 1.3 Maine 93.4 96.6 3.2 * Maryland 95.7 93.4 -2.3 # Massachusetts 95.9 96.4 0.5 Michigan 92.8 93.7 0.9 Minnesota 95.8 97.1 1.3 Mississippi 82.4 89.6 7.2 * Missouri 91.5 93.7 2.2 * Montana 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A9.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-262986A9.txt  
- 1999 2004 CPI All Items CPI Telephone Services 7 - 6 1978 7.3% 9.0% 0.9% 1979 8.7 13.3 0.7 1980 9.7 12.5 4.6 1981 8.3 8.9 11.7 1982 5.2 3.8 7.2 1983 3.4 3.8 3.6 1984 3.6 3.9 9.2 1985 2.8 3.8 4.7 1986 2.3 1.1 2.7 1987 2.9 4.4 -1.3 1988 3.7 4.4 1.3 1989 3.5 4.6 -0.3 1990 4.1 6.1 -0.4 1991 3.1 3.1 3.5 1992 2.1 2.9 -0.3 1993 2.3 2.7 1.8 1994 2.2 2.7 0.7 1995 2.0 2.5 1.2 1996 1.9 3.3 2.1 1997 1.5 1.7 0.2 1998 1.1 1.6 0.3* 1999 1.5 2.7 0.4 2000 2.3 3.4 -2.3 2001 2.5 1.6 1.3 2002 1.5 2.4 0.2 2003 1.7 1.9 -2.7 2004 2.4 3.3 -2.5 * The 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263226A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263226A1.txt  
- Fixed Earth Station Grant of Authority 05/21/2003 - 05/21/2018 Application for Modification MOBILE SATELLITE CONNECTION,LLC Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service, International Fixed Satellite Service Page 16 of 26 0 ° 0 ' 0.00 " N LAT. SITE ID: 1 CONUS U.S. and it's territories 0 ° 0 ' 0.00 " W LONG. LOCATION: Comtech RSI 1 4.1 meters ANTENNA ID: Offsat 65.50 dBW Compressed Digital Video, 45 Mbps, 3/4 FEC. Emission range: 4M00G7F -36M0G7F 5925.0000 - 6425.0000 MHz 36M0G7F 61.50 dBW Compressed Digital Video, 5000 kbps, 3/4 FEC 5925.0000 - 6425.0000 MHz 4M00G7F - 65.50 dBW Standard video with associated audio subcarriers 5925.0000 - 6425.0000 MHz 36M0F3F Compressed Digital Video, 5000 kbps, 3/4 FEC 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263230A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263230A1.txt  
- Cellular Systems, Inc. Edna 01/11/2006 06197.24000 28-57-49.6 N TX AM WMT241 096-38-35.2 W 0002368367 Dobson Cellular Systems, Inc. Edna 01/11/2006 06197.24000 28-57-49.6 N AL AM WLK814 086-12-23.0 W 0002370884 Verizon Wireless of the East LP Montgomery 01/12/2006 06765.00000 32-22-27.0 N AL AM WLK814 086-12-23.0 W 0002370884 Verizon Wireless of the East LP Montgomery 01/12/2006 06765.00000 32-22-27.0 N WA AM WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERSHIP BEVERLY 01/11/2006 06345.49000 46-48-55.4 N WA AM WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERSHIP BEVERLY 01/11/2006 06421.25000 46-48-55.4 N WA AM WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERSHIP BEVERLY 01/11/2006 06855.62500 46-48-55.4 N WA AM WPJB542 119-53-04.1 W 0002373623 WESTERN SUB-RSA LIMITED PARTNERSHIP BEVERLY 01/11/2006 10563.75000 46-48-55.4 N DC AM 077-01-44.4 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263555A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263555A1.txt  
- City FL NE 081-15-30.0 W 0002460673 Flagler County Board of County CommissBUNNELL 01/26/2006 06616.25000 29-27-30.0 N FL NE 081-15-30.0 W 0002460673 Flagler County Board of County CommissBUNNELL 01/26/2006 06650.00000 29-27-30.0 N FL NE 081-14-42.0 W 0002460773 Flagler County Board of County CommissBunnel 01/26/2006 06810.00000 29-28-19.0 N FL NE 081-08-35.6 W 0002461003 Flagler County Board of County CommissFLAGLER BEACH 01/26/2006 06776.25000 29-28-04.1 N NH NE 072-22-59.3 W 0002461005 Southwestern New Hampshire District FireWestmoreland 01/26/2006 11688.12500 42-57-36.2 N NH NE 072-16-43.3 W 0002461006 Southwestern New Hampshire District FireKeene 01/26/2006 11188.12500 42-56-08.2 N NY NE 073-33-16.0 W 0002461728 Nassau County Government WESTBURY 01/26/2006 21985.00000 40-45-18.0 N NY NE 073-35-33.0 W 0002461729 Nassau County Government 1 EDUCATION DR 01/26/2006 23185.00000 40-43-42.0 N NH NE 072-16-43.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263565A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263565A1.txt  
- 54K6G7W- DIGITAL DATA 3700.0000 - 4200.0000 MHz 36M0G7W FREQUENCY MODULATED VIDEO 3700.0000 - 4200.0000 MHz 25M0F3F- FREQUENCY MODULATED VIDEO 3700.0000 - 4200.0000 MHz 36M0F3F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 7M70G7F- COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 16M0G7F 3625.0000 - 4200.0000 MHz 1M64G7W Page 40 of 48 3625.0000 - 4200.0000 MHz 45K0G7W- 3625.0000 - 4200.0000 MHz 5M40G7W COMTECH 4.1M 4.1 meters ANTENNA ID: 5.5 meter OFFSAT 54.60 dBW DIGITAL DATA 5925.0000 - 6425.0000 MHz 54K6G7W- 72.40 dBW DIGITAL DATA 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW FREQUENCY MODULATED VIDEO 5925.0000 - 6425.0000 MHz 25M0F3F- 72.40 dBW FREQUENCY MODULATED VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 7M70G7F- 72.40 dBW COMPRESSED DIGITAL VIDEO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263694A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263694A1.txt  
- 098-48-37.0 W 0002472129 TEXAS ELECTRONIC TRANSPORT COMLA COSTA 02/03/2006 06063.80000 29-18-48.0 N TX MD WPZL444 098-48-37.0 W 0002472129 TEXAS ELECTRONIC TRANSPORT COMLA COSTA 02/03/2006 06093.45000 29-18-48.0 N TX MD WPZL444 098-48-37.0 W 0002472129 TEXAS ELECTRONIC TRANSPORT COMLA COSTA 02/03/2006 06123.10000 29-18-48.0 N TX MD WPZL444 098-48-37.0 W 0002472129 TEXAS ELECTRONIC TRANSPORT COMLA COSTA 02/03/2006 06152.75000 29-18-48.0 N TX MD KLR38 099-16-04.1 W 0002472130 TEXAS ELECTRONIC TRANSPORT COMD HANIS 02/03/2006 05945.20000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0002472130 TEXAS ELECTRONIC TRANSPORT COMD HANIS 02/03/2006 05960.02500 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0002472130 TEXAS ELECTRONIC TRANSPORT COMD HANIS 02/03/2006 05974.85000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0002472130 TEXAS ELECTRONIC TRANSPORT COMD HANIS 02/03/2006 05989.67500 29-18-48.8 N TX MD KLR38 099-16-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263704A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263704A1.txt  
- Authority FROM: Current Licensee: GRANDE COMMUNICATIONS NETWORKS, INC. CLEARSOURCE, INC. Application for Consent to Assignment GRANDE COMMUNICATIONS NETWORKS, INC. E050339 SES-LIC-20051220-01776E Date Effective: 02/01/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 02/01/2006 - 02/01/2021 Application for Authority Vision Accomplished, Inc. d/b/a Transvision International Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Prim Comtech 1 4.1 meters ANTENNA ID: OFFSAT ("18FT") 70.20 dBW ANALOG AND DIGITAL 5925.0000 - 6425.0000 MHz 36M0F9F Points of Communication: 1 - ALSAT - (ALSAT) E050393 SES-REG-20051226-01797E Date Effective: 02/06/2006 Class of Station: Fixed Earth Stations Grant of Authority 12/26/2005 - 12/26/2020 Registration KHBS HEARST-ARGYLE TELEVISION, INC. Page 1 of 7 Nature of Service:Domestic Fixed Satellite Service 35 ° 24 ' 7.40 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263808A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263808A1.txt  
- PA STANORTHWEST HAR 02/07/2006 00947.00000 42-07-36.4 N WA NE 120-16-29.3 W 0002477022 BUSTOS MEDIA OF EASTERN WASHINEAST WENATCHEE 02/09/2006 00946.00000 47-23-49.5 N WA NE 120-17-19.3 W 0002477072 BUSTOS MEDIA OF EASTERN WASHINWENATCHEE 02/09/2006 00944.50000 47-22-50.5 N CO NE 104-30-40.5 W 0002477279 PHILLIPS BROADCASTING COMPANY, TRINIDAD 02/09/2006 00949.00000 37-08-55.7 N CO NE 104-33-51.0 W 0002477281 PHILLIPS BROADCASTING COMPANY, TRINIDAD 02/09/2006 00947.00000 37-09-04.1 N CO NE 104-30-40.5 W 0002477289 PHILLIPS BROADCASTING, INC. TRINIDAD 02/09/2006 00944.50000 37-08-55.7 N CO NE 104-33-51.0 W 0002477308 PHILLIPS BROADCASTING, INC. TRINIDAD 02/09/2006 00951.00000 37-09-04.1 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO KNLS422 0002475516 ATLANTIC COMMUNICATION INC 02/08/2006 RO KNLS423 0002475527 ATLANTIC 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263818A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263818A1.txt  
- MODULATION, VARIOUS COMBINATIONS OF INFORMATION 14000.0000 - 14500.0000 MHz 36M0G7W STANDARD ANALOG VIDEO 11700.0000 - 12200.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) SES-LIC-INTR2006-00406E Date Effective: 02/10/2006 Class of Station: Temporary Fixed Earth Station Withdrawn Application for Authority RCN License Subsidiary, Inc. Nature of Service:Fixed Satellite Service SITE ID: N/A N/A N/A, N/A, N/A LOCATION: Comtech TF-1 4.1 meters ANTENNA ID: Offsat 54.27 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 51K2G7W 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates to 45Mbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.43 dBW Standard Video with Associated Audio Subcarriers. 5925.0000 - 6425.0000 MHz 36M0F3F Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263911A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-263911A1.txt  
- 40.30 dBW Digital Voice and Data 5925.0000 - 6425.0000 MHz 100KG7W 45.20 dBW Digital Voice and Data 5925.0000 - 6425.0000 MHz 195KG7W Points of Communication: 1 - ALSAT - (ALSAT) E060040 SES-LIC-20060214-00247E Class of Station: Temporary Fixed Earth Station Application for Authority RCN LICENSE SUBSIDIARY, INC. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 N/A, VARIOUS LOCATION: COMTECH TF-2 4.1 meters ANTENNA ID: OFFSAT 54.27 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64kbps, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45Mbps, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.43 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264075A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264075A1.txt  
- Rico SAN JUAN 12/05/2005 19455.00000 18-25-05.2 N OH NE 081-30-12.0 W 0002491161 FIBERTOWER CORPORATION EUCLID 02/21/2006 23070.00000 41-35-52.0 N OH NE 081-39-20.0 W 0002491162 FIBERTOWER CORPORATION CUYAHOGA HEIGH 02/21/2006 17760.00000 41-25-43.4 N CA NE 122-24-54.8 W 0002491776 WILINE NETWORKS SAN FRANCISCO 02/21/2006 21370.00000 37-44-35.7 N CA NE 122-24-54.8 W 0002491776 WILINE NETWORKS SAN FRANCISCO 02/21/2006 21520.00000 37-44-35.7 N CA NE 122-24-04.1 W 0002491777 WILINE NETWORKS SAN FRANCISCO 02/21/2006 21270.00000 37-47-24.0 N CA NE 122-24-04.1 W 0002491777 WILINE NETWORKS SAN FRANCISCO 02/21/2006 22720.00000 37-47-24.0 N CA NE 122-24-51.0 W 0002491778 WILINE NETWORKS INC. SAN FRANCISCO 02/21/2006 22470.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002491778 WILINE NETWORKS INC. SAN FRANCISCO 02/21/2006 22570.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002491778 WILINE NETWORKS INC. SAN 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264205A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264205A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AL MD WLE915 085-50-11.0 W 0002502910 WOODARD BROADCASTING CO. INC.Oxford 02/27/2006 00950.00000 33-36-30.0 N IL MD WGX299 088-21-45.0 W 0002504842 NM LICENSING LLC Crystal Lake 02/28/2006 00949.50000 42-15-34.0 N NY MD WPJE684 075-31-21.6 W 0002506932 DOUBLE O CENTRAL NEW YORK CORPNORWICH 03/01/2006 00947.50000 42-31-49.9 N PA MD WPJD240 079-22-04.1 W 0002507160 CLARION COUNTY BROADCASTING COCLARION 03/01/2006 00948.00000 41-11-34.2 N IA MD WLF211 092-24-30.7 W 0002511892 O-TOWN COMMUNICATIONS, INC. OTTUMWA 03/03/2006 00950.00000 41-00-52.0 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WLU202 117-17-17.2 W 0002445094 Los Angeles SMSA Limited 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264309A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264309A1.txt  
- $15,105,012 0.0 99.5 0.1 0.0 0.4 1,092,402,459 30.7 5.0 33.5 17.2 13.5 Germany $309,803,824 36.2 1.4 15.3 44.2 2.9 $23,081,780 54.2 0.7 14.2 24.2 6.8 $17,658,501 0.0 91.1 0.0 0.0 8.9 2,911,052,403 26.0 2.0 21.6 44.1 6.2 Gibraltar $307,317 58.7 1.7 17.9 19.5 2.2 $20,430 85.6 0.0 0.0 0.0 14.4 $14 0.0 0.0 0.0 0.0100.0 2,569,764 45.6 3.0 37.4 9.9 4.1 Greece $33,315,312 47.9 5.3 26.6 12.2 8.0 $2,367,838 30.3 0.6 28.8 4.8 35.6 $198,187 0.0 99.4 0.6 0.0 0.0 285,456,736 28.0 5.0 33.3 10.0 23.8 Greenland $124,930 12.4 0.9 14.6 67.8 4.3 $4,285 0.0 0.0 0.0 0.0100.0 $1 0.0 0.0 0.0 0.0100.0 408,590 23.4 0.3 27.7 42.5 6.1 Iceland $3,935,920 64.2 2.1 28.2 1.7 3.7 $437,789 44.1 0.0 24.7 24.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264456A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264456A1.txt  
- BROADCASTING, LLC STATE COLLEGE 03/14/2006 00945.37500 40-46-08.8 N SC NE 080-44-25.0 W 0002526504 COMMUNITY BROADCASTING CORP. OBeaufort 03/16/2006 00949.50000 32-23-55.0 N OH NE 083-47-12.7 W 0002526680 BLUE CHIP BROADCASTING LICENSESSpringfield 03/16/2006 00951.75000 39-57-55.2 N GA NE 084-52-47.0 W 0002526682 STYLES ALABAMA LICENSING, LLC Donalsonville 03/16/2006 00948.37500 31-04-27.0 N KS NE 097-07-36.4 W 0002530465 TAYLOR COMMUNICATIONS, INC. CLAY CENTER 03/17/2006 00949.00000 39-29-04.1 N KS NE 097-08-49.3 W 0002530491 CROSS COMMUNICATIONS, INC. CLAY CENTER 03/17/2006 00944.50000 39-22-52.9 N Page 3 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR NE 092-09-29.0 W 0002530728 ABG ARKANSAS, LLC Redfield 03/17/2006 00944.50000 34-29-12.0 N IA NE 091-32-18.6 W 0002530991 STUDENT BROADCASTERS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264457A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264457A1.txt  
- WLU203 117-03-01.1 W 0002522797 Los Angeles SMSA Limited Partnership BARSTOW 03/13/2006 10587.50000 34-51-19.9 N CA MD WLU203 117-03-01.1 W 0002522797 Los Angeles SMSA Limited Partnership BARSTOW 03/13/2006 11405.00000 34-51-19.9 N CA MD WMW750 117-02-02.1 W 0002522799 Los Angeles SMSA Limited Partnership BARSTOW 03/13/2006 10652.50000 34-54-03.9 N CA MD WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 03/13/2006 10577.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 03/13/2006 10592.50000 33-53-04.1 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WPXH205 118-06-22.4 W 0002522802 Los Angeles SMSA Limited Partnership CERRITOS 03/13/2006 10657.50000 33-52-29.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264545A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264545A1.txt  
- MHz 100KG7W 45.20 dBW Digital Voice and Data 5925.0000 - 6425.0000 MHz 195KG7W Points of Communication: 1 - ALSAT - (ALSAT) E060040 SES-LIC-20060214-00247E Date Effective: 03/23/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/23/2006 - 03/23/2021 Application for Authority RCN LICENSE SUBSIDIARY, INC. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 N/A, VARIOUS LOCATION: COMTECH TF-2 4.1 meters ANTENNA ID: OFFSAT 54.27 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64kbps, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W Page 3 of 28 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45Mbps, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.43 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264548A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264548A1.txt  
- Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 122-24-51.0 W 0002541504 WILINE NETWORKS INC SAN FRANCISCO 03/22/2006 22470.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002541504 WILINE NETWORKS INC SAN FRANCISCO 03/22/2006 22570.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002541504 WILINE NETWORKS INC SAN FRANCISCO 03/22/2006 22720.00000 37-47-36.0 N CA NE 122-24-04.1 W 0002541505 WINLINE NETWORKS INC San Francisco 03/22/2006 21270.00000 37-47-23.7 N CA NE 122-24-04.1 W 0002541505 WINLINE NETWORKS INC San Francisco 03/22/2006 22720.00000 37-47-23.7 N CA NE 122-24-54.8 W 0002541506 WILINE NETWORKS INC SAN FRANCISCO 03/22/2006 21370.00000 37-44-35.7 N CA NE 122-24-54.8 W 0002541506 WILINE NETWORKS INC SAN FRANCISCO 03/22/2006 21520.00000 37-44-35.7 N OH NE 081-31-51.7 W 0002541809 FIBERTOWER CORPORATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264554A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264554A1.txt  
- WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 456.70000000 -- -- 2 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 457.80000000 -- -- 2 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 457.85000000 -- -- 2 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 467.12500000 -- -- 2 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 451.46250000 GRAND RAPID 42-58-17.1 N MI 85-40-4.1 W 3 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 451.56250000 GRAND RAPID 42-58-17.1 N MI 85-40-4.1 W 3 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 456.46250000 GRAND RAPID 42-58-17.1 N MI 85-40-4.1 W 3 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC SCHOOL 456.56250000 GRAND RAPID 42-58-17.1 N MI 85-40-4.1 W 3 1 02/17/2006 WPNX552 MOC GRAND RAPIDS PUBLIC 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264774A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264774A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264774A1.txt  
- to the smallest papers. Some of the largest companies with the most storied histories, such as the Chicago Tribune and the New York Times, saw their stock price fall over thirty percent. Perhaps most troubling, these results have led to cuts in papers' newsgathering operations. For instance, the number of people working in the newsrooms of U.S. daily newspapers dropped 4.1 percent between 2001 and 2005. In 2005 alone, newspapers announced layoffs and buyouts of over 700 news people. Most of these cuts occurred at large metropolitan papers and more are expected this year. Since 1996, the Commission has repeatedly recognized that the news business was changing and that the new media landscape warranted a revision of the cross-ownership rule. In 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264785A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264785A1.txt  
- WARRENSVILLE 03/24/2006 11285.00000 41-26-53.0 N OH MD WLB917 081-30-15.0 W 0002545148 New Par WARRENSVILLE 03/24/2006 11325.00000 41-26-53.0 N OH MD WLB917 081-30-15.0 W 0002545148 New Par WARRENSVILLE 03/24/2006 11485.00000 41-26-53.0 N OH MD WLB919 081-18-49.4 W 0002545151 New Par KIRTLAND 03/24/2006 02112.00000 41-35-22.2 N OH MD WLB919 081-18-49.4 W 0002545151 New Par KIRTLAND 03/24/2006 06404.79000 41-35-22.2 N NC MD WPOT354 079-12-04.1 W 0002547104 NORTH CAROLINA RSA #9, INC. PEMBROKE 03/27/2006 10617.50000 34-39-00.6 N NC MD WPOQ321 079-09-05.1 W 0002547147 NORTH CAROLINA RSA #9, INC. MCDONALD 03/27/2006 06785.00000 34-34-18.6 N NC MD WPOQ321 079-09-05.1 W 0002547147 NORTH CAROLINA RSA #9, INC. MCDONALD 03/27/2006 10552.50000 34-34-18.6 N NC MD WMW277 078-09-52.0 W 0002548378 NORTH CAROLINA RSA #9, INC. MIDDLESEX 03/27/2006 06745.00000 35-48-51.6 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264878A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264878A1.txt  
- 04/06/2006 06695.00000 34-19-31.0 N CA AM WLA271 119-02-23.0 W 0002517939 Oxnard-Ventura-Simi Limited PartnershipSANTA PAULA 04/06/2006 10632.50000 34-19-31.0 N CA AM WLA271 119-02-23.0 W 0002517939 Oxnard-Ventura-Simi Limited PartnershipSANTA PAULA 04/06/2006 10642.50000 34-19-31.0 N CA AM WLA271 119-02-23.0 W 0002517939 Oxnard-Ventura-Simi Limited PartnershipSANTA PAULA 04/06/2006 11647.50000 34-19-31.0 N CA AM WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 04/03/2006 10577.50000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 04/03/2006 10592.50000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 04/03/2006 10755.00000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0002522800 Los Angeles SMSA Limited Partnership COMPTON 04/03/2006 11115.00000 33-53-04.1 N VA AM 077-25-15.7 W 0002525663 FIBERTOWER CORPORATION STAFFORD 04/04/2006 10795.00000 38-24-46.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264982A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-264982A1.txt  
- All applications accepted for filing will be assigned call signs, or other unique station identifiers. However, these assignments are for administrative purposes only and do not in any way prejudice Commission action. E060110 SES-LIC-20060407-00605E Class of Station: Temporary Fixed Earth Station Application for Authority Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 69.88 dBW Digital TV and Audio QPSK Modulation 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060111 SES-LIC-20060407-00606E Class of Station: Temporary Fixed Earth Station Application for Authority Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service SITE ID: 1 Various LOCATION: Page 1 of 11 Comtech 1 4.1 meters ANTENNA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265107A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265107A1.txt  
- LOCATION: SATCOM TECH 1 4.5 meters ANTENNA ID: 450TC TORUS 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E960134 SES-RWL-20060412-00637E Date Effective: 04/19/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 04/15/2006 - 04/15/2021 Renewal RCN License Subsidiary, Inc. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH "18FT" 1 4.1 meters ANTENNA ID: OFFSAT Page 22 of 29 72.40 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.30 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 64 KBPS, VARIOUS INFORMATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265170A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265170A1.txt  
- 1.5 288 1.9 199 1.3 7,431 48.6 15,283 Delaware 2,292 53.2 29 0.7 91 2.1 78 1.8 21 0.5 1,796 41.7 4,308 District of Columbia 3,701 67.3 26 0.5 156 2.8 140 2.6 22 0.4 1,452 26.4 5,497 Florida 34,648 49.8 1,808 2.6 403 0.6 2,688 3.9 1,110 1.6 28,900 41.5 69,556 Georgia 17,265 45.0 1,664 4.3 328 0.9 1,560 4.1 444 1.2 17,080 44.5 38,342 Guam Not shown to protect carrier confidentiality Hawaii 2,697 55.4 11 0.2 11 0.2 103 2.1 83 1.7 1,960 40.3 4,866 Idaho 2,454 42.1 20 0.3 39 0.7 116 2.0 68 1.2 3,137 53.8 5,834 Illinois 24,176 41.5 1,207 2.1 1,222 2.1 1,479 2.5 596 1.0 29,633 50.8 58,313 Indiana 9,957 37.8 346 1.3 328 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265186A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265186A1.txt  
- W 0002584681 CBS BROADCASTING INC. Wrightwood 04/26/2006 06950.00000 - 06975.00000 34-21-08.0 N PA NE 076-52-46.9 W 0002586529 WGAL HEARST-ARGYLE TELEVISION, Harrisburg 04/28/2006 07037.50000 40-15-41.3 N TP - TV Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD KW8562 P 083-32-07.7 W 0002581745 LIBCO, INC. TOLEDO 04/24/2006 02025.00000 - 02025.50000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0002581745 LIBCO, INC. TOLEDO 04/24/2006 02025.50000 - 02037.50000 41-39-04.1 N OH MD KW8562 P 083-32-07.7 W 0002581745 LIBCO, INC. TOLEDO 04/24/2006 02037.50000 - 02049.50000 41-39-04.1 N Page 36 TP - TV Pickup State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD KW8562 P 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265287A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265287A1.txt  
- WPWT869 117-32-26.2 W 0002590112 Los Angeles SMSA Limited Partnership Rancho Cucamonga 05/03/2006 17925.00000 34-07-15.7 N CA MD WPWT869 117-32-26.2 W 0002590112 Los Angeles SMSA Limited Partnership Rancho Cucamonga 05/03/2006 18110.00000 34-07-15.7 N OH MD WPOS956 084-21-54.8 W 0002590113 Centennial Michiana License Company LLDEFIANCE 05/03/2006 06093.45000 41-18-41.2 N OH MD WPOS957 084-45-54.8 W 0002590114 Centennial Michiana License Company LLHICKSVILLE 05/03/2006 06197.24000 41-16-04.1 N OH MD WPOS957 084-45-54.8 W 0002590114 Centennial Michiana License Company LLHICKSVILLE 05/03/2006 06226.89000 41-16-04.1 N Page 22 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD WPOS957 084-45-54.8 W 0002590114 Centennial Michiana License Company LLHICKSVILLE 05/03/2006 06345.49000 41-16-04.1 N LA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265356A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265356A1.txt  
- California 91.7 95.4 3.7 * Colorado 94.4 94.4 0.0 Connecticut 95.5 93.8 -1.7 Delaware 95.0 90.2 -4.8 District of Columbia 94.7 92.2 -2.5 Florida 85.5 90.9 5.4 * Georgia 88.9 86.8 -2.1 Hawaii 94.6 92.8 -1.8 Idaho 89.5 94.0 4.5 * Illinois 95.0 89.0 -6.0 Indiana 90.3 90.0 -0.3 Iowa 95.4 94.4 -1.0 Kansas 94.9 93.9 -1.0 Kentucky 86.9 91.0 4.1 * Louisiana 88.9 93.1 4.2 * Maine 90.7 95.2 4.5 * Maryland 96.3 92.8 -3.5 Massachusetts 94.3 94.3 0.0 Michigan 93.8 92.4 -1.4 Minnesota 96.4 96.6 0.3 Mississippi 82.4 91.8 9.4 * Missouri 92.1 95.3 3.2 * Montana 92.8 91.6 -1.2 Nebraska 94.0 93.6 -0.4 Nevada 89.4 90.5 1.1 New Hampshire 95.0 95.8 0.8 New Jersey 94.1 92.7 -1.4 New 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265412A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265412A1.txt  
- Racing, L.L.C. Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service Application to amend a pending application for authority to operate a C-band temporary fixed earth station to change the emission designator for this earth station from 4M50G7W to 9M00G7W. This Amendment is associated with pending license SES-LIC-20060412-00626 earth station. SITE ID: 1 (TRUCK 5), VARIOUS LOCATION: COMTECH TRUCK 5 4.1 meters ANTENNA ID: OFFSAT 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 9M00G7W Points of Communication: 1 - ALSAT - (ALSAT) E060111 SES-AMD-20060509-00769E Class of Station: Temporary Fixed Earth Station Amendment Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service Page 1 of 12 "AMD" to SES-LIC-20060407-00606 to change emission designator and related service. The 30 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265413A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265413A1.txt  
- E960253 SES-RWL-20060509-00775E Date Effective: 05/15/2006 Class of Station: Fixed Earth Stations Grant of Authority 06/28/2006 - 06/28/2021 Renewal Metro Networks Communications Inc Nature of Service:Domestic Fixed Satellite Service 34 ° 26 ' 11.00 " N LAT. SITE ID: 1 25060 WEST AVENUE STANFORD, LOS ANGELES, VALENCIA, CA 118 ° 34 ' 25.00 " W LONG. LOCATION: COMTECH ANT. CORP. 1 4.1 meters ANTENNA ID: 5 METER OFFSAT 72.90 dBW 5925.0000 - 6425.0000 MHz 3M68G7D 3700.0000 - 4200.0000 MHz 3M68G7D Points of Communication: 1 - ALSAT - (ALSAT) WF74 SES-RWL-20060509-00780E Date Effective: 05/11/2006 Class of Station: Fixed Earth Stations Grant of Authority 07/31/2006 - 07/31/2021 Renewal UCA LLC, Debtor-in-Possession Nature of Service:Domestic Fixed Satellite Service 37 ° 16 ' 26.00 " N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265495A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265495A1.txt  
- Commission, by its International Bureau, took the following actions pursuant to delegated authority. The effective dates of the actions are the dates specified. E060110 SES-LIC-20060407-00605E Date Effective: 05/22/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 05/22/2006 - 05/22/2021 Application for Authority Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 69.88 dBW Digital TV and Audio QPSK Modulation 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060114 SES-LIC-20060412-00621E Date Effective: 05/22/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 05/22/2006 - 05/22/2021 Application for Authority Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service SITE ID: 1 Various LOCATION: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265794A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265794A1.txt  
- W 0002635009 FIBERTOWER CORPORATION CHICAGO 06/01/2006 21925.00000 41-51-20.0 N Page 32 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL NE 087-39-58.0 W 0002635011 FIBERTOWER CORPORATION CHICAGO 06/01/2006 23125.00000 41-51-47.0 N CA NE 118-02-09.0 W 0002637589 COLOR BROADBAND INC CERRITOS 06/02/2006 18040.00000 33-53-04.1 N CA NE 118-15-20.2 W 0002637660 COLOR BROADBAND INC Los Angeles 06/02/2006 17880.00000 34-02-52.0 N CA NE 118-15-20.2 W 0002637660 COLOR BROADBAND INC Los Angeles 06/02/2006 18080.00000 34-02-52.0 N CA NE 118-05-39.0 W 0002637661 COLOR BROADBAND INC MONTEBELLO 06/02/2006 19440.00000 34-01-48.3 N CA NE 118-05-39.0 W 0002637661 COLOR BROADBAND INC MONTEBELLO 06/02/2006 19600.00000 34-01-48.3 N OH NE 083-38-09.0 W 0002637865 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265809A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265809A1.txt  
- GALAXY 10R - (123 W.L.) Page 7 of 16 E910150 SES-RWL-19980903-01227P Date Effective: 10/07/1998 Class of Station: Temporary Fixed Earth Station Grant of Authority 09/25/1998 - 09/25/2008 Renewal Autotote Communications Services, Inc. Nature of Service:Domestic Fixed Satellite Service This authorization is corrected to show station status as non-common carrier instead of common carrier. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT OFFSAT" 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W Points of Communication: 1 - ALSAT - (ALSAT) E860971 SES-RWL-20060524-00883E Date Effective: 05/31/2006 Class of Station: Fixed Earth Stations Grant of Authority 08/22/2006 - 08/22/2021 Renewal CHANNEL 7 OF DETROIT INC. Nature of Service:Domestic Fixed Satellite Service 42 ° 28 ' 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265920A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-265920A1.txt  
- SAN FRANCISCO 06/05/2006 22470.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002640200 Wiline Networks SAN FRANCISCO 06/05/2006 22570.00000 37-47-36.0 N CA NE 122-24-51.0 W 0002640200 Wiline Networks SAN FRANCISCO 06/05/2006 22720.00000 37-47-36.0 N CA NE 122-24-54.8 W 0002640201 WILINE NETWORKS SAN FRANCISCO 06/05/2006 21370.00000 37-44-35.7 N CA NE 122-24-54.8 W 0002640201 WILINE NETWORKS SAN FRANCISCO 06/05/2006 21520.00000 37-44-35.7 N CA NE 122-24-04.1 W 0002640202 WILINE NETWORKS San Francisco 06/05/2006 21270.00000 37-47-23.7 N Page 24 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 122-24-04.1 W 0002640202 WILINE NETWORKS San Francisco 06/05/2006 22720.00000 37-47-23.7 N CA NE 121-58-03.0 W 0002640203 WILINE NETWORKS SANTA CLARA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266020A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266020A1.txt  
- its International Bureau, took the following actions pursuant to delegated authority. The effective dates of the actions are the dates specified. E060119 SES-AMD-20060509-00768E Date Effective: 06/20/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority Amendment SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service SITE ID: 1 (TRUCK 5), VARIOUS LOCATION: COMTECH TRUCK 5 4.1 meters ANTENNA ID: OFFSAT 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 9M00G7W Points of Communication: 1 - ALSAT - (ALSAT) E060119 SES-LIC-20060412-00626E Date Effective: 06/20/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 06/20/2006 - 06/20/2021 Application for Authority SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service SITE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266108A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266108A1.txt  
- State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM 096-48-38.9 W 0002479789 BTR Partners L.P. Dallas 06/20/2006 17920.00000 32-51-44.2 N IN AM 085-37-49.9 W 0002543675 Indiana Michigan Power Company DBA ALA FONTAINE 06/21/2006 06363.40400 40-40-01.2 N IN AM KSI94 085-26-21.9 W 0002543683 Indiana Michigan Power Company DBA AWARREN 06/21/2006 06111.36400 40-40-04.1 N VA AM 076-26-46.0 W 0002640490 Virginia Electric and Power Company HAMPTON 06/23/2006 00928.58125 37-04-42.0 N VA AM 076-26-46.0 W 0002640490 Virginia Electric and Power Company HAMPTON 06/23/2006 00952.58125 37-04-42.0 N SD AM WNTA253 098-00-51.2 W 0002641142 NorthWestern Corporation MITCHELL 06/23/2006 00928.03125 43-42-12.9 N SD AM WNTA253 098-00-51.2 W 0002641142 NorthWestern Corporation MITCHELL 06/23/2006 00952.03125 43-42-12.9 N MT MD WHH611 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266129A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266129A1.txt  
- TELECASTING CORP. Grant of Authority FROM: Current Licensee: GRAY TELEVISION LICENSEE, INC. Michiana Telecasting Corp Application for Consent to Assignment Michiana Telecasting Corp. E060111 SES-LIC-20060407-00606E Date Effective: 06/22/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 06/22/2006 - 06/22/2021 Application for Authority SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Fixed Satellite Service SITE ID: 1 Various LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 69.88 dBW Digital TV and Audio QPSK Modulation 5925.0000 - 6425.0000 MHz 9M00G7W Points of Communication: 1 - ALSAT - (ALSAT) E060137 SES-LIC-20060414-00651E Date Effective: 06/21/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 06/21/2006 - 06/21/2021 Application for Authority Bright House Networks, LLC EZ Nature of Service:Fixed Satellite Service SITE ID: T2 LOCATION: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266245A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266245A1.txt  
- W 0002665339 CLEARWIRE SPECTRUM HOLDINGS LLPUYALLUP 06/27/2006 21925.00000 47-10-45.9 N Page 22 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 122-19-41.8 W 0002665396 CLEARWIRE SPECTRUM HOLDINGS LLDES MOINES 06/27/2006 17840.00000 47-24-56.8 N WA NE 122-18-09.0 W 0002665397 CLEARWIRE SPECTRUM HOLDINGS LLFEDERAL WAY 06/27/2006 17800.00000 47-21-04.1 N WA NE 122-18-09.0 W 0002665397 CLEARWIRE SPECTRUM HOLDINGS LLFEDERAL WAY 06/27/2006 17840.00000 47-21-04.1 N WA NE 122-18-09.0 W 0002665397 CLEARWIRE SPECTRUM HOLDINGS LLFEDERAL WAY 06/27/2006 21825.00000 47-21-04.1 N WA NE 122-12-00.9 W 0002665398 CLEARWIRE SPECTRUM HOLDINGS LLKENT 06/27/2006 23025.00000 47-22-24.1 N WA NE 122-12-00.9 W 0002665398 CLEARWIRE SPECTRUM HOLDINGS LLKENT 06/27/2006 23125.00000 47-22-24.1 N WA NE 122-12-00.9 W 0002665398 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266343A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266343A1.txt  
- NE 088-00-14.2 W 0002672597 FIBERTOWER CORPORATION LOMBARD 07/06/2006 11405.00000 41-54-32.1 N IL NE 088-00-14.2 W 0002672597 FIBERTOWER CORPORATION LOMBARD 07/06/2006 18060.00000 41-54-32.1 N IL NE 087-52-24.2 W 0002672598 FIBERTOWER CORPORATION MELROSE PARK 07/06/2006 11245.00000 41-54-52.1 N IL NE 087-52-24.2 W 0002672598 FIBERTOWER CORPORATION MELROSE PARK 07/06/2006 21920.00000 41-54-52.1 N IL NE 087-52-59.4 W 0002672599 FIBERTOWER CORPORATION STONE PARK 07/06/2006 23120.00000 41-54-04.1 N IL NE 087-46-15.1 W 0002672600 FIBERTOWER CORPORATION CHICAGO 07/06/2006 23070.00000 41-54-52.3 N IL NE 087-46-15.1 W 0002672600 FIBERTOWER CORPORATION CHICAGO 07/06/2006 23125.00000 41-54-52.3 N Page 27 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL NE 087-45-34.7 W 0002672601 FIBERTOWER CORPORATION 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266457A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266457A1.txt  
- 43-59-13.0 N UT NE 113-34-22.8 W 0002683461 CCR-ST. GEORGE IV, LLC St George 07/14/2006 00948.50000 37-03-48.9 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM WPOL477 122-44-51.3 W 0002606224 MAVERICK MEDIA OF SANTA ROSA LSanta Rosa 07/12/2006 00949.50000 38-26-19.8 N PA AM WGV605 076-18-04.1 W 0002678245 CLEAR CHANNEL BROADCASTING LICLANCASTER 07/13/2006 00948.00000 40-03-58.0 N CA MD WAW501 120-57-31.6 W 0002677912 CAPSTAR TX LIMITED PARTNERSHIPMODESTO 07/10/2006 00951.00000 37-40-12.4 N KS MD WGR825 100-52-46.5 W 0002677953 KANZA SOCIETY, INC. GARDEN CITY 07/10/2006 00947.00000 37-57-52.0 N CA MD WLP356 117-20-20.5 W 0002678048 CITICASTERS LICENSES, L.P. RIVERSIDE 07/10/2006 00946.50000 33-59-34.0 N PA MD WLO826 076-18-04.1 W 0002678131 CLEAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266595A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266595A1.txt  
- by state. State * Data withheld to maintain firm confidentiality. Some data have been revised. Zero 44.0%38.0%31.3% 21.0% 21.9% 17.4% 18.4% One 16.8 16.8 19.3 15.3 15.3 10.5 11.4 Two 10.4 10.0 10.4 9.8 11.6 7.6 7.6 Three 7.2 7.7 6.7 7.5 7.6 6.0 6.2 Four 5.5 6.1 6.3 6.1 5.7 4.8 4.7 Five 4.0 4.5 5.2 5.4 5.2 4.2 4.1 Six 3.0 3.8 4.4 5.6 4.4 3.4 3.6 Seven 2.3 2.9 3.5 5.4 4.2 3.1 3.3 Eight 1.7 2.2 2.9 5.4 3.7 3.1 2.9 Nine 1.4 2.1 2.6 4.0 3.2 2.8 2.7 Ten or More 3.7 5.9 7.3 14.7 17.3 36.9 35.0 Zero 11.8% 8.8% 5.8% 3.0% 3.1% 2.2% 2.4% One 10.6 8.5 8.2 4.8 4.6 2.1 2.3 Two 10.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266596A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266596A1.txt  
- 12.7 0.6 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 80.8 15.6 2.9 0.6 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Mobile Wireless 47.6 48.4 4.0 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Power Line and/or Other 1 48.1 22.8 9.7 6.2 5.0 3.9 2.5 1.1 0.5 0.1 0.1 ADSL and/or Cable Modem 13.5 27.0 21.6 14.3 8.7 5.9 4.1 2.7 1.3 0.6 0.3 All Technologies 1.0 5.6 11.9 14.8 13.5 10.3 7.8 5.7 4.6 4.0 20.7 Figures may not add up to 100% due to rounding. 1 Other includes high-speed lines provided over traditional wireline facilities such as T-carrier and also lines provided over any technology that is not specified in the table. Table 16 Percentage of Zip Codes 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266822A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266822A1.txt  
- KGM71 076-50-33.0 W 0002699093 Baltimore Gas and Electric Company REISTERSTOWN 08/01/2006 06635.00000 39-27-52.0 N MD MD KGM71 076-50-33.0 W 0002699093 Baltimore Gas and Electric Company REISTERSTOWN 08/01/2006 06655.00000 39-27-52.0 N MD MD KGM71 076-50-33.0 W 0002699093 Baltimore Gas and Electric Company REISTERSTOWN 08/01/2006 10623.75000 39-27-52.0 N AZ MD WIA660 114-03-34.7 W 0002700138 EL PASO NATURAL GAS COMPANY QUARTZSITE 08/02/2006 06256.54000 33-40-04.1 N AZ MD WIA660 114-03-34.7 W 0002700138 EL PASO NATURAL GAS COMPANY QUARTZSITE 08/02/2006 06785.00000 33-40-04.1 N AZ MD WPRR587 114-20-58.3 W 0002700155 EL PASO NATURAL GAS COMPANY Quartzsite 08/02/2006 06004.50000 33-34-10.6 N AZ MD WPRR587 114-20-58.3 W 0002700155 EL PASO NATURAL GAS COMPANY Quartzsite 08/02/2006 06555.00000 33-34-10.6 N AZ MD WIA659 114-31-49.8 W 0002700164 EL PASO NATURAL GAS COMPANY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266914A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-266914A1.txt  
- CA MD WQFE810 116-59-00.2 W 0002703011 COX COMMUNICATIONS PCS, L.P SANTEE 08/04/2006 21875.00000 32-50-14.8 N PR MD WQFI652 066-11-49.1 W 0002703012 SPRINTCOM, INC. (PUERTO RICO) LOS MAGOS 08/04/2006 11137.50000 18-26-21.9 N PR MD WQFI652 066-11-49.1 W 0002703012 SPRINTCOM, INC. (PUERTO RICO) LOS MAGOS 08/04/2006 19545.00000 18-26-21.9 N PR MD WPTA576 066-08-52.5 W 0002703013 SprintCom, Inc. (Puerto Rico) CATANO 08/04/2006 11627.50000 18-27-04.1 N PR MD WPTA576 066-08-52.5 W 0002703013 SprintCom, Inc. (Puerto Rico) CATANO 08/04/2006 19310.00000 18-27-04.1 N PR MD WPTA576 066-08-52.5 W 0002703013 SprintCom, Inc. (Puerto Rico) CATANO 08/04/2006 19485.00000 18-27-04.1 N PR MD WPTA576 066-08-52.5 W 0002703013 SprintCom, Inc. (Puerto Rico) CATANO 08/04/2006 19590.00000 18-27-04.1 N PR MD WPSN599 065-59-20.3 W 0002703076 SprintCom, Inc. (Puerto Rico) SAN LORENZO 08/04/2006 05945.20000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267135A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267135A1.txt  
- City CA NE 117-22-30.2 W 0002727402 Southern California Logistics Airport Victorville 08/25/2006 00118.35000 34-35-15.0 N CA NE 117-22-30.2 W 0002727402 Southern California Logistics Airport Victorville 08/25/2006 00121.50000 34-35-15.0 N CA NE 117-22-30.2 W 0002727402 Southern California Logistics Airport Victorville 08/25/2006 00124.45000 34-35-15.0 N CA NE 117-22-30.2 W 0002727402 Southern California Logistics Airport Victorville 08/25/2006 00243.00000 34-35-15.0 N OR RM KNA7 121-09-04.1 W 0002726860 REDMOND AIR REDMOND 08/25/2006 00122.95000 44-15-12.4 N RO WPTM556 0002719700 City of Deland Municipal Airport 08/21/2006 Page 1 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO KAL8 0002719851 Aviation Spectrum Resources Inc 08/21/2006 RO KBH4 0002719852 Aviation Spectrum Resources Inc 08/21/2006 RO KCJ3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267151A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267151A1.txt  
- MHz 26K7G1W 3700.0000 - 4200.0000 MHz 13K3G1E Page 28 of 57 3700.0000 - 4200.0000 MHz 30K0F3W Points of Communication: 1 - ALSAT - (ALSAT) E960464 SES-RWL-20060816-01392E Date Effective: 08/25/2006 Class of Station: Temporary Fixed Earth Station Grant of Authority 09/06/2006 - 09/06/2021 Renewal RCN License Subsidiary, Inc. Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: MODEL OFFSAT "18FT" 74.70 dBW 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E960405 SES-RWL-20060816-01394E Date Effective: 08/25/2006 Class of Station: Fixed Earth Stations Grant of Authority 09/06/2006 - 09/06/2021 Renewal Ascent Media Network Services, Inc. Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service 41 ° 0 ' 58.40 " 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267225A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267225A1.txt  
- 35-21-40.3 N AR MD WLL282 094-24-58.8 W 0002728033 ALLTEL COMMUNICATIONS, INC. FT. SMITH 08/28/2006 06315.84000 35-21-40.3 N AR MD WLL282 094-24-58.8 W 0002728033 ALLTEL COMMUNICATIONS, INC. FT. SMITH 08/28/2006 06345.49000 35-21-40.3 N AR MD WLL282 094-24-58.8 W 0002728033 ALLTEL COMMUNICATIONS, INC. FT. SMITH 08/28/2006 06375.14000 35-21-40.3 N NE MD WQEQ215 099-23-20.0 W 0002728103 NE Colorado Wireless Technologies, Inc.Holdrege 08/28/2006 06315.84000 40-26-04.1 N IL MD WQFF551 087-48-58.2 W 0002728322 FIBERTOWER CORPORATION CHICAGO 08/28/2006 10835.00000 41-56-45.1 N IL MD WQFF551 087-48-58.2 W 0002728322 FIBERTOWER CORPORATION CHICAGO 08/28/2006 19540.00000 41-56-45.1 N Page 6 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV MD WLV611 117-52-10.4 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267490A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267490A1.txt  
- NE 088-02-43.6 W 0002749085 Joliet Public Schools District # 86 Joliet 09/12/2006 19360.00000 41-32-17.1 N IL NE 088-02-43.6 W 0002749085 Joliet Public Schools District # 86 Joliet 09/12/2006 19520.00000 41-32-17.1 N IL NE 088-04-24.7 W 0002749086 Joliet Public Schools District # 86 Joliet 09/12/2006 17960.00000 41-30-59.2 N IL NE 088-25-37.1 W 0002749860 Illinois State Toll Highway Authority Elburn 09/13/2006 06004.50000 41-52-04.1 N IL NE 088-25-37.1 W 0002749860 Illinois State Toll Highway Authority Elburn 09/13/2006 06063.80000 41-52-04.1 N PA NE 075-54-39.7 W 0002750512 Luzerne, County of Upper Lehigh 09/13/2006 06770.00000 41-02-14.3 N PA NE 075-52-20.0 W 0002750552 Luzerne, County of MOUNTAINTOP 09/13/2006 06610.00000 41-10-57.0 N PA NE 075-52-20.0 W 0002750552 Luzerne, County of MOUNTAINTOP 09/13/2006 06680.00000 41-10-57.0 N PA NE 075-41-05.7 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267494A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267494A1.txt  
- Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. IG - Industrial/Business Pool, Conventional Public Safety & Critical Infrastructure Division 08/17/2006 WPBA634 MO Macy's West 467.90000000 HONOLULU 21-16-43.0 N HI 157-47-15.0 W 10 1 08/17/2006 WPBA634 MO Macy's West 467.92500000 HONOLULU 21-16-43.0 N HI 157-47-15.0 W 10 1 08/15/2006 WPFE838 MO MERCY MEDICAL CENTER 462.20000000 REDDING 40-36-9.5 N CA 122-39-4.1 W 4 1 04/18/2006 WPMP208 FB2 SENSORMATIC CORPORATION 462.32500000 AGUADILLA 18-29-17.8 N PR 67-6-39.7 W 4 1 04/18/2006 WPMP208 MO SENSORMATIC CORPORATION 462.32500000 -- -- 5 1 04/18/2006 WPMP208 MO SENSORMATIC CORPORATION 467.32500000 -- -- 5 1 08/15/2006 WQBD279 FB2 SOUTH BROWARD HOSPITAL DISTRICT DBA M 462.40000000 MIRAMAR 25-59-45.0 N FL 80-22-36.0 W 1 1 08/15/2006 WQBD279 MO SOUTH BROWARD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267757A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267757A1.txt  
- - 1 - PASAOR - E861076 SES-RWL-20060926-01774E Date Effective: 10/03/2006 Class of Station: Fixed Earth Stations Grant of Authority 10/10/2006 - 10/10/2021 Renewal ABC Radio Detroit, LLC Nature of Service:Domestic Fixed Satellite Service 42 ° 10 ' 9.00 " N LAT. SITE ID: 1 WAYNE, DETROIT, MI 83 ° 12 ' 47.00 " W LONG. LOCATION: COMTECH ANT. CORP. 1 4.1 meters ANTENNA ID: OFFSAT 50.70 dBW 5967.0000 - 6003.0000 MHz 200F9 55.90 dBW 5925.0000 - 6092.0000 MHz 200F9 61.88 dBW 5925.0000 - 6092.0000 MHz 200KF3E 60.18 dBW 5925.0000 - 6092.0000 MHz 200KG1D Points of Communication: 1 - ALSAT - (ALSAT) KA91 SES-RWL-20061002-01793E Date Effective: 10/03/2006 Class of Station: Fixed Earth Stations Grant of Authority 11/12/2006 - 11/12/2021 Renewal AT&T Corp. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267826A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-267826A1.txt  
- 37-29-16.1 N CA NE 122-16-34.5 W 0002771539 Wiline Networks Inc San Mateo 10/03/2006 17880.00000 37-33-45.8 N CA NE 122-18-28.0 W 0002771541 Wiline Networks Inc San Mateo 10/03/2006 19440.00000 37-32-51.0 N CA NE 122-18-28.0 W 0002771541 Wiline Networks Inc San Mateo 10/03/2006 19560.00000 37-32-51.0 N CA NE 122-24-05.0 W 0002771546 Wiline Networks Inc San Francisco 10/03/2006 21420.00000 37-47-58.0 N CA NE 122-24-04.1 W 0002771549 Wiline Networks Inc San Francisco 10/03/2006 21270.00000 37-47-24.0 N CA NE 122-24-04.1 W 0002771549 Wiline Networks Inc San Francisco 10/03/2006 22835.00000 37-47-24.0 N CA NE 122-24-54.8 W 0002771551 Wiline Networks Inc San Francisco 10/03/2006 21370.00000 37-44-35.7 N CA NE 122-24-54.8 W 0002771551 Wiline Networks Inc San Francisco 10/03/2006 21635.00000 37-44-35.7 N CA NE 122-24-54.8 W 0002771551 Wiline Networks 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268047A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268047A1.txt  
- SERVICEMERRILLVILLE 10/18/2006 06805.00000 41-27-47.1 N IN MD WNTF961 087-19-31.1 W 0002790527 NORTHERN INDIANA PUBLIC SERVICEMERRILLVILLE 10/19/2006 06645.00000 41-27-41.1 N IN MD WBA65 087-17-00.1 W 0002790531 NORTHERN INDIANA PUBLIC SERVICEHobart 10/19/2006 06815.00000 41-32-12.1 N IN MD WBA65 087-17-00.1 W 0002790531 NORTHERN INDIANA PUBLIC SERVICEHobart 10/19/2006 06865.00000 41-32-12.1 N IN MD WED429 087-23-56.1 W 0002790535 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 10/19/2006 02137.20000 41-27-04.1 N IN MD WED429 087-23-56.1 W 0002790535 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 10/19/2006 06605.00000 41-27-04.1 N IN MD WED429 087-23-56.1 W 0002790535 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 10/19/2006 06655.00000 41-27-04.1 N IN MD WED429 087-23-56.1 W 0002790535 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 10/19/2006 06675.00000 41-27-04.1 N NV MD WNEI911 115-11-26.0 W 0002791197 LAS VEGAS VALLEY WATER DISTRICTLAS VEGAS 10/18/2006 00928.33125 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268273A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268273A1.txt  
- IA MD WPJB495 092-14-58.0 W 0002796310 USCOC OF GREATER IOWA, INC. SIGOURNEY 10/26/2006 06765.00000 41-20-39.0 N IA MD WPJB495 092-14-58.0 W 0002796310 USCOC OF GREATER IOWA, INC. SIGOURNEY 10/26/2006 06795.00000 41-20-39.0 N CA MD WHD239 118-07-18.2 W 0002796361 LOS ANGELES SMSA LIMITED PARTNEBELLFLOWER 10/26/2006 11265.00000 33-53-01.0 N CA MD WMQ712 118-11-22.3 W 0002796454 LOS ANGELES SMSA LIMITED PARTNECOMPTON 10/26/2006 10775.00000 33-53-04.1 N WI MD WPON754 088-38-05.0 W 0002796464 UNITED STATES CELLULAR OPERATINPALMYRA 10/26/2006 06197.24000 42-55-34.0 N WI MD WPON754 088-38-05.0 W 0002796464 UNITED STATES CELLULAR OPERATINPALMYRA 10/26/2006 06226.89000 42-55-34.0 N WI MD WPON754 088-38-05.0 W 0002796464 UNITED STATES CELLULAR OPERATINPALMYRA 10/26/2006 06256.54000 42-55-34.0 N WI MD WPON754 088-38-05.0 W 0002796464 UNITED STATES CELLULAR OPERATINPALMYRA 10/26/2006 06345.49000 42-55-34.0 N Page 8 CF 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268388A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268388A1.txt  
- GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service "MOD" to change its existing C-band earth station license from temporary-fixed to a fixed earth station. 41 ° 40 ' 7.30 " N LAT. SITE ID: 1 ROUTE 17 AND 17 B, RACEWAY RD., SULLIVAN, MONTICELLO, NY 74 ° 42 ' 47.50 " W LONG. LOCATION: COMTECH ANTENNA SYSTEMS TRUCK 9 4.1 meters ANTENNA ID: 5 METER OFFSAT 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060129 SES-MOD-20061102-01935E Class of Station: Fixed Earth Stations Application for Modification SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service "MOD" to change its existing C-band earth station license from temporary-fixed to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268453A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268453A1.txt  
- SPRIN 11/07/2006 00936.46250 39-54-48.0 N CA MD WPPF812 117-33-57.2 W 0002811315 FCI 900, INC. ADELANTO 11/07/2006 00937.42500 34-44-14.9 N CA MD WPPF812 117-33-57.2 W 0002811315 FCI 900, INC. ADELANTO 11/07/2006 00939.92500 34-44-14.9 N CA MD WPPF812 118-35-12.3 W 0002811315 FCI 900, INC. CHATSWORTH 11/07/2006 00937.42500 34-19-35.0 N MI MD WPRM324 083-42-30.8 W 0002811316 FCI 900, INC. ANN ARBOR 11/07/2006 00935.72500 42-16-04.1 N MI MD WPRM324 083-42-30.8 W 0002811316 FCI 900, INC. ANN ARBOR 11/07/2006 00938.15000 42-16-04.1 N Page 41 YS - SMR, 896-901/935-940 MHz, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI MD WPRM324 083-42-30.8 W 0002811316 FCI 900, INC. ANN ARBOR 11/07/2006 00939.13750 42-16-04.1 N MI MD WPRM324 083-28-14.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268593A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268593A1.txt  
- - ALSAT - (ALSAT) E860696 SES-MOD-20061116-02034E Class of Station: Fixed Earth Stations Application for Modification Scientific Games Racing, L.L.C. Nature of Service:Fixed Satellite Service "MOD" to change from temporary-fixed to fixed. 42 ° 58 ' 12.60 " N LAT. SITE ID: 1 5857 ROUTE 96, ONTARIO, FARMINGTON, NY 77 ° 20 ' 40.40 " W LONG. LOCATION: COMTECH OFFSAT 1 4.1 meters ANTENNA ID: OFFSAT 66.91 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) Page 8 of 8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268666A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268666A1.txt  
- ID MD WMF745 116-12-17.4 W 0002827139 IDAHO STATE BOARD OF EDUCATIONBOISE 11/22/2006 00949.00000 43-36-13.6 N ID MD WMF745 116-12-17.4 W 0002827139 IDAHO STATE BOARD OF EDUCATIONBOISE 11/22/2006 00949.12500 43-36-13.6 N VA NE 077-27-26.6 W 0002823465 VIRGINIA CENTER FOR PUBLIC PRESSRichmond 11/20/2006 00949.50000 37-33-15.6 N NC NE 082-34-25.5 W 0002824316 LIBERTY PRODUCTIONS, A LIMITED PAAsheville 11/20/2006 00951.00000 35-37-10.4 N ID NE 116-59-04.1 W 0002825242 IDA-VEND COMPANY, INC. LEWISTON 11/21/2006 00949.50000 46-23-30.5 N ID NE 117-00-27.5 W 0002825501 INLAND NORTHWEST BROADCASTINGMOSCOW 11/21/2006 00946.50000 46-44-47.5 N WA NE 117-10-20.0 W 0002826631 INLAND NORTHWEST BROADCASTINGFALLON 11/22/2006 00948.00000 46-51-44.0 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268720A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268720A1.txt  
- Earth Stations Application for Modification SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service "MOD" of its existing C-band earth station license from temporary-fixed to fixed earth station license. 43 ° 3 ' 46.80 " N LAT. SITE ID: 1 NELSON AVENUE-TRUCK C-19, SARATOGA, SARATOGA SPRINGS, NY 73 ° 46 ' 25.30 " W LONG. LOCATION: COMTECH TRUCK C-19 4.1 meters ANTENNA ID: "18FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 68.90 dBW 5925.0000 - 6425.0000 MHz 1M50F7D 57.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 72.40 dBW 5925.0000 - 6425.0000 MHz 7M92G7W 66.91 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E890997 SES-MOD-20061116-02037E Class of Station: Fixed 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268813A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268813A1.txt  
- - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO NE 092-32-41.7 W 0002829813 Aviation Spectrum Resources Inc Kirksville 11/28/2006 00129.80000 40-05-36.6 N LA NE 093-18-40.9 W 0002829816 Aviation Spectrum Resources Inc Westlake 11/28/2006 00131.57500 30-13-16.4 N OH NE 081-58-56.5 W 0002830169 EAA Chapter 425 Zanesville 11/28/2006 00122.80000 39-59-04.1 N RO WET9 0002828951 WEYERHAEUSER COMPANY 11/27/2006 RO KNO4 0002829713 Aviation Spectrum Resources Inc 11/28/2006 RO KRT9 0002829714 Aviation Spectrum Resources Inc 11/28/2006 RO KSJ6 0002829715 Aviation Spectrum Resources Inc 11/28/2006 RO KTO3 0002829716 Aviation Spectrum Resources Inc 11/28/2006 RO KUR6 0002829717 Aviation Spectrum Resources Inc 11/28/2006 RO KWG4 0002829718 Aviation Spectrum Resources Inc 11/28/2006 RO KWG8 0002829719 Aviation Spectrum 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268942A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-268942A1.txt  
- Earth Stations Grant of Authority 05/22/2006 - 05/22/2021 Application for Modification SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service Page 21 of 31 41 ° 40 ' 7.30 " N LAT. SITE ID: 1 ROUTE 17 AND 17 B, RACEWAY RD., SULLIVAN, MONTICELLO, NY 74 ° 42 ' 47.50 " W LONG. LOCATION: COMTECH ANTENNA SYSTEMS TRUCK 9 4.1 meters ANTENNA ID: 5 METER OFFSAT 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060129 SES-MOD-20061102-01935E Date Effective: 12/11/2006 Class of Station: Fixed Earth Stations Grant of Authority 05/22/2006 - 05/22/2021 Application for Modification SCIENTIFIC GAMES RACING, L.L.C. Nature of Service:Domestic Fixed Satellite Service 40 ° 55 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A1.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A2.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A6.txt  
- of Funding Year 2004 funds.6 As of the same date, USAC had committed over $1.6 billion, and disbursed over $481 million of Funding Year 2005 funds. 7 USAC supplies the Commission with funding commitments and disbursements information for the Schools and Libraries mechanism for all active funding years. USAC provided the Commission with data as of June 30, 2006. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A8.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A8.txt  
- 3.2% * Alaska 86.5 95.2 8.7 * Arizona 86.9 92.9 6.0 * Arkansas 86.6 87.9 1.3 California 92.5 95.4 3.0 * Colorado 93.2 95.1 1.8 * Connecticut 95.5 93.9 -1.6 # Delaware 94.3 91.5 -2.7 # District of Columbia 94.9 92.2 -2.7 # Florida 88.7 91.8 3.1 * Georgia 86.2 89.8 3.6 * Hawaii 93.5 94.8 1.3 Idaho 90.7 94.8 4.1 * Illinois 94.2 89.6 -4.6 # Indiana 91.6 90.8 -0.8 Iowa 96.2 95.4 -0.8 Kansas 94.3 94.3 0.0 Kentucky 88.1 91.3 3.1 * Louisiana 89.7 91.8 2.2 * Maine 93.4 95.7 2.3 * Maryland 95.7 94.0 -1.7 # Massachusetts 95.9 94.5 -1.4 # Michigan 92.8 92.6 -0.2 Minnesota 95.8 96.2 0.4 Mississippi 82.4 89.5 7.1 * Missouri 91.5 94.2 2.7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A9.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269251A9.txt  
- to the local telephone companies' networks. The reductions in per-minute access prices over time have been a major contributing factor to reductions in long distance prices. 6 Although the changes took effect on July 1, some companies made subsequent adjustments to their tariffs, which did not take effect until August 11. 1955 - 2005 1995 - 2005 CPI All Items 4.1 % 2.5 % CPI All Services 5.0 3.2 CPI Telephone Services ** 1.7 -0.2 CPI Major Categories: - Food & Beverages * 2.5 - Housing * 2.8 - Apparel 2.1 -1.0 - Transportation 3.9 2.3 - Medical Care 5.9 3.9 - Recreation * 1.5 - Other Goods & Services * 4.2 CPI Public Transportation 5.1 2.1 CPI Utility Natural Gas 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269278A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269278A1.txt  
- - (ALSAT) E860696 SES-MOD-20061116-02034E Date Effective: 12/28/2006 Class of Station: Fixed Earth Stations Grant of Authority 01/27/1998 - 01/27/2008 Application for Modification Scientific Games Racing, LLC Nature of Service:Fixed Satellite Service 42 ° 58 ' 12.60 " N LAT. SITE ID: 1 5857 ROUTE 96, ONTARIO, FARMINGTON, NY 77 ° 20 ' 40.40 " W LONG. LOCATION: COMTECH OFFSAT 1 4.1 meters ANTENNA ID: OFFSAT 66.91 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E870041 SES-RWL-20061226-02244E Date Effective: 12/29/2006 Class of Station: Fixed Earth Stations Grant of Authority 01/09/2007 - 01/09/2022 Renewal C-NATIVE EXCHANGE II, LP Nature of Service:Domestic Fixed Satellite Service 32 ° 57 ' 16.00 " N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269409A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269409A1.txt  
- E890942 SES-MOD-20061116-02036E Date Effective: 01/03/2007 Class of Station: Fixed Earth Stations Grant of Authority 03/22/1998 - 03/22/2008 Application for Modification SCIENTIFIC GAMES RACING, LLC Nature of Service:Domestic Fixed Satellite Service 43 ° 3 ' 46.80 " N LAT. SITE ID: 1 NELSON AVENUE-TRUCK C-19, SARATOGA, SARATOGA SPRINGS, NY 73 ° 46 ' 25.30 " W LONG. LOCATION: COMTECH TRUCK C-19 4.1 meters ANTENNA ID: "18FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 68.90 dBW 5925.0000 - 6425.0000 MHz 1M50F7D 57.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 72.40 dBW 5925.0000 - 6425.0000 MHz 7M92G7W 66.91 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) Page 19 of 31 E890997 SES-MOD-20061116-02037E 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269507A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269507A1.txt  
- WMT399 113-52-56.8 W 0002864368 CommNet Cellular Licence Holding LLC St. George 01/08/2007 06126.18900 37-09-17.9 N UT AM WMT399 113-52-56.8 W 0002864368 CommNet Cellular Licence Holding LLC St. George 01/08/2007 06155.22000 37-09-17.9 N UT AM WMT399 113-52-56.8 W 0002864368 CommNet Cellular Licence Holding LLC St. George 01/08/2007 06160.16000 37-09-17.9 N WY AM 106-42-40.9 W 0002871604 Union Telephone Company Alcova 01/09/2007 06815.00000 42-34-04.1 N IL AM 087-53-42.8 W 0002871887 Village of Franklin Park Franklin Park 01/10/2007 23175.00000 41-56-28.1 N PR AM 066-08-51.2 W 0002872609 NEPTUNO MEDIA BAYAMON 01/10/2007 11035.00000 18-23-50.8 N CA AM WMQ861 117-21-59.1 W 0002873357 Verizon Wireless (VAW) LLC SAN DIEGO 01/12/2007 10553.12500 33-13-32.1 N Page 7 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269691A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269691A1.txt  
- WQEI787 077-01-32.3 W 0002881340 Baltimore Gas and Electric Company COOKSVILLE 01/17/2007 06776.25000 39-19-05.9 N MD MD WQEI787 077-01-32.3 W 0002881340 Baltimore Gas and Electric Company COOKSVILLE 01/17/2007 10563.75000 39-19-05.9 N AZ MD WPRR587 114-20-58.3 W 0002881433 El Paso Natural Gas Company Quartzsite 01/17/2007 06565.00000 33-34-10.6 N AZ MD WIA660 114-03-34.7 W 0002881467 EL PASO NATURAL GAS COMPANY QUARTZSITE 01/17/2007 06785.00000 33-40-04.1 N Page 26 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD WIA660 114-03-34.7 W 0002881467 EL PASO NATURAL GAS COMPANY QUARTZSITE 01/17/2007 06835.00000 33-40-04.1 N AZ MD WQFM362 110-58-23.6 W 0002881765 Simply Bits, LLC Tucson 01/17/2007 17760.00000 32-13-26.6 N AZ MD WQFM361 110-52-57.3 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269718A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-269718A1.txt  
- 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information 5925.0000 - 6425.0000 MHz 51K2G7W 81.90 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates to 45Mbps, Various Information 5925.0000 - 6425.0000 MHz 36M0G7W 74.50 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 3M00G1F 81.90 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 36M0G1F Comtech 1 4.1 meters ANTENNA ID: Offsat Page 2 of 16 Standard Video with Associated Audio Sub-carriers 3700.0000 - 4200.0000 MHz 36M0F3F BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information 3700.0000 - 4200.0000 MHz 51K2G7W BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates to 45Mbps, Various Information 3700.0000 - 4200.0000 MHz 36M0G7W Compressed Digital Video 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270046A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270046A1.txt  
- 01/26/2007 21970.00000 33-23-32.9 N AZ NE 112-04-27.4 W 0002892241 SPARKPLUG SOUTHWEST, LLC PHOENIX 01/26/2007 11245.00000 33-29-13.2 N AZ NE 112-04-27.4 W 0002892241 SPARKPLUG SOUTHWEST, LLC PHOENIX 01/26/2007 11285.00000 33-29-13.2 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ NE 111-49-04.1 W 0002892388 SPARKPLUG SOUTHWEST, LLC MESA 01/26/2007 23170.00000 33-23-15.8 N AZ NE 111-55-22.7 W 0002892396 SPARKPLUG SOUTHWEST, LLC SCOTTSDALE 01/26/2007 10755.00000 33-29-18.5 N AK NE 149-26-24.0 W 0002892768 General Communication Corp. Milne Point CFP 01/26/2007 11245.00000 70-27-33.0 N AK NE 149-26-24.0 W 0002892768 General Communication Corp. Milne Point CFP 01/26/2007 11325.00000 70-27-33.0 N VA NE 077-28-28.2 W 0002892840 Telecom Transport 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270308A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270308A1.txt  
- N CA NE 117-11-22.0 W 0002894533 Aviation Spectrum Resources, Inc San Diego 01/29/2007 00132.00000 32-44-00.8 N GM NE 092-26-36.4 W 0002894538 Aviation Spectrum Resources, Inc Gulf of Mexico 01/29/2007 00136.85000 27-32-46.9 N MO NE 094-42-50.1 W 0002894542 Aviation Spectrum Resources, Inc Kansas City 01/29/2007 00131.60000 39-17-51.4 N MN NE 093-03-35.9 W 0002894546 Aviation Spectrum Resources, Inc St Paul 01/29/2007 00131.62500 44-56-04.1 N Page 2 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE 077-27-20.9 W 0002894553 Aviation Spectrum Resources, Inc Chantilly 01/29/2007 00128.92500 38-56-40.3 N NV NE 119-46-05.2 W 0002894556 Aviation Spectrum Resources, Inc Reno 01/29/2007 00129.75000 39-29-56.8 N IL NE 087-45-08.7 W 0002894564 Aviation Spectrum 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270407A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270407A1.txt  
- 2.11Percent of U.S. Households with Internet Connections by Technology: Rural vs Urban............................................................................... 2-13 Consumer Expenditures.......................................................................................3-1 Table 3.1Household Expenditures for Telephone Service................................................3-3 Table 3.2Average Monthly Household Telecommunications Expenditures by Type of Provider....................................................................................3-4 Table 3.3Personal Consumption Expenditures.............................................................3-5 Chart 3.1Personal Consumption Expenditures for Telephone Service.................................3-6 Chart 3.2Monthly Personal Consumption Expenditures for Telephone Service........................3-6 Introduction.................................................................................................... Access Charges................................................................................................ Advanced Telecommunications.............................................................................. i Earnings ....................................................................................................... 4-1 Table 4.1Interstate Rate-of-Return Summary: Years 1998 through 2005 ..............................4-3 Employment and Labor Productivity ................................................................... 5-1 Table 5.1Average Number of Employees in the Telecommunications Industry ..................... 5-3 Chart 5.1Average Number of Employees in the Telecommunications Industry ........................5-3 Table 5.2Labor Productivity Index for the Wired and Wireless Telecommunications Industry .....................................................................5-4 Chart 5.2Wired and Wireless Telecommunications Carriers (NAICS 5171 and 5172) Labor Productivity Index ........................................... 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270500A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270500A1.txt  
- Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 120-29-38.2 W 0002901466 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 23170.00000 46-36-15.4 N WA NE 120-25-26.4 W 0002901467 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 17960.00000 46-36-59.8 N WA NE 120-25-26.4 W 0002901467 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 21870.00000 46-36-59.8 N WA NE 120-24-04.1 W 0002901468 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 19400.00000 46-30-56.1 N WA NE 120-24-04.1 W 0002901468 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 19520.00000 46-30-56.1 N WA NE 120-24-04.1 W 0002901468 CLEARWIRE SPECTRUM HOLDINGS II YAKIMA 02/05/2007 23020.00000 46-30-56.1 N WA NE 120-18-47.8 W 0002902018 CLEARWIRE SPECTRUM HOLDINGS II WENATCHEE 02/05/2007 23020.00000 47-25-34.1 N WA NE 120-18-47.8 W 0002902018 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270515A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270515A1.txt  
- 01/09/2007 WQEE655 FB LEWISTON COMMUNITY SERVICES DISTRICT 154.44500000 LEWISTON 40-41-52.4 N CA 122-48-26.5 W 1 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. YF - Public Safety Ntl Plan, 821-824/866-869 MHz, Trunked Public Safety and Homeland Security Bureau 01/10/2007 WPJQ951 FB2 Riverside, County of 866.21250000 BEAUMONT 33-54-51.1 N CA 117-0-4.1 W 1 1 01/10/2007 WPJQ951 FB Riverside, County of 866.21250000 BEAUMONT 33-54-51.1 N CA 117-0-4.1 W 1 1 01/10/2007 WPJQ951 FB2 Riverside, County of 866.26250000 BEAUMONT 33-54-51.1 N CA 117-0-4.1 W 1 1 01/10/2007 WPJQ951 FB Riverside, County of 866.26250000 BEAUMONT 33-54-51.1 N CA 117-0-4.1 W 1 1 01/10/2007 WPJQ951 FB2 Riverside, County of 866.71250000 BEAUMONT 33-54-51.1 N CA 117-0-4.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270666A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270666A1.txt  
- State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NE AM 099-42-05.6 W 0002890586 NEBRASKA PUBLIC POWER DISTRICTLEXINGTON 02/12/2007 00928.16875 40-41-39.8 N NE AM 099-42-05.6 W 0002890586 NEBRASKA PUBLIC POWER DISTRICTLEXINGTON 02/12/2007 00952.16875 40-41-39.8 N NC AM KMY25 081-05-20.2 W 0002893120 DUKE ENERGY CORP DENVER 02/16/2007 06785.00000 35-34-04.5 N NC AM KMX97 079-41-04.1 W 0002894517 DUKE ENERGY CORP REIDSVILLE 02/16/2007 06615.00000 36-25-29.4 N NC AM KMX97 079-41-04.1 W 0002894517 DUKE ENERGY CORP REIDSVILLE 02/16/2007 06645.00000 36-25-29.4 N NC AM 079-49-43.2 W 0002894555 Duke Energy Corporation Reidsville 02/16/2007 06805.00000 26-19-49.4 N CA AM WQEH518 118-40-25.8 W 0002899380 Nextweb Inc Simi Valley 02/16/2007 19575.00000 34-14-40.8 N CA AM WQCY774 118-47-01.0 W 0002899383 Nextweb, Inc. Malibu 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270855A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270855A1.txt  
- recalculated composites in the attached tables. Other charts contain data that were taken directly from company provided composite data. 21 See supra note 14. 7 Overall, we caution readers to be aware of potential inconsistencies in the service quality data and methodological shortcomings affecting both the collection and interpretation of the data. Some common sources of issues are described below. 4.1 Data Re-filings Commission staff generally screen company-filed service quality data for irregularities and provide feedback to reporting companies on suspected problems. The reporting companies are then given an opportunity to re-file. Re-filed data appear in this report if they are received in time to be included in the Commission's recalculation of holding company totals and other data aggregates described in 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270881A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270881A1.txt  
- 082-02-24.5 W 0002888796 Appalachian Power Company DBA AmericGRUNDY 02/20/2007 06585.00000 37-20-16.4 N VA AM WAL397 082-02-24.5 W 0002888796 Appalachian Power Company DBA AmericGRUNDY 02/20/2007 06605.62500 37-20-16.4 N VA AM WAL397 082-02-24.5 W 0002888796 Appalachian Power Company DBA AmericGRUNDY 02/20/2007 06645.00000 37-20-16.4 N VA AM WAL397 082-02-24.5 W 0002888796 Appalachian Power Company DBA AmericGRUNDY 02/20/2007 06660.62500 37-20-16.4 N NC AM KMX97 079-41-04.1 W 0002894517 DUKE ENERGY CORP REIDSVILLE 02/20/2007 06615.00000 36-25-29.4 N NC AM KMX97 079-41-04.1 W 0002894517 DUKE ENERGY CORP REIDSVILLE 02/20/2007 06645.00000 36-25-29.4 N NC AM 079-49-43.2 W 0002894555 Duke Energy Corporation Reidsville 02/20/2007 06805.00000 36-19-49.4 N AZ AM 110-54-53.0 W 0002899463 TRILLION PARTNERS, INC. Tucson 02/21/2007 21835.00000 32-08-36.8 N AZ AM 110-54-53.0 W 0002899463 TRILLION PARTNERS, INC. Tucson 02/21/2007 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270893A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270893A1.txt  
- Division 01/20/2007 KNBI753 FB2 A C T S Retirement Life Communities 464.32500000 LIMA 39-55-20.0 N PA 75-26-50.0 W 9 1 01/20/2007 KNBI753 MO A C T S Retirement Life Communities 464.32500000 -- -- 10 1 01/20/2007 KNBI753 MO A C T S Retirement Life Communities 469.32500000 -- -- 10 1 01/25/2007 KNFA251 FB2 NATIONAL FRUIT PRODUCT CO INC 462.32500000 WINCHESTER 39-14-4.1 N VA 78-12-34.3 W 4 1 01/25/2007 KNFA251 MO NATIONAL FRUIT PRODUCT CO INC 462.32500000 -- -- 5 1 01/25/2007 KNFA251 MO NATIONAL FRUIT PRODUCT CO INC 467.32500000 -- -- 5 1 01/24/2007 WPNU341 FB2 NRG Texas LLC 451.77500000 RICHMOND 29-29-1.9 N TX 95-37-49.8 W 1 2 01/24/2007 WPNU341 FB2 NRG Texas LLC 452.02500000 RICHMOND 29-29-1.9 N TX 95-37-49.8 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270916A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270916A1.txt  
- Temporary Fixed Earth Station Application for Modification RCN LICENSE SUBSIDIARY, INC. Nature of Service:Domestic Fixed Satellite Service "MOD" to change from Fixed, Transmit/Receive facility to Temporary-Fixed, Transmit-only facility, emission designator, frequency(ies), increase EIRP and EIRP density, to replace antenna, and to relocate fixed station. Page 5 of 8 SITE ID: 1 4175 CAMERON STREET SUITE B-10, VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.43 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.27 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64 KBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270918A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-270918A1.txt  
- Page 8 of 35 E070011 SES-LIC-20070116-00116E Date Effective: 02/27/2007 Class of Station: Fixed Earth Stations Grant of Authority 02/27/2007 - 02/27/2022 Application for Authority CRAWFORD COMMUNICATIONS, INC. Nature of Service:Fixed Satellite Service 33 ° 53 ' 48.80 " N LAT. SITE ID: 1 3845 Pleasantdale Road, Dekalb, Atlanta, GA 84 ° 14 ' 48.80 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat Standard Video with Associated Audio Sub-carriers 3700.0000 - 4200.0000 MHz 36M0F3F BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information 3700.0000 - 4200.0000 MHz 51K2G7W BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates to 45Mbps, Various Information 3700.0000 - 4200.0000 MHz 36M0G7W Compressed Digital Video 3700.0000 - 4200.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271175A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271175A1.txt  
- 092-06-54.2 W 0002933027 Fixed Wireless Holdings, LLC DULUTH 03/02/2007 21875.00000 46-47-13.9 N MN MD WQDE232 092-05-55.0 W 0002933029 Fixed Wireless Holdings, LLC Duluth 03/02/2007 19360.00000 46-47-11.2 N NC MD KIM96 079-28-08.0 W 0002933495 DUKE ENERGY CORP GLEN RAVEN 03/02/2007 06775.00000 36-06-45.4 N NC MD KIM96 079-28-08.0 W 0002933495 DUKE ENERGY CORP GLEN RAVEN 03/02/2007 06795.00000 36-06-45.4 N NC MD KMX97 079-41-04.1 W 0002933515 DUKE ENERGY CORP REIDSVILLE 03/02/2007 06615.00000 36-25-29.4 N NC MD KMX97 079-41-04.1 W 0002933515 DUKE ENERGY CORP REIDSVILLE 03/02/2007 06635.00000 36-25-29.4 N NC MD KMX97 079-41-04.1 W 0002933515 DUKE ENERGY CORP REIDSVILLE 03/02/2007 06675.00000 36-25-29.4 N PA NE 076-57-32.1 W 0002924098 CLEARWIRE SPECTRUM HOLDINGS II ENOLA 02/23/2007 21875.00000 40-18-12.1 N PA NE 076-57-32.1 W 0002924098 CLEARWIRE SPECTRUM HOLDINGS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271200A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271200A1.txt  
- m-PSK Digital data 14000.0000 - 14500.0000 MHz 36M0G7D Points of Communication: NAOR Hub - ALSAT - (ALSAT) NAOR Hub - ESTRELA DO SUL 1 - (63 W.L.) E070035 SES-LIC-20070227-00281E Class of Station: Temporary Fixed Earth Station Application for Authority MOBILE SATELLITE CONNECTION, LLC Page 1 of 4 Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 TRANSPORTABLE LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT OFFSAT" 44.40 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW STANDARD ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.90 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E070034 SES-LIC-20070228-00280E Class of Station: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271495A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271495A1.txt  
- 2.4 meters ANTENNA ID: 240-KVO Page 4 of 9 76.00 dBW 14000.0000 - 14500.0000 MHz 36M0F9W Points of Communication: 1 - ALSAT - (ALSAT) E7106 SES-MOD-20070307-00309E Class of Station: Temporary Fixed Earth Station Application for Modification Crawford Communications, Inc. Nature of Service:Fixed Satellite Service "MOD" to change from common carrier to non-common carrier. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18 FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W Points of Communication: 1 - ALSAT - (ALSAT) E880922 SES-MOD-20070307-00310E Class of Station: Temporary Fixed Earth Station Application for Modification Crawford Communications, Inc. Nature of Service:Fixed Satellite Service "MOD" to change from common carrier to non-common carrier. SITE ID: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271635A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271635A1.txt  
- 03/12/2007 19440.00000 39-36-35.3 N OH NE 084-03-23.0 W 0002945216 CLEARWIRE SPECTRUM HOLDINGS II Beavercreek City 03/12/2007 17800.00000 39-43-27.6 N OH NE 084-03-23.0 W 0002945216 CLEARWIRE SPECTRUM HOLDINGS II Beavercreek City 03/12/2007 17960.00000 39-43-27.6 N OH NE 084-04-34.2 W 0002945217 CLEARWIRE SPECTRUM HOLDINGS II Bellbrook 03/12/2007 19360.00000 39-40-19.2 N OH NE 084-08-26.6 W 0002945218 CLEARWIRE SPECTRUM HOLDINGS II Dayton 03/12/2007 19440.00000 39-45-04.1 N Page 30 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 117-53-32.7 W 0002946437 ST. JOSEPH HEALTH SYSTEM ORANGE 03/12/2007 23170.00000 33-46-32.6 N CA NE 117-51-54.4 W 0002946439 ST. JOSEPH HEALTH SYSTEM ORANGE 03/12/2007 21970.00000 33-46-47.6 N LA NE 090-07-06.9 W 0002946859 EarthLink, Inc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271812A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271812A1.txt  
- Company Anaheim 03/22/2007 00614.00000 - 00806.00000 33-48-16.1 N CA AM P 117-54-58.2 W 0002949443 The Walt Disney Company Anaheim 03/22/2007 00944.00000 - 00952.00000 33-48-16.1 N MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ AM WNTR588 112-33-32.6 W 0002796916 Arizona Public Service Company BUCKEYE 03/19/2007 00928.11875 33-34-04.1 N AZ AM WNTR588 112-33-32.6 W 0002796916 Arizona Public Service Company BUCKEYE 03/19/2007 00952.11875 33-34-04.1 N AR AM 090-43-00.4 W 0002840720 CITY WATER AND LIGHT PLANT OF THJONESBORO 03/22/2007 00928.48125 35-50-37.2 N Page 34 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR AM 090-43-00.4 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271873A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-271873A1.txt  
- Points of Communication: 1 - ALSAT - (ALSAT) E070011 SES-MOD-20070320-00377E Class of Station: Fixed Earth Stations Application for Modification CRAWFORD COMMUNICATIONS, INC. Nature of Service:Fixed Satellite Service "MOD" to correct the coordinates. 33 ° 53 ' 48.80 " N LAT. SITE ID: 1 3845 Pleasantdale Road, Dekalb, Atlanta, GA 84 ° 14 ' 18.90 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 72.40 dBW Standard Video with Associated Audio Sub-carriers 6334.0000 - 6425.0000 MHz 36M0F3F 66.40 dBW Standard Video with Associated Audio Sub-carriers 6297.0000 - 6334.0000 MHz 36M0F3F 72.40 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 36M0G1F 68.20 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 3M00G1F 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272066A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272066A1.txt  
- MISSOURI, LLCMARISSA 03/28/2007 06110.75000 38-14-50.8 N IL NE 089-44-14.2 W 0002971537 USCOC OF GREATER MISSOURI, LLCMARISSA 03/28/2007 06585.00000 38-14-50.8 N IL NE 089-44-14.2 W 0002971537 USCOC OF GREATER MISSOURI, LLCMARISSA 03/28/2007 06605.00000 38-14-50.8 N IL NE 089-44-14.2 W 0002971537 USCOC OF GREATER MISSOURI, LLCMARISSA 03/28/2007 06635.00000 38-14-50.8 N MO NE 092-42-17.9 W 0002971539 USCOC OF GREATER MISSOURI, LLCCamdenton 03/28/2007 05945.20000 37-55-04.1 N PR NE 066-11-54.3 W 0002972557 Puerto Rico Telephone Company Lapacayey 03/28/2007 18120.00000 18-05-34.2 N DC NE 077-04-18.8 W 0002973001 FiberTower Network Services Corp. Washington 03/29/2007 21820.00000 38-56-02.4 N DC NE 077-03-11.2 W 0002973003 FiberTower Network Services Corp. WASHINGTON 03/29/2007 21970.00000 38-55-37.9 N NC NE 076-56-55.9 W 0002973300 USCOC OF NORTH CAROLINA RSA #7,COLERAIN 03/29/2007 06785.00000 36-10-39.3 N OK NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272080A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272080A1.txt  
- MHz 54K6G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 6M84G7W 54.50 dBW 5925.0000 - 6425.0000 MHz 81K9G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 11M2G7W 71.50 dBW 5925.0000 - 6425.0000 MHz 35M9G7W 65.89 dBW 5925.0000 - 6425.0000 MHz 618KG7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 20M3G7W Page 20 of 28 3700.0000 - 4200.0000 MHz 53.60 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- ANDREW 4.1M 4.1 meters ANTENNA ID: "18 FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 18M0F8F- 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 72.40 dBW 5925.0000 - 6425.0000 MHz 9M00G1F 72.40 dBW 5925.0000 - 6425.0000 MHz 24M0G7F 56.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 53.02 dBW 5925.0000 - 6425.0000 MHz 38K4G7E 54.55 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 72.40 dBW 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272082A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272082A1.txt  
- - IRIDIUM - (NGSO) TEMP - MOTOROLA - (MOTOROLA) TEMP - ORBCOMM - E960173 SES-MOD-20070213-00231E Date Effective: 04/03/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 06/14/2006 - 06/14/2021 Application for Modification RCN LICENSE SUBSIDIARY, INC. Nature of Service:Domestic Fixed Satellite Service Page 8 of 17 SITE ID: 1 4175 CAMERON STREET SUITE B-10, VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.43 dBW STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F3F 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45 MBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 36M0G7W 54.27 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64 KBPS, VARIOUS INFORMATION 5925.0000 - 6425.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272240A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272240A1.txt  
- MS MD WAE486 088-46-15.1 W 0002974102 CAPSTAR TX LIMITED PARTNERSHIPTUPELO 03/30/2007 00946.50000 34-14-33.3 N KS MD WQEY481 097-08-49.3 W 0002974488 CROSS COMMUNICATIONS, INC. CLAY CENTER 03/30/2007 00944.50000 39-22-52.9 N KS MD WQEY482 097-03-46.2 W 0002974493 TAYLOR COMMUNICATIONS, INC. GREEN 03/30/2007 00949.00000 39-28-03.1 N AK MD WPVJ748 147-43-07.0 W 0002977528 CAPSTAR TX LIMITED PARTNERSHIPFAIRBANKS 04/03/2007 00944.50000 64-50-23.0 N TX MD WGI210 098-32-04.1 W 0002980460 CCB TEXAS LICENSES, L.P. SAN ANTONIO 04/04/2007 00949.00000 29-28-47.6 N NM MD WPXP430 104-31-23.8 W 0002982201 PECOS VALLEY BROADCASTING COMRoswell 04/05/2007 00948.00000 33-23-34.2 N AR MD WCQ539 094-07-43.7 W 0002984013 CAPSTAR TX LIMITED PARTNERSHIPFAYETTEVILLE 04/06/2007 00950.12500 36-06-16.3 N MS NE 088-46-15.1 W 0002974181 CITICASTERS LICENSES, L.P. TUPELO 03/30/2007 00951.00000 34-14-33.3 N NY NE 074-51-26.0 W 0002974459 THE ST. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272255A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272255A1.txt  
- Grant of Authority FROM: Current Licensee: Local TV Virginia License, LLC LOCAL TV, LLC Application for Consent to Assignment LOCAL TV, LLC E070035 SES-LIC-20070227-00281E Date Effective: 04/10/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 04/10/2007 - 04/10/2022 Application for Authority MOBILE SATELLITE CONNECTION, LLC Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 TRANSPORTABLE LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT OFFSAT" 44.40 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW STANDARD ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.90 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E070034 SES-LIC-20070228-00280E Date Effective: 04/10/2007 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272393A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272393A1.txt  
- NE 073-50-35.8 W 0002987934 FiberTower Network Services Corp. Ozone Park 04/10/2007 10835.00000 40-41-19.1 N NY NE 073-50-35.8 W 0002987934 FiberTower Network Services Corp. Ozone Park 04/10/2007 23025.00000 40-41-19.1 N NY NE 073-50-35.8 W 0002987934 FiberTower Network Services Corp. Ozone Park 04/10/2007 23075.00000 40-41-19.1 N NY NE 073-57-35.2 W 0002987937 FiberTower Network Services Corp. Brooklyn 04/10/2007 21870.00000 40-39-17.8 N NY NE 073-52-04.1 W 0002987938 FiberTower Network Services Corp. Rego Park 04/10/2007 17900.00000 40-43-18.8 N NY NE 073-51-54.4 W 0002987941 FiberTower Network Services Corp. Woodhaven 04/10/2007 21825.00000 40-41-31.2 N NY NE 073-50-37.9 W 0002987945 FiberTower Network Services Corp. Ozone Park 04/10/2007 21875.00000 40-40-29.4 N CA NE 117-22-32.3 W 0002988455 Los Angeles SMSA Limited Partnership Victorville 04/11/2007 10557.50000 34-28-10.8 N AL NE 086-33-18.7 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272415A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272415A1.txt  
- 11700.0000 - 12200.0000 MHz 54M0F8F ANALOG VIDEO 11700.0000 - 12200.0000 MHz 18M0F8F Points of Communication: 1 - ALSAT - (ALSAT) Page 3 of 13 E7106 SES-MOD-20070307-00309E Date Effective: 04/17/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 11/18/1997 - 11/18/2007 Application for Modification CRAWFORD COMMUNICATIONS, INC. Nature of Service:Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18 FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W Points of Communication: 1 - ALSAT - (ALSAT) E930303 SES-MOD-20070307-00311E Date Effective: 04/17/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 07/09/2003 - 07/09/2018 Application for Modification CRAWFORD COMMUNICATIONS, INC. Nature of Service:Fixed Satellite Service SITE ID: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272545A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272545A2.txt  
- at 5723-24, paras. 27-28. Currently, 165 routes are exempted from the ISP. See U.S.-Cambodia Route Exempted from the International Settlements Policy, Public Notice, IB Docket Nos. 02-324, 96-261, 20 FCC Rcd 963 (Int'l. Bur. 2005). 5 For example, carriers reported 4.8 billion minutes of non-traditional settlement traffic for Canada, and 1.9 billion minutes for the United Kingdom. They also reported 4.1 billion and 1.5 billion, respectively, minutes of traditional settlement traffic for each country. The Commission has permitted non-traditional settlement arrangements for U.S.-Canada and U.S.-U.K. traffic since 1992 and 1994, respectively. It is therefore unlikely that carriers are in fact settling substantial amounts of traffic on these two U.S. international routes under traditional settlement arrangements. 5 Reporting Requirements Different levels of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272549A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272549A1.txt  
- NO. 6, INC. PINEHURST 04/19/2007 06755.00000 35-15-16.0 N NC MD WMK834 079-28-50.0 W 0002998527 NORTH CAROLINA RSA NO. 6, INC. PINEHURST 04/19/2007 06820.00000 35-15-16.0 N NC MD WPOP939 079-26-47.1 W 0002998530 NORTH CAROLINA RSA NO. 6, INC. ABERDEEN 04/19/2007 06660.00000 35-08-30.6 N CA MD WQGG372 122-24-54.8 W 0002999142 Wiline Networks Inc San Francisco 04/19/2007 21535.00000 37-44-35.7 N CA MD WQGG371 122-24-04.1 W 0002999151 Wiline Networks Inc San Francisco 04/19/2007 22735.00000 37-47-24.0 N TN MD WMW611 085-37-54.0 W 0002999353 TENNESSEE RSA NO. 3 LIMITED PARTGAINESBORO 04/20/2007 06615.00000 36-18-42.0 N TN MD WMW611 085-37-54.0 W 0002999353 TENNESSEE RSA NO. 3 LIMITED PARTGAINESBORO 04/20/2007 10592.50000 36-18-42.0 N AZ MD WQGN780 112-04-27.4 W 0002999663 SPARKPLUG SOUTHWEST, LLC PHOENIX 04/20/2007 11345.00000 33-29-13.2 N AZ MD WQGN780 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272591A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272591A1.pdf  
- the admin. So there's nothing to be a surprise there. Of that 1.54 million, 85,000 will be paid by Canada and the Caribbean countries. That leaves the cost to be covered at 1.365 million for NANP admin. The next number is pooling. Right now it's highlighted because that is not a final number yet. We're just estimating right now. That 4.1 million is based on -- right now pooling can bill 296,000 maximum a month. So that adds up to about 3˝ million, and then they have a couple of change orders, 48 and 51, which might be another 500,000. So that's where we get the 4 million 1 hundred. As Amy mentioned before, their contract can be extended right now 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272809A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272809A1.txt  
- - ALSAT - (ALSAT) E070011 SES-MOD-20070320-00377E Date Effective: 04/30/2007 Class of Station: Fixed Earth Stations Grant of Authority 02/27/2007 - 02/27/2022 Application for Modification Crawford Communications, Inc. Nature of Service:Fixed Satellite Service 33 ° 53 ' 48.80 " N LAT. SITE ID: 1 3845 Pleasantdale Road, Dekalb, Atlanta, GA 84 ° 14 ' 18.90 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 72.40 dBW Standard Video with Associated Audio Sub-carriers 6334.0000 - 6425.0000 MHz 36M0F3F 66.40 dBW Standard Video with Associated Audio Sub-carriers 6297.0000 - 6334.0000 MHz 36M0F3F 72.40 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 36M0G1F 68.20 dBW Compressed Digital Video 5925.0000 - 6425.0000 MHz 3M00G1F 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272904A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272904A1.txt  
- Iowa 95.4 96.7 1.3 Kansas 94.9 94.5 -0.4 Kentucky 86.9 92.0 5.1 * Louisiana 88.9 94.9 6.0 * Maine 90.7 95.8 5.1 * Maryland 96.3 95.2 -1.0 Massachusetts 94.3 95.5 1.2 Michigan 93.8 94.3 0.5 Minnesota 96.4 98.0 1.6 Mississippi 82.4 90.7 8.3 * Missouri 92.1 95.4 3.3 * Montana 92.8 93.3 0.6 Nebraska 94.0 92.5 -1.5 Nevada 89.4 93.5 4.1 * New Hampshire 95.0 96.7 1.7 New Jersey 94.1 95.7 1.5 New Mexico 85.3 89.4 4.1 * New York 90.8 91.3 0.5 North Carolina 89.3 93.0 3.7 * North Dakota 95.1 96.9 1.8 Ohio 92.2 94.0 1.8 Oklahoma 91.5 92.7 1.2 Oregon 91.2 96.3 5.1 * Pennsylvania 95.1 96.6 1.5 * Rhode Island 93.3 93.4 0.1 South Carolina 81.8 92.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272906A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272906A1.txt  
- 16,792 16,918 16,401 9,271 9,061 9,176 9,016 9,234 14,299 14,123 13,920 13,415 13,480 13,532 6,482 6,714 6,607 6,714 6,643 10,746 10,395 10,425 10,320 10,298 10,164 10,966 11,435 12,337 13,209 13,459 22,296 22,648 21,655 21,713 21,064 21,188 49,682 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 75,939 * Current dollar equivalents are at the end of Table 4 82 Alabama 4.1 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.6 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.5 Hawaii 3.1 Oregon 3.1 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272912A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272912A1.txt  
- York 05/01/2007 10915.00000 40-42-49.5 N NY NE 073-51-12.5 W 0003012561 NEW YORK, CITY OF Queens 05/01/2007 06226.89000 40-41-54.5 N NY NE 073-51-12.5 W 0003012561 NEW YORK, CITY OF Queens 05/01/2007 06256.54000 40-41-54.5 N NY NE 073-51-12.5 W 0003012561 NEW YORK, CITY OF Queens 05/01/2007 06660.62500 40-41-54.5 N NY NE 073-59-30.9 W 0003012562 NEW YORK, CITY OF New York 05/01/2007 10623.12500 40-45-04.1 N NY NE 073-52-29.0 W 0003012563 NEW YORK, CITY OF Bronx 05/01/2007 06315.84000 40-50-32.1 N NY NE 073-52-29.0 W 0003012563 NEW YORK, CITY OF Bronx 05/01/2007 11445.00000 40-50-32.1 N NY NE 074-05-25.6 W 0003012564 NEW YORK, CITY OF Staten Island 05/01/2007 05945.20000 40-37-12.2 N NY NE 074-05-25.6 W 0003012564 NEW YORK, CITY OF Staten Island 05/01/2007 11405.00000 40-37-12.2 N NY 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272940A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-272940A1.txt  
- dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 6M84G7W 54.50 dBW 5925.0000 - 6425.0000 MHz 81K9G7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 11M2G7W 71.50 dBW 5925.0000 - 6425.0000 MHz 35M9G7W 65.89 dBW 5925.0000 - 6425.0000 MHz 618KG7W- 71.50 dBW 5925.0000 - 6425.0000 MHz 20M3G7W 3700.0000 - 4200.0000 MHz 53.60 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- ANDREW 4.1M 4.1 meters ANTENNA ID: "18 FT" OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 18M0F8F- 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 72.40 dBW 5925.0000 - 6425.0000 MHz 9M00G1F 72.40 dBW 5925.0000 - 6425.0000 MHz 24M0G7F 56.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 53.02 dBW 5925.0000 - 6425.0000 MHz 38K4G7E Page 7 of 14 54.55 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273042A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273042A1.txt  
- 39-45-37.5 N OH MD WQGU866 084-11-39.8 W 0003026260 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 17815.00000 39-45-37.5 N OH MD WQGU866 084-11-39.8 W 0003026260 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 17865.00000 39-45-37.5 N OH MD WQGU866 084-11-39.8 W 0003026260 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 17920.00000 39-45-37.5 N OH MD WQGU881 084-08-26.6 W 0003026262 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 19425.00000 39-45-04.1 N OH MD WQGU861 084-15-16.3 W 0003026265 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 19440.00000 39-48-15.9 N Page 25 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OH MD WQGU861 084-15-16.3 W 0003026265 CLEARWIRE SPECTRUM HOLDINGS II Dayton 05/11/2007 19480.00000 39-48-15.9 N OH MD WQGU873 084-12-31.1 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273075A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273075A1.txt  
- - 14500.0000 MHz 230KG7W Digitally encoded audio and data @ 192 Kbps, QPSK, 1/2 FEC 11700.0000 - 12200.0000 MHz 230KG7W Points of Communication: College Place - PERMITTED LIST - () Page 4 of 6 E9268 SES-MOD-20070501-00535E Class of Station: Fixed Earth Stations Application for Modification Remote Manage, Inc. Nature of Service:Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW STANDARD ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.90 dBW DIGITAL TRAFFIC, VARIOUS INFO, FEC AND DATA RATES 5925.0000 - 6425.0000 MHz 36M0G7W 54.00 dBW DIGITAL TRAFFIC, VARIOUS INFO, FEC AND DATA RATES 5925.0000 - 6425.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E990100 SES-MOD-20070508-00565E Class of Station: Fixed Earth Stations 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273170A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273170A1.txt  
- 41-48-21.2 N Page 31 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 080-09-04.0 W 0003032707 Conterra Ultra Broadband, LLC Waynesburg 05/18/2007 21825.00000 39-53-37.7 N PA NE 080-03-51.6 W 0003032725 Conterra Ultra Broadband, LLC Jefferson 05/18/2007 19360.00000 39-55-41.2 N PA NE 080-09-04.1 W 0003032729 Conterra Ultra Broadband, LLC Waynesburg 05/18/2007 23025.00000 39-53-43.4 N PA NE 080-09-04.1 W 0003032729 Conterra Ultra Broadband, LLC Waynesburg 05/18/2007 23125.00000 39-53-43.4 N PA NE 080-09-04.1 W 0003032729 Conterra Ultra Broadband, LLC Waynesburg 05/18/2007 23175.00000 39-53-43.4 N PA NE 080-10-05.4 W 0003032735 Conterra Ultra Broadband, LLC FRANKLIN TWP. 05/18/2007 11485.00000 39-54-52.3 N PA NE 080-10-05.4 W 0003032735 Conterra 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273209A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273209A1.txt  
- - ALSAT - (ALSAT) E990518 SES-MOD-20070514-00654E Class of Station: Fixed Earth Stations Application for Modification Atlantic Telecommunications Services Corp. Nature of Service:Fixed Satellite Service "MOD" to change remote conrol point. 42 ° 37 ' 30.00 " N LAT. SITE ID: 1 SR99, 4240 N. MICHIGAN ROAD, EATON, DIMONDALE, MI 84 ° 37 ' 29.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M60G1F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 8M60G1F Points of Communication: 1 - ALSAT - (ALSAT) E070090 SES-REG-20070514-00645E Class of Station: Fixed Earth Stations Registration COMCAST OF FRESNO, INC. Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service 36 ° 8 ' 36.70 " N LAT. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273211A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273211A1.txt  
- 14000.0000 - 14500.0000 MHz 8M00G7W 11700.0000 - 12200.0000 MHz 8M00G7W Points of Communication: 1 - ALSAT - (ALSAT) E970357 SES-RWL-20070521-00682E Date Effective: 05/22/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 08/08/2007 - 08/08/2022 Renewal International Sound Corporation Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 THROUGHOUT THE U.S. & ITS TERR. (#3), VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18 FT" (OFFSAT) 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9F Points of Communication: 1 - ALSAT - (ALSAT) E970356 SES-RWL-20070521-00683E Date Effective: 05/22/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 08/08/2007 - 08/08/2022 Renewal International Sound Corporation Page 12 of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273340A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273340A1.txt  
- N CA NE 119-08-44.7 W 0003038911 Cardiology Associates Medical Group Inc.Oxnard 05/22/2007 17960.00000 34-13-01.8 N CA NE 119-15-23.2 W 0003038936 Cardiology Associates Medical Group, IncVentura 05/22/2007 18000.00000 34-16-28.6 N NE NE P 098-50-34.8 W 0003039404 CITY OF GIBBON GIBBON 05/22/2007 00956.41875 40-44-49.2 N NE NE P 095-53-25.8 W 0003039418 CITY OF PLATTSMOUTH PLATTSMOUTH 05/22/2007 00956.44375 41-00-31.0 N MI NE P 085-25-04.1 W 0003039428 GITY OF GALESBURG GALESBURG 05/22/2007 00952.70625 42-17-26.2 N AZ NE 112-12-15.4 W 0003039475 Comment Four Corners, LLC Williams, AZ 05/22/2007 06093.45000 35-11-58.5 N MI NE P 086-03-02.2 W 0003039645 VILLAGE OF LAWRENCE LAWRENCE 05/22/2007 00952.81875 42-13-09.5 N LA NE 090-04-16.3 W 0003041837 New Orleans Hearst-Argyle Television, IncNew Orleans 05/24/2007 23235.00000 29-57-01.2 N LA NE 090-04-16.3 W 0003041837 New 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273365A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273365A1.txt  
- Inc. Nature of Service:Domestic Fixed Satellite Service, Fixed Satellite Service "MOD" to change its existing C-band earth station license from temporary-fixed to fixed. Page 10 of 16 35 ° 9 ' 48.00 " N LAT. SITE ID: 1 1550 N. INGRAM BOULEVARD (TRUCK 10), CRITTENDEN, WEST MEMPHIS, AR 90 ° 9 ' 38.00 " W LONG. LOCATION: COMTECH TRUCK 10 4.1 meters ANTENNA ID: OFFSAT "18 FT" 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060116 SES-MOD-20070518-00677E Class of Station: Fixed Earth Stations Application for Modification RCN License Subsidiary, Inc. Nature of Service:Domestic Fixed Satellite Service "MOD" to change its existing C-band earth station license from temporary-fixed to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273647A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273647A1.txt  
- - (ALSAT) E970324 SES-RWL-20070523-00702E Date Effective: 06/01/2007 Class of Station: Fixed Earth Stations Grant of Authority 07/25/2007 - 07/25/2022 Renewal Educational Information Corporation Nature of Service:Domestic Fixed Satellite Service 35 ° 56 ' 29.00 " N LAT. SITE ID: 1 1928 STATE ROAD, WAKE, WAKE FOREST, NC 78 ° 28 ' 33.00 " W LONG. LOCATION: COMTECH ANT CORP. 1 4.1 meters ANTENNA ID: "18 FT." OFFSAT 55.90 dBW 5925.0000 - 6125.0000 MHz 200KG7D 3700.0000 - 4200.0000 MHz 200KG7D Points of Communication: 1 - ALSAT - (ALSAT) E970315 SES-RWL-20070523-00708E Date Effective: 06/01/2007 Class of Station: Fixed Earth Stations Grant of Authority 07/18/2007 - 07/18/2022 Renewal Juniper Content Corporation Nature of Service:Domestic Fixed Satellite Service 32 ° 47 ' 26.00 " N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273956A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-273956A1.txt  
- 35-57-22.9 N NC NE 078-54-12.8 W 0003062997 FiberTower Network Service Corp. DURHAM 06/07/2007 10715.00000 36-03-33.4 N NC NE 078-54-12.8 W 0003062997 FiberTower Network Service Corp. DURHAM 06/07/2007 10875.00000 36-03-33.4 N NC NE 080-01-07.1 W 0003062998 FiberTower Network Service Corp. COLFAX 06/07/2007 11325.00000 36-05-53.5 N NC NE 080-01-07.1 W 0003062998 FiberTower Network Service Corp. COLFAX 06/07/2007 23185.00000 36-05-53.5 N NC NE 080-35-04.1 W 0003062999 FiberTower Network Service Corp. MONROE 06/07/2007 11365.00000 35-01-43.1 N NC NE 078-55-03.0 W 0003063000 FiberTower Network Service Corp. Durham 06/07/2007 10755.00000 36-05-05.1 N NC NE 078-55-03.0 W 0003063000 FiberTower Network Service Corp. Durham 06/07/2007 10935.00000 36-05-05.1 N NC NE 079-58-27.0 W 0003063001 FiberTower Network Service Corp. ARCHDALE 06/07/2007 11345.00000 35-53-05.0 N NC NE 079-58-27.0 W 0003063001 FiberTower Network 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274374A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274374A1.txt  
- PHOENIX 06/15/2007 10618.75000 33-25-47.1 N AZ MD WNTL779 112-06-31.5 W 0003073298 ARIZONA, STATE OF PHOENIX 06/15/2007 10995.00000 33-25-47.1 N CO NE 108-54-29.0 W 0003064379 STATE OF COLORADO EGNAR 06/08/2007 06795.62500 37-56-29.0 N WA NE 119-17-44.7 W 0003065500 OREGON, STATE OF WASHINGTON 06/11/2007 06004.50000 45-58-49.4 N WA NE 119-17-44.7 W 0003065500 OREGON, STATE OF WASHINGTON 06/11/2007 06123.10000 45-58-49.4 N OR NE 122-33-04.1 W 0003065501 OREGON, STATE OF PORTLAND 06/11/2007 06286.19000 45-27-16.0 N OR NE 122-33-04.1 W 0003065501 OREGON, STATE OF PORTLAND 06/11/2007 10755.00000 45-27-16.0 N Page 8 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR NE 122-39-28.6 W 0003065502 OREGON, STATE OF PORTLAND 06/11/2007 11245.00000 45-31-44.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274414A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274414A1.txt  
- Communication: Opa-Locka East - ALSAT - (ALSAT) Opa-Locka East - ALSAT - (ALSAT) Opa-Locka East - ALSAT - (ALSAT) Page 4 of 8 E9268 SES-MOD-20070501-00535 E Date Effective: 06/18/2007 Class of Station: Fixed Earth Stations Grant of Authority 10/26/1998 - 10/26/2008 Application for Modification Remote Manage, Inc. Nature of Service: Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW STANDARD ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.90 dBW DIGITAL TRAFFIC, VARIOUS INFO, FEC AND DATA RATES 5925.0000 - 6425.0000 MHz 36M0G7W 54.00 dBW DIGITAL TRAFFIC, VARIOUS INFO, FEC AND DATA RATES 5925.0000 - 6425.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E8454 SES-MOD-20070510-00586 E Date Effective: 06/18/2007 Class of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274572A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274572A1.txt  
- Corp. YOUNGSTOWN 06/19/2007 19675.00000 41-06-00.2 N OH NE 080-41-36.6 W 0003076843 FiberTower Network Service Corp. Girard 06/19/2007 10795.00000 41-08-35.5 N OH NE 080-33-02.5 W 0003076844 FiberTower Network Service Corp. HUBBARD 06/19/2007 18120.00000 41-09-32.4 N OH NE 080-29-02.3 W 0003076845 FiberTower Network Service Corp. Farrell 06/19/2007 10795.00000 41-12-58.2 N OH NE 080-39-53.3 W 0003076846 FiberTower Network Service Corp. VIENNA 06/19/2007 10835.00000 41-14-04.1 N OH NE 080-37-19.1 W 0003076847 FiberTower Network Service Corp. Youngstown 06/19/2007 23120.00000 41-07-01.4 N OH NE 080-41-33.2 W 0003076848 FiberTower Network Service Corp. YOUNGSTOWN 06/19/2007 19620.00000 41-05-30.6 N OH NE 080-44-01.3 W 0003076849 FiberTower Network Service Corp. Youngstown 06/19/2007 10855.00000 41-04-51.4 N OH NE 080-44-01.3 W 0003076849 FiberTower Network Service Corp. Youngstown 06/19/2007 18060.00000 41-04-51.4 N OH NE 080-44-01.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274613A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274613A1.txt  
- 06/26/2007 Class of Station: Fixed Earth Stations Grant of Authority 01/21/2000 - 01/21/2010 Application for Modification Atlantic Telecommunications Services Corp. Nature of Service: Fixed Satellite Service Page 5 of 11 42 ° 37 ' 30.00 " N LAT. SITE ID: 1 SR99, 4240 N. MICHIGAN ROAD, EATON, DIMONDALE, MI 84 ° 37 ' 29.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M60G1F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 8M60G1F Points of Communication: 1 - ALSAT - (ALSAT) E970276 SES-RWL-20070618-00827 E Date Effective: 06/20/2007 Class of Station: Fixed Earth Stations Grant of Authority 07/25/2007 - 07/25/2022 Renewal MCI Communications Services, Inc. (fka MCI WorldCom Communications, Inc.) Nature of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274823A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-274823A1.txt  
- Effective: 07/02/2007 Class of Station: Fixed Earth Stations Grant of Authority 05/22/2006 - 05/22/2021 Application for Modification RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service 32 ° 24 ' 44.50 " N LAT. SITE ID: 1 8680 COUNTY ROAD 40 TRUCK 6, MACON, SHORTER, AL 85 ° 56 ' 44.30 " W LONG. LOCATION: COMTECH TRUCK 6 4.1 meters ANTENNA ID: "OFFSAT"18FT 69.88 dBW Digital TV and Audio QPSK Modulation 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E060126 SES-MOD-20070525-00724 E Date Effective: 07/02/2007 Class of Station: Fixed Earth Stations Grant of Authority 05/22/2006 - 05/22/2021 Application for Modification RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service 18 ° 22 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275087A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275087A1.txt  
- 14500.0000 MHz 24M0G7F 66.91 dBW PSK Digital Video w/digital audio/data 14000.0000 - 14500.0000 MHz 36M0G7F Points of Communication: DC ENG - PERMITTED LIST - () E070137 SES-LIC-20070706-00902 E Class of Station: Temporary Fixed Earth Station Application for Authority THE SATELLITE CENTER, INC. Nature of Service: Fixed Satellite Service SITE ID: 1 VARIOUS LOCATIONS THROUGHOUT, CONUS, AK, HI LOCATION: COMTECH T1 4.1 meters ANTENNA ID: OFFSAT ANALOG VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 3700.0000 - 4200.0000 MHz 36M0F8W DIGITAL VIDEO, AUDIO, AND DATA 3700.0000 - 4200.0000 MHz 100KG7W- DIGITAL VIDEO, AUDIO, AND DATA 3700.0000 - 4200.0000 MHz 72M0G7W 72.40 dBW ANALOG VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW DIGITAL VIDEO, AUDIO, AND DATA 5925.0000 - 6425.0000 MHz 72M0G7W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275088A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275088A1.txt  
- Station: Fixed Earth Stations Grant of Authority 05/22/2006 - 05/22/2021 Application for Modification RCN LICENSE SUBSIDIARY, INC. Nature of Service: Domestic Fixed Satellite Service, Fixed Satellite Service 35 ° 9 ' 48.00 " N LAT. SITE ID: 1 1550 N. INGRAM BOULEVARD (TRUCK 10), CRITTENDEN, WEST MEMPHIS, AR 90 ° 9 ' 38.00 " W LONG. LOCATION: COMTECH TRUCK 10 4.1 meters ANTENNA ID: OFFSAT "18 FT" 69.88 dBW DIGITAL TV AND AUDIO QPSK MODULATION 5925.0000 - 6425.0000 MHz 4M50G7W Points of Communication: 1 - ALSAT - (ALSAT) E050333 SES-MOD-20070525-00722 E Date Effective: 07/09/2007 Class of Station: Fixed Earth Stations Grant of Authority 01/10/2006 - 01/10/2021 Application for Modification CapRock Communications, Inc. Nature of Service: Fixed Satellite Service 27 ° 22 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275322A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275322A1.txt  
- MHz 36M0F8W IDR, IBS 3625.0000 - 4200.0000 MHz 36M0G7W Points of Communication: 1 - PERMITTED LIST - () E920453 SES-RWL-20070712-00931 E Date Effective: 07/17/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 08/07/2007 - 08/07/2022 Renewal Ascent Media Network Services, Inc. Nature of Service: Domestic Fixed Satellite Service, Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 5.5 OFST 847130 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E873439 SES-RWL-20070712-00932 E Date Effective: 07/17/2007 Class of Station: Fixed Earth Stations Grant of Authority 08/07/2007 - 08/07/2022 Renewal KWGN Inc. Nature of Service: Domestic Fixed Satellite Service 39 ° 36 ' 15.30 " N LAT. SITE ID: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275483A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275483A1.txt  
- 38-55-04.2 N KS NE 094-39-24.0 W 0003115998 Mid America Regional Council EmergencyOverland Park 07/19/2007 19460.00000 38-55-04.2 N PA NE 076-53-00.6 W 0003116042 DAUPHIN COUNTY EMERGENCY MANAHARRISBURG 07/19/2007 06765.00000 40-15-37.7 N NY NE 077-49-35.0 W 0003116450 LIVINGSTON, COUNTY OF Mt. Morris 07/19/2007 18085.00000 42-43-51.7 N NY NE 077-53-11.0 W 0003116451 LIVINGSTON, COUNTY OF Mt. Morris 07/19/2007 19645.00000 42-44-00.0 N PA NE 076-44-04.1 W 0003116676 DAUPHIN COUNTY EMERGENCY MANAMiddletown 07/20/2007 06197.24000 40-12-57.3 N PA NE 076-44-04.1 W 0003116676 DAUPHIN COUNTY EMERGENCY MANAMiddletown 07/20/2007 06286.19000 40-12-57.3 N PA NE 076-44-04.1 W 0003116676 DAUPHIN COUNTY EMERGENCY MANAMiddletown 07/20/2007 06675.62500 40-12-57.3 N UT NE 109-15-07.4 W 0003117346 University of Utah - Utah Education NetwoLaSal 07/20/2007 06226.89000 38-18-46.8 N Page 7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275804A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275804A1.txt  
- 111-12-09.5 W 0003127182 CNG Communications, Inc. TUBA CITY 08/01/2007 06615.00000 36-21-30.0 N AZ MD KPH82 111-12-09.5 W 0003127182 CNG Communications, Inc. TUBA CITY 08/01/2007 06665.00000 36-21-30.0 N AZ MD KPH82 111-12-09.5 W 0003127182 CNG Communications, Inc. TUBA CITY 08/01/2007 10735.00000 36-21-30.0 N AZ MD KPH82 111-12-09.5 W 0003127182 CNG Communications, Inc. TUBA CITY 08/01/2007 17855.00000 36-21-30.0 N AZ MD WQFN861 111-03-04.1 W 0003127187 Trillion Partners, Inc. Tucson 08/01/2007 19400.00000 32-22-45.7 N AZ MD WQFN861 111-03-04.1 W 0003127187 Trillion Partners, Inc. Tucson 08/01/2007 21825.00000 32-22-45.7 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD WQFN861 111-03-04.1 W 0003127187 Trillion Partners, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275965A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275965A1.txt  
- OCONEE EMC JEFFERSONVILLE 08/10/2007 00928.28750 32-41-53.0 N GA NE 083-13-29.0 W 0003134980 OCONEE EMC JEFFERSONVILLE 08/10/2007 00952.28750 32-41-53.0 N MN NE 093-54-26.0 W 0003135074 Ridgeview Medical Center NORWOOD 08/10/2007 10551.25000 44-47-20.0 N MN NE 093-47-32.7 W 0003135077 Ridgeview Medical Center WACONIA 08/10/2007 10616.25000 44-50-35.0 N GM NE 093-40-15.0 W 0003135192 EPEC Communications Corporation Offshore 08/10/2007 00933.37500 27-57-43.9 N GM NE 093-31-04.1 W 0003135198 EPEC Communications Corporation Offshore 08/10/2007 00942.37500 28-00-50.0 N ID NE 116-45-56.3 W 0003135213 AVISTA CORPORATION Coeur d Alene 08/10/2007 11405.00000 47-41-31.1 N TX NE 096-58-59.0 W 0003135455 Universal Display & Fixture Company LEWISVILLE 08/10/2007 17755.00000 33-00-19.9 N TX NE 096-58-59.0 W 0003135455 Universal Display & Fixture Company LEWISVILLE 08/10/2007 17785.00000 33-00-19.9 N TX NE 097-01-59.1 W 0003135528 Universal 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275999A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-275999A1.txt  
- for video/voice/data 14000.0000 - 14500.0000 MHz 36M0G7W Points of Communication: 1 - PERMITTED LIST - () E070137 SES-LIC-20070706-00902 E Date Effective: 08/14/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 08/14/2007 - 08/14/2022 Application for Authority THE SATELLITE CENTER, INC. Nature of Service: Fixed Satellite Service SITE ID: 1 VARIOUS LOCATIONS THROUGHOUT, CONUS, AK, HI LOCATION: COMTECH T1 4.1 meters ANTENNA ID: OFFSAT ANALOG VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 3700.0000 - 4200.0000 MHz 36M0F8W Page 1 of 11 DIGITAL VIDEO, AUDIO, AND DATA 3700.0000 - 4200.0000 MHz 100KG7W- DIGITAL VIDEO, AUDIO, AND DATA 3700.0000 - 4200.0000 MHz 72M0G7W 72.40 dBW ANALOG VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW DIGITAL VIDEO, AUDIO, AND DATA 5925.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276117A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276117A1.txt  
- N AZ NE 113-08-17.1 W 0003137463 Commnet Four Corners, LLC Hyder 08/13/2007 06393.05400 33-03-04.9 N TN NE 084-32-18.6 W 0003137780 TENNESSEE RSA NO. 3 LIMITED PARTHarriman 08/14/2007 06775.00000 36-00-41.2 N IL NE 089-41-01.3 W 0003138418 USCOC OF GREATER MISSOURI, LLCTRENTON 08/14/2007 06004.50000 38-36-52.1 N IL NE 089-41-01.3 W 0003138418 USCOC OF GREATER MISSOURI, LLCTRENTON 08/14/2007 06063.80000 38-36-52.1 N IL NE 089-54-04.1 W 0003138431 USCOC OF GREATER MISSOURI, LLCO' FALLON 08/14/2007 06315.84000 38-37-40.6 N CA NE 118-13-18.5 W 0003138559 COLOR BROAD BAND INC COMPTON 08/14/2007 17875.00000 33-52-29.1 N MA NE 071-08-16.8 W 0003139022 Cellco Partnership Lawrence 08/15/2007 10582.50000 42-42-58.0 N OR NE 123-23-07.9 W 0003139072 Edge Wireless Licenses, LLC Roseburg 08/15/2007 10618.12500 43-18-03.2 N CA NE 122-58-50.5 W 0003139076 Edge Wireless Licenses, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276308A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276308A1.txt  
- 12200.0000 MHz 36M0F3F 11700.0000 - 12200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E970430 SES-RWL-20070820-01109 E Date Effective: 08/24/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 10/10/2007 - 10/10/2022 Renewal RCN License Subsidiary, Inc. Page 36 of 42 Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH ANT. CORP. 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 70.20 dBW 5925.0000 - 6425.0000 MHz 8M60G7D 51.20 dBW PM modulation digital video 5925.0000 - 6425.0000 MHz 8M12G7W 50.20 dBW PM modulation digital video 5925.0000 - 6425.0000 MHz 6M06G7W 44.20 dBW PM modulation voice and data 5925.0000 - 6425.0000 MHz 1M54G7W 69.40 dBW PM modulation analog video 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276392A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276392A1.txt  
- TRILLION PARTNERS, INC. NEW BOSTON 08/24/2007 21935.00000 33-26-40.0 N TX NE 094-42-56.8 W 0003150169 TRILLION PARTNERS, INC. DAINGERFIELD 08/24/2007 21885.00000 33-02-10.2 N TX NE 095-19-05.0 W 0003150176 TRILLION PARTNERS, INC. DEPORT 08/24/2007 19465.00000 33-31-32.3 N TX NE 095-31-16.4 W 0003150179 TRILLION PARTNERS, INC. POWDERLY 08/24/2007 17935.00000 33-48-49.6 N TX NE 094-24-32.6 W 0003150184 TRILLION PARTNERS, INC. NEW BOSTON 08/24/2007 21985.00000 33-28-04.1 N Page 18 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 094-25-31.0 W 0003150193 TRILLION PARTNERS, INC. NEW BOSTON 08/24/2007 21885.00000 33-28-14.0 N TX NE 094-25-31.0 W 0003150193 TRILLION PARTNERS, INC. NEW BOSTON 08/24/2007 21935.00000 33-28-14.0 N TX NE 094-43-07.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276539A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276539A1.txt  
- WME965 084-09-34.4 W 0003162757 RADIO ONE OF DAYTON LICENSES, LLDayton 09/05/2007 00946.00000 39-40-53.2 N OH MD WLO867 083-47-12.7 W 0003162761 BLUE CHIP BROADCASTING LICENSESSpringfield 09/05/2007 00946.50000 39-57-55.2 N OH MD WLO867 083-47-12.7 W 0003162761 BLUE CHIP BROADCASTING LICENSESSpringfield 09/05/2007 00946.62500 39-57-55.2 N TX MD WHB742 097-23-28.9 W 0003162792 SOUTH TEXAS PUBLIC BROADCASTINCORPUR CHRISTI 09/05/2007 00947.50000 27-42-58.1 N OR MD WGX45 122-45-04.1 W 0003164436 MAPLETON COMMUNICATIONS, LLC MEDFORD 09/06/2007 00947.50000 42-17-51.5 N OR MD WDF27 122-54-40.0 W 0003164444 MAPLETON COMMUNICATIONS, LLC MEDFORD 09/06/2007 00951.00000 42-20-30.0 N LA MD WPOT237 091-46-37.0 W 0003164515 CITADEL BROADCASTING COMPANYPARKS 09/06/2007 00946.50000 30-12-07.0 N LA MD WPOT238 092-04-31.0 W 0003164533 CITADEL BROADCASTING COMPANYLafayette 09/06/2007 00950.25000 30-13-35.0 N VT NE 073-09-02.4 W 0003160718 VERMONT PUBLIC RADIO Colchester 09/04/2007 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276695A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276695A1.txt  
- 09/14/2007 06835.00000 39-41-18.1 N IN MD KSE82 086-45-29.0 W 0003171774 Duke Energy Carolinas, LLC FILLMORE 09/14/2007 06855.00000 39-41-18.1 N TX MD WQEZ865 106-23-28.1 W 0003172319 INTERNATIONAL OUTSOURCING SERVEL PASO 09/14/2007 22477.00000 31-46-24.4 N OR NE 122-41-44.4 W 0003166547 CLEARWIRE SPECTRUM HOLDINGS II PORTLAND 09/10/2007 18115.00000 45-29-19.4 N WY NE 110-31-17.7 W 0003166551 PacifiCorp Evanston 09/10/2007 00955.55000 41-17-41.5 N GM NE 093-31-04.1 W 0003166569 EPEC Communications Corporation Offshore 09/10/2007 00942.37500 28-00-50.0 N GM NE 093-40-15.0 W 0003166613 EPEC Communications Corporation 09/10/2007 00933.37500 27-57-43.9 N IA NE 094-53-47.7 W 0003167789 CORN BELT POWER COOPERATIVE TERRIL 09/10/2007 06197.24000 43-20-07.0 N IA NE 094-53-47.7 W 0003167789 CORN BELT POWER COOPERATIVE TERRIL 09/10/2007 06345.49000 43-20-07.0 N IA NE 095-06-40.7 W 0003167795 CORN BELT POWER COOPERATIVE MILFORD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276709A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-276709A1.txt  
- Gravel Inc 159.52500000 -- -- 4 1 08/10/2007 WPVX540 FB R&L TRANSFER, INC. 160.05000000 ROCKFORD 42-22-2.0 N IL 89-5-13.0 W 1 1 08/10/2007 WPVX540 MO R&L TRANSFER, INC. 160.05000000 42-22-2.0 N 89-5-13.0 W 2 1 08/14/2007 WQDK400 MO Rutherford Board of Education 72.34000000 Rutherford 40-50-12.6 N NJ 74-6-54.9 W 3 1 08/10/2007 WQFL495 MO GEPHART ELECTRICAL CONSTRUCTION 451.18750000 NEW BUFFALO 41-47-4.1 N MI 86-42-15.3 W 1 1 08/10/2007 WQFL495 MO GEPHART ELECTRICAL CONSTRUCTION 451.23750000 NEW BUFFALO 41-47-4.1 N MI 86-42-15.3 W 1 1 Page 3 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. IG - Industrial/Business Pool, Conventional Mobility Division 08/10/2007 WQFL495 MO GEPHART ELECTRICAL CONSTRUCTION 451.31250000 NEW 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277038A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277038A1.txt  
- 102-10-27.5 W 0003184561 WWC TEXAS RSA LIMITED PARTNERSMcCamey 09/28/2007 06093.45000 31-18-11.5 N TX MD WPJB375 102-10-27.5 W 0003184561 WWC TEXAS RSA LIMITED PARTNERSMcCamey 09/28/2007 06402.32000 31-18-11.5 N TX MD WPJB375 102-10-27.5 W 0003184561 WWC TEXAS RSA LIMITED PARTNERSMcCamey 09/28/2007 06595.00000 31-18-11.5 N TX MD WPJB375 102-10-27.5 W 0003184561 WWC TEXAS RSA LIMITED PARTNERSMcCamey 09/28/2007 06675.00000 31-18-11.5 N TX MD WQCH493 102-41-04.1 W 0003184565 WWC Texas RSA Limited Partnership Imperial 09/28/2007 06835.00000 31-16-28.5 N WV MD WQBN796 079-47-18.3 W 0003184630 EASTERBROOKE CELLULAR CORPORAKelley Mountain 09/28/2007 06615.00000 38-54-40.5 N WV MD WQBN796 079-47-18.3 W 0003184630 EASTERBROOKE CELLULAR CORPORAKelley Mountain 09/28/2007 10587.50000 38-54-40.5 N WV MD WQBL517 079-34-54.7 W 0003184701 EASTERBROOKE CELLULAR CORPORAThomas 09/28/2007 06775.00000 39-08-24.0 N TN MD WMS485 086-26-04.9 W 0003184773 Verizon 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277546A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277546A1.txt  
- 6425.0000 MHz 351KG7D Points of Communication: 1 - ALSAT - (ALSAT) E880105 SES-RWL-20071019-01439 E Date Effective: Class of Station: Fixed Earth Stations Renewal QVC, Inc. Nature of Service: Domestic Fixed Satellite Service 39 ° 59 ' 19.00 " N LAT. SITE ID: 1 CHESTER, EAST GOSHEN, PA 75 ° 33 ' 33.00 " W LONG. LOCATION: COMTECH ANTENNA CORP 1 4.1 meters ANTENNA ID: . 72.40 dBW 5925.0000 - 6425.0000 MHz 36000F9 Page 39 of 40 For more information concerning this Notice, contact the Satellite and Radiocommunication Division at 418-0719; TTY 202-418-2555. 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E950499 SES-STA-20071016-01424 E Date Effective: 10/18/2007 Class of Station: Grant of Authority Special Temporary Authority DG 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277721A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277721A1.txt  
- WA NE 122-18-36.8 W 0003206584 Towerstream Corp Seattle 10/22/2007 23020.00000 47-36-25.2 N WA NE 122-18-36.8 W 0003206584 Towerstream Corp Seattle 10/22/2007 23220.00000 47-36-25.2 N WA NE 122-20-03.3 W 0003206585 Towerstream Corp Seattle 10/22/2007 21820.00000 47-36-31.5 N WA NE 122-20-02.5 W 0003206586 Towerstream Corp Seattle 10/22/2007 22020.00000 47-36-21.9 N WI NE 090-36-52.3 W 0003206732 UNITED STATES CELLULAR OPERATINHazel Green 10/23/2007 06775.00000 42-31-04.1 N ME NE 068-16-45.3 W 0003206976 BANGOR CELLULAR TELEPHONE, L.P.Lee 10/23/2007 06605.00000 45-21-07.5 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 121-46-31.0 W 0003207181 WiLine Networks San Jose 10/23/2007 17875.00000 37-12-32.1 N WI NE 089-22-48.4 W 0003207215 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277749A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277749A1.txt  
- E880105 SES-RWL-20071019-01439 E Date Effective: 10/26/2007 Class of Station: Fixed Earth Stations Grant of Authority 12/24/2007 - 12/24/2022 Renewal QVC, Inc. Nature of Service: Domestic Fixed Satellite Service Page 6 of 15 39 ° 59 ' 19.00 " N LAT. SITE ID: 1 CHESTER, EAST GOSHEN, PA 75 ° 33 ' 33.00 " W LONG. LOCATION: COMTECH ANTENNA CORP 1 4.1 meters ANTENNA ID: . 72.40 dBW 5925.0000 - 6425.0000 MHz 36000F9 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E970051 SES-RWL-20071022-01446 E Date Effective: 10/23/2007 Class of Station: Fixed Earth Stations Grant of Authority 12/12/2007 - 12/12/2022 Renewal PanAmSat Licensee Corp. Nature of Service: Domestic Fixed Satellite Service 34 ° 24 ' 21.00 " N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277784A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-277784A1.txt  
- 20.9 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Fixed Wireless 75.7 19.2 4.2 0.8 0.1 0.0 0.0 0.0 0.0 0.0 0.0 Mobile Wireless 12.8 33.4 38.4 13.4 1.9 0.1 0.0 0.0 0.0 0.0 0.0 Power Line and/or Other 1 81.8 12.1 4.8 1.1 0.2 0.0 0.0 0.0 0.0 0.0 0.0 ADSL and/or Cable Modem 10.5 24.3 22.8 16.5 11.2 7.3 4.1 2.0 0.8 0.4 0.1 All Technologies 0.4 2.4 5.7 8.9 11.4 12.5 11.7 10.0 8.3 6.7 22.0 Figures may not add up to 100% due to rounding. 1 Other includes high-speed lines provided over traditional wireline facilities such as T-carrier and also lines provided over any technology that is not specified in the table. Table 16 Percentage of Zip Codes 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278044A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278044A1.pdf  
- Section 1.4 When requesting new or incremental p-ANI ranges, the p-ANI Applicant shall check the appropriate box to indicate whether the request is for an ``Initial'' range of p-ANIs associated with first time deployment or whether the request represents a ``Growth'' increment of a previously assigned initial p-ANI range. Any request exceeding an aggregate total of 50 p-ANIs, see Section 4.1 d) of the p-ANI Administration Guidelines. For requests to modify assignments of previously acquired p-ANI resources, the p-ANI Applicant shall check the ``Modification'' box, and enter the p-ANI range(s) affected by the change and check the box most closely related to the reason for the modifications. For requests to return previously assigned p-ANI resources, the p-ANI Applicant shall check the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278130A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278130A1.txt  
- MD WQFD365 076-48-12.0 W 0003226636 FIBERTOWER NETWORK SERVICES COSAVAGE 11/08/2007 11465.00000 39-09-06.5 N MD MD WQFD365 076-48-12.0 W 0003226636 FIBERTOWER NETWORK SERVICES COSAVAGE 11/08/2007 11645.00000 39-09-06.5 N CA MD WQFY920 122-18-28.0 W 0003227241 Wiline Networks Inc San Mateo 11/09/2007 23025.00000 37-32-51.0 N CA MD WQFY921 122-16-34.5 W 0003227300 Wiline Networks Inc San Mateo 11/09/2007 21825.00000 37-33-45.8 N CA MD WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 11/09/2007 17965.00000 37-47-24.0 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 11/09/2007 21270.00000 37-47-24.0 N CA MD WQGG371 122-24-04.1 W 0003227325 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278316A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278316A1.txt  
- -- 2 1 10/17/2007 WNBE465 MO BLACK FOREST FIRE DEPT 155.34000000 -- PA -- 2 1 Page 3 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. PW - Public Safety Pool, Conventional Public Safety and Homeland Security Bureau 10/17/2007 WNLZ949 FB MONONGALIA COUNTY EMERGENCY SERVICE 155.23500000 FAIRVIEW 39-38-4.1 N WV 80-13-30.8 W 4 1 10/17/2007 WNLZ949 FB MONONGALIA COUNTY EMERGENCY SERVICE 155.23500000 IDAMAY 39-30-5.0 N WV 80-14-55.0 W 5 1 10/17/2007 WNLZ949 MO MONONGALIA COUNTY EMERGENCY SERVICE 155.23500000 -- -- 6 1 10/17/2007 WNLZ949 MO MONONGALIA COUNTY EMERGENCY SERVICE 155.23500000 -- -- 7 1 10/17/2007 WPFK875 FB2 ARKANSAS, COUNTY OF 155.25000000 TICHNOR 34-1-39.0 N AR 91-14-53.0 W 6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278326A1.pdf  
- - (45.0 W.L.) 1 - PAS-3R - (43.0 W.L.) 1 - PAS-4 - (191.0 W.L.) 1 - TELSTAR 11 - (37.5 W.L.) E7635 SES-RWL-20071115-01584 E Date Effective: 11/16/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 11/18/2007 - 11/18/2022 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT." OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W Points of Communication: 1 - ALSAT - (ALSAT) E6391 SES-RWL-20071115-01585 E Date Effective: 11/16/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 11/18/2007 - 11/18/2022 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278415A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278415A1.txt  
- 11/20/2007 17880.00000 45-33-35.4 N OR NE 122-51-00.1 W 0003236100 Freewire Broadband LLC Beaverton 11/20/2007 17960.00000 45-32-11.8 N OR NE 122-51-08.6 W 0003236104 Freewire Broadband LLC Aloha 11/20/2007 17880.00000 45-30-26.0 N OR NE 123-08-47.5 W 0003236108 Freewire Broadband LLC Forest Grove 11/20/2007 19360.00000 45-33-04.7 N OR NE 123-07-40.2 W 0003236111 Freewire Broadband LLC Forest Grove 11/20/2007 17800.00000 45-31-30.8 N NY NE 073-55-04.1 W 0003236145 Northrop Grumman Information TechnologBrooklyn 11/20/2007 23075.00000 40-41-45.3 N NY NE 073-55-04.1 W 0003236145 Northrop Grumman Information TechnologBrooklyn 11/20/2007 23125.00000 40-41-45.3 N NY NE 073-56-20.5 W 0003236161 Northrop Grumman Information TechnologBrooklyn 11/20/2007 21925.00000 40-41-51.5 N NY NE 073-56-20.5 W 0003236161 Northrop Grumman Information TechnologBrooklyn 11/20/2007 21975.00000 40-41-51.5 N CO NE 104-42-36.6 W 0003236347 Banner Health System Greeley 11/20/2007 23070.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278419A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278419A1.txt  
- N CO MD WNTA898 105-15-02.0 W 0003236473 BOULDER, COUNTY OF BOULDER 11/20/2007 19115.00000 40-01-03.9 N CO MD WNTA898 105-15-02.0 W 0003236473 BOULDER, COUNTY OF BOULDER 11/20/2007 19320.00000 40-01-03.9 N CO MD WNTA898 105-15-02.0 W 0003236473 BOULDER, COUNTY OF BOULDER 11/20/2007 19600.00000 40-01-03.9 N CO MD WNTD905 105-15-47.9 W 0003236474 BOULDER, COUNTY OF BOULDER 11/20/2007 17760.00000 40-00-26.3 N CO MD WNTH275 107-20-04.1 W 0003236476 COLORADO, STATE OF GLENWOOD SPRIN 11/20/2007 11187.50000 39-33-12.9 N CO MD WNTH275 107-20-04.1 W 0003236476 COLORADO, STATE OF GLENWOOD SPRIN 11/20/2007 18685.00000 39-33-12.9 N CO MD KCM98 107-22-47.2 W 0003236478 COLORADO, STATE OF GLENWOOD SPRIN 11/20/2007 06545.00000 39-25-33.9 N CO MD KCM98 107-22-47.2 W 0003236478 COLORADO, STATE OF GLENWOOD SPRIN 11/20/2007 06625.00000 39-25-33.9 N CO MD KCM98 107-22-47.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-278866A1.pdf  
- DIGITAL, QPSK, VARIOUS FEC, VARIOUS DATA RATES, VARIOUS INFO. 3700.0000 - 4200.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E890995 SES-RWL-20071205-01665 E Date Effective: 12/10/2007 Class of Station: Temporary Fixed Earth Station Grant of Authority 12/22/2007 - 12/22/2022 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" OFFSAT Page 12 of 19 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 68.90 dBW 5925.0000 - 6425.0000 MHz 1M50F7D 57.90 dBW 5925.0000 - 6425.0000 MHz 200KF3E 75.90 dBW 5925.0000 - 6425.0000 MHz 7M92G7W Points of Communication: 1 - ALSAT - (ALSAT) E890996 SES-RWL-20071205-01666 E Date Effective: 12/10/2007 Class of Station: Temporary Fixed Earth Station Grant of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279015A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279015A1.txt  
- 122-18-28.0 W 0003227241 Wiline Networks Inc San Mateo 12/14/2007 23025.00000 37-32-51.0 N CA AM WQFY920 122-18-28.0 W 0003227241 Wiline Networks Inc San Mateo 12/14/2007 23075.00000 37-32-51.0 N CA AM WQFY920 122-18-28.0 W 0003227241 Wiline Networks Inc San Mateo 12/13/2007 23075.00000 37-32-51.0 N CA AM WQFY920 122-18-28.0 W 0003227241 Wiline Networks Inc San Mateo 12/14/2007 23175.00000 37-32-51.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 12/13/2007 17965.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 12/13/2007 21270.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 12/13/2007 22735.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 12/13/2007 23175.00000 37-47-24.0 N VA AM WQGK788 077-22-25.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A1.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 5 Index of Tables and Charts Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A11.txt  
- Installation Interval (days) 18.6 15.8 23.1 11.3 12.8 17.4 5.3 10.2 Average Repair Interval (hours) 35.3 NA 8.8 98.5 1.8 16.9 4.6 3.1 ACCESS SERVICES PROVIDED TO CARRIERS -- SPECIAL ACCESS Percent Installation Commitments Met 91.2 97.6 86.9 16.3 93.0 86.9 93.5 86.7 Average Installation Interval (days) 14.0 17.2 14.4 42.3 10.8 1.6 7.5 10.2 Average Repair Interval (hours) 44.1 4.1 12.5 94.9 3.6 22.9 3.6 5.9 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 96.7 99.5 93.7 99.2 96.7 97.2 95.9 95.7 Residence 97.1 99.6 93.7 99.2 97.0 97.4 96.3 95.8 Business 95.3 98.8 94.1 98.9 94.5 95.9 91.5 94.8 Average Installation Interval (days) 1.0 2.4 4.9 4.8 1.9 1.4 2.6 2.8 Residence 0.9 2.0 4.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A2.txt  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 5 Index of Tables and Charts Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A6.txt  
- of Funding Year 2005 funds. As of the same date, USAC had committed nearly $1.91 billion, and disbursed over $634 million of Funding Year 2006 funds. USAC supplies the Commission with funding commitments and disbursements information for the schools and libraries support mechanism for all active funding years. USAC provided the Commission with data as of June 30, 2007. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A9.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279226A9.txt  
- in long distance prices. 6 Access Charge Reform, CC Docket No. 96-262, Sixth Report and Order, 15 Rcd. 12962 (CALLS Order). 7 Telecommunications Act of 1996, Pub. L. No. 104-104, 110 Stat. 56 (1996) (1996 Act). The 1996 Act amended the Communications Act of 1934. 47 U.S.C. §§ 151 et seq. 1956 - 2006 1996 - 2006 CPI All Items 4.1 % 2.5% CPI All Services 5.0 3.2 CPI Telephone Services ** 1.7 -0.3 CPI Major Categories: - Food & Beverages * 2.4 - Housing * 2.9 - Apparel 2.2 -1.0 - Transportation 3.5 2.4 - Medical Care 5.1 4.0 - Recreation * 1.3 - Other Goods & Services * 4.1 CPI Public Transportation 4.6 2.2 CPI Utility Natural Gas Service 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279231A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279231A1.txt  
- 2004 State 2003 2005 2006 Zero 44.0%38.0%31.3% 25.1% 21.9% 17.4% 18.4% 17.7% 17.7% One 16.8 16.8 19.3 17.3 15.3 10.5 11.4 11.3 11.1 Two 10.4 10.0 10.4 10.4 11.6 7.6 7.6 7.8 8.2 Three 7.2 7.7 6.7 7.0 7.6 6.0 6.2 6.2 6.7 Four 5.5 6.1 6.3 5.3 5.7 4.8 4.7 5.0 5.2 Five 4.0 4.5 5.2 4.8 5.2 4.2 4.1 4.2 4.4 Six 3.0 3.8 4.4 4.7 4.4 3.4 3.6 3.5 3.8 Seven 2.3 2.9 3.5 4.1 4.2 3.1 3.3 3.2 3.2 Eight 1.7 2.2 2.9 3.7 3.7 3.1 2.9 2.9 3.0 Nine 1.4 2.1 2.6 3.2 3.2 2.8 2.7 2.8 2.7 Ten or More 3.7 5.9 7.3 14.4 17.3 36.9 35.0 35.3 34.0 Zero 11.8% 8.8% 5.8% 3.8% 3.1% 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279358A1.pdf  
- INC. Nature of Service: Fixed Satellite Service MOD to broaden range of satellite arc and C-band frequencies available for use, to add emission designators, and to increase maximum EIRP. 34 ° 13 ' 55.00 " N LAT. SITE ID: 1 20640 BAHAMA ST., LOS ANGELES, CHATSWORTH, CA 118 ° 34 ' 57.30 " W LONG. LOCATION: COMTECH ANTENNA SYSTEMS 1 4.1 meters ANTENNA ID: 5 METER OFFSAT 67.70 dBW COMPRESSED DIGITAL VIDEO, DVB 6315.0000 - 6324.0000 MHz 9M10G7F Page 6 of 8 COMPRESSED DIGITAL VIDEO, DVB 3700.0000 - 4200.0000 MHz 9M10G7F 62.85 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 3M00G7W 74.90 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 36M0G7W DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 3M00G7W DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279359A1.pdf  
- Date Effective: 01/03/2008 Class of Station: Fixed Earth Stations Grant of Authority 12/20/2007 - 12/20/2022 Renewal FIBERSAT GLOBAL SERVICES, INC. Nature of Service: Domestic Fixed Satellite Service, International Fixed Satellite Service 34 ° 13 ' 55.00 " N LAT. SITE ID: 1 20640 BAHAMA ST., LOS ANGELES, CHATSWORTH, CA 118 ° 34 ' 57.30 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 67.70 dBW COMPRESSED DIGITAL VIDEO, DVB 6315.0000 - 6324.0000 MHz 9M10G7F COMPRESSED DIGITAL VIDEO, DVB 3700.0000 - 4200.0000 MHz 9M10G7F Points of Communication: 1 - ALSAT - (ALSAT) E880410 SES-RWL-20080107-00013 E Date Effective: 01/07/2008 Class of Station: Fixed Earth Stations Grant of Authority 03/18/2008 - 03/18/2023 Renewal Cox Communications Louisiana, LLC Page 5 of 9 Nature 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279376A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279376A1.txt  
- City CA AM 119-33-37.3 W 0003169785 Conterra Ultra Broadband, LLC Sanger 01/03/2008 23225.00000 36-42-03.2 N CA AM 119-33-37.3 W 0003169785 Conterra Ultra Broadband, LLC Sanger 01/03/2008 23225.00000 36-42-03.2 N CA AM 119-33-37.3 W 0003169785 Conterra Ultra Broadband, LLC Sanger 01/03/2008 23325.00000 36-42-03.2 N CA AM 119-33-37.3 W 0003169785 Conterra Ultra Broadband, LLC Sanger 01/03/2008 23325.00000 36-42-03.2 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 01/02/2008 17965.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 01/02/2008 21270.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 01/02/2008 22735.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 W 0003227325 Wiline Networks Inc San Francisco 01/02/2008 22925.00000 37-47-24.0 N CA AM WQGG371 122-24-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279530A1.pdf  
- dBW 14000.0000 - 14500.0000 MHz 24M0G7W 11700.0000 - 12200.0000 MHz Points of Communication: 1 - ALSAT - (ALSAT) E874239 SES-RWL-20080109-00025 E Date Effective: 01/09/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 02/02/2008 - 02/02/2023 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service Page 14 of 20 SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E860696 SES-RWL-20080109-00026 E Date Effective: 01/09/2008 Class of Station: Fixed Earth Stations Grant of Authority 01/27/2008 - 01/27/2023 Renewal RCN License Subsidiary, Inc. Nature of Service: Fixed Satellite Service 42 ° 58 ' 12.60 " N LAT. SITE ID: 1 5857 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279647A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279647A1.txt  
- NETWORKS, INMORRISVILLE 01/14/2008 10955.00000 35-50-34.3 N NC NE 078-31-14.6 W 0003286590 METROPOLITAN AREA NETWORKS, INRALEIGH 01/14/2008 10755.00000 35-50-39.3 N NC NE 078-33-21.1 W 0003286592 METROPOLITAN AREA NETWORKS, INRALEIGH 01/14/2008 11245.00000 35-47-33.6 N NC NE 078-52-20.6 W 0003286593 METROPOLITAN AREA NETWORKS, INApex 01/14/2008 11525.00000 35-48-02.6 N NC NE 078-47-32.6 W 0003286594 METROPOLITAN AREA NETWORKS, INCary 01/14/2008 11035.00000 35-47-09.3 N NC NE 078-53-04.1 W 0003286595 METROPOLITAN AREA NETWORKS, INApex 01/14/2008 11565.00000 35-44-54.5 N NC NE 078-51-14.8 W 0003286596 METROPOLITAN AREA NETWORKS, INAPEX 01/14/2008 11075.00000 35-42-03.0 N NC NE 078-42-14.9 W 0003286597 METROPOLITAN AREA NETWORKS, INRALEIGH 01/14/2008 11605.00000 35-45-01.3 N NC NE 078-40-57.1 W 0003286598 METROPOLITAN AREA NETWORKS, INRALEIGH 01/14/2008 11115.00000 35-47-24.3 N NC NE 078-54-50.8 W 0003286599 METROPOLITAN AREA NETWORKS, INApex 01/14/2008 10755.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279648A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279648A1.txt  
- Cellular Telephone CompanyST. PARIS 01/14/2008 40-08-22.0 N IN MD KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 01/14/2008 41-40-07.2 N IN MD KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 01/14/2008 41-40-07.2 N Page 19 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 01/14/2008 41-39-27.2 N IN MD KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 01/14/2008 41-39-27.2 N IN MD KNKN603 086-53-22.1 W 0003287178 Chicago SMSA LP Westville 01/14/2008 41-35-28.1 N IN MD KNKN603 086-53-22.1 W 0003287178 Chicago SMSA LP Westville 01/14/2008 41-35-28.1 N OH MD KNKN853 080-34-15.3 W 0003288805 New Par CONNEAUT 01/15/2008 41-54-20.2 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279931A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279931A1.txt  
- the very end of 2006). BellSouth data are shown separately to facilitate comparisons with prior year data. 22 See supra note 15. 7 4. Qualifications Overall, we caution readers to be aware of potential inconsistencies in the service quality data and methodological shortcomings affecting both the collection and interpretation of the data. Some common sources of issues are described below. 4.1 Data Re-filings Commission staff generally screen company-filed service quality data for irregularities and provide feedback to reporting companies on suspected problems. The reporting companies are then given an opportunity to re-file. Re-filed data appear in this report if they are received in time to be included in the Commission's recalculation of holding company totals and other data aggregates described in 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279997A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-279997A1.txt  
- 89.5 96.8 7.3 * Illinois 95.0 94.1 -0.9 Indiana 90.3 91.0 0.7 Iowa 95.4 97.7 2.3 Kansas 94.9 97.0 2.1 Kentucky 86.9 94.4 7.5 * Louisiana 88.9 93.9 5.0 * Maine 90.7 97.0 6.3 * Maryland 96.3 96.3 0.0 Massachusetts 94.3 95.9 1.6 Michigan 93.8 95.6 1.9 * Minnesota 96.4 97.8 1.5 Mississippi 82.4 89.8 7.5 * Missouri 92.1 96.1 4.1 * Montana 92.8 94.7 1.9 Nebraska 94.0 92.8 -1.2 Nevada 89.4 95.5 6.1 * New Hampshire 95.0 96.6 1.6 New Jersey 94.1 94.9 0.7 New Mexico 85.3 91.1 5.7 * New York 90.8 93.0 2.1 * North Carolina 89.3 94.8 5.5 * North Dakota 95.1 97.6 2.5 * Ohio 92.2 96.6 4.4 * Oklahoma 91.5 95.3 3.8 * Oregon 91.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280031A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280031A1.txt  
- NE 087-19-27.2 W 0003305428 METROPOLITAN AREA NETWORKS, INMcDavid 01/29/2008 05945.20000 30-53-32.1 N Page 11 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 087-21-01.8 W 0003305429 METROPOLITAN AREA NETWORKS, INCantonment 01/29/2008 06197.24000 30-40-42.5 N FL NE 087-19-55.1 W 0003305430 METROPOLITAN AREA NETWORKS, INMcDavid 01/29/2008 06256.54000 30-48-04.1 N FL NE 087-17-04.2 W 0003305431 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 06004.50000 30-33-37.3 N FL NE 087-17-04.2 W 0003305431 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 11245.00000 30-33-37.3 N AL NE 087-28-27.9 W 0003305432 METROPOLITAN AREA NETWORKS, INROBERTSDALE 01/29/2008 11445.00000 30-34-48.3 N FL NE 087-24-23.6 W 0003305433 METROPOLITAN AREA NETWORKS, INPensacola 01/29/2008 10955.00000 30-32-10.7 N FL NE 086-58-37.9 W 0003305434 METROPOLITAN AREA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280187A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280187A1.txt  
- 40-08-28.2 N OH AM KNKA641 083-42-47.7 W 0003286980 Springfield Cellular Telephone CompanySPRINGFIELD 02/06/2008 40-08-28.2 N OH AM KNKA641 083-57-49.8 W 0003286980 Springfield Cellular Telephone CompanyST. PARIS 02/06/2008 40-08-22.0 N IN AM KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 02/06/2008 41-40-07.2 N IN AM KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 02/06/2008 41-40-07.2 N IN AM KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 02/06/2008 41-39-27.2 N IN AM KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 02/06/2008 41-39-27.2 N IN AM KNKN603 086-53-22.1 W 0003287178 Chicago SMSA LP Westville 02/06/2008 41-35-28.1 N IN AM KNKN603 086-53-22.1 W 0003287178 Chicago SMSA LP Westville 02/06/2008 41-35-28.1 N OH AM KNKN853 080-34-15.3 W 0003288805 New Par CONNEAUT 02/06/2008 41-54-20.2 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280312A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280312A1.txt  
- W 0003325992 TRILLION PARTNERS, INC. Farmersville 02/14/2008 23175.00000 36-18-26.7 N CA NE 119-12-06.0 W 0003325995 TRILLION PARTNERS, INC. Farmersville 02/14/2008 21875.00000 36-18-38.2 N CA NE 119-12-06.0 W 0003325995 TRILLION PARTNERS, INC. Farmersville 02/14/2008 21975.00000 36-18-38.2 N CA NE 119-03-39.2 W 0003327041 MetroPCS California, LLC BAKERSFIELD 02/15/2008 19550.00000 35-18-29.4 N CA NE 119-05-00.3 W 0003327109 MetroPCS California, LLC BAKERSFIELD 02/15/2008 17990.00000 35-19-04.1 N CA NE 118-54-49.8 W 0003327135 MetroPCS California, LLC BAKERSFIELD 02/15/2008 17930.00000 35-18-10.6 N LA NE 093-06-30.3 W 0003327238 DETEL WIRELESS, LLC NATCHITOCHES 02/15/2008 17765.00000 31-46-04.7 N RO WNEQ516 0003320000 Pacific Wireless Systems, LLC 02/11/2008 RO WPNL671 0003323465 Alltel Communications, LLC 02/13/2008 RO WNEH240 0003325081 SOUTHERN CALIFORNIA EDISON COM 02/14/2008 RO WNEK764 0003325082 SOUTHERN CALIFORNIA EDISON COM 02/14/2008 RO WNTQ816 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280465A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280465A1.txt  
- KY MD WPTY897 083-07-01.6 W 0003329027 Kentucky Power Company Jeff 02/19/2008 06610.00000 37-12-05.3 N KS MD KJL77 101-01-45.8 W 0003329041 Panhandle Eastern Pipe Line Company SATANTA 02/19/2008 06785.00000 37-24-06.7 N KS MD KJL77 101-01-45.8 W 0003329041 Panhandle Eastern Pipe Line Company SATANTA 02/19/2008 06845.00000 37-24-06.7 N KS MD KJL76 101-19-06.6 W 0003329071 Panhandle Eastern Pipe Line Company HUGOTON 02/19/2008 06625.00000 37-10-04.1 N KS MD KJL76 101-19-06.6 W 0003329071 Panhandle Eastern Pipe Line Company HUGOTON 02/19/2008 06655.00000 37-10-04.1 N KS MD KJL76 101-19-06.6 W 0003329071 Panhandle Eastern Pipe Line Company HUGOTON 02/19/2008 06685.00000 37-10-04.1 N PA MD WEG926 075-56-09.0 W 0003329074 Exelon Generation Company, LLC RUSSELLVILLE 02/19/2008 06315.84000 39-50-56.0 N PA MD WEG926 075-56-09.0 W 0003329074 Exelon Generation Company, LLC RUSSELLVILLE 02/19/2008 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280613A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280613A1.txt  
- N LA MD KNV70 089-41-29.2 W 0003339871 ALABAMA GREAT SOUTHERN RAILWAYSLIDELL 02/28/2008 06855.00000 30-13-37.7 N VA MD WQGW465 078-16-28.1 W 0003339900 COMMONWEALTH OF VIRGINIA, DEPABENTONVILLE 02/28/2008 06404.79000 38-45-43.9 N NY MD WQID650 074-00-35.2 W 0003340894 Northrop Grumman Information TechnologBrooklyn 02/29/2008 21825.00000 40-38-33.2 N NY MD WQID650 074-00-35.2 W 0003340894 Northrop Grumman Information TechnologBrooklyn 02/29/2008 22225.00000 40-38-33.2 N NY MD WQIB502 073-55-04.1 W 0003340915 Northrop Grumman Information TechnologBrooklyn 02/29/2008 23075.00000 40-41-45.3 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD WQIB502 073-55-04.1 W 0003340915 Northrop Grumman Information TechnologBrooklyn 02/29/2008 23075.00000 40-41-45.3 N NY MD WQIE475 073-58-44.4 W 0003340918 Northrop Grumman Information TechnologBrooklyn 02/29/2008 21925.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-280897A1.pdf  
- KPC 85.50 dBW 5925.0000 - 6425.0000 MHz 36000F9 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E970097 SES-RWL-20080310-00264 E Date Effective: 03/11/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/11/2008 - 03/11/2023 Renewal RCN LICENSE SUBSIDIARY, INC. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH "18FT" 1 4.1 meters ANTENNA ID: (OFFSAT) 66.40 dBW 5925.0000 - 6425.0000 MHz 8M30G7W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 51.20 dBW PM modulation digital video 5925.0000 - 6425.0000 MHz 8M12G7W 50.20 dBW PM modulation digital video 5925.0000 - 6425.0000 MHz 6M06G7W 44.20 dBW PM modulation voice and data 5925.0000 - 6425.0000 MHz 1M54G7W 69.40 dBW PM modulation analog video 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281237A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281237A1.txt  
- 40-46-02.8 N NY NE 073-58-27.0 W 0003369695 Northrop Grumman Information TechnologNew York 03/24/2008 23125.00000 40-46-45.3 N NY NE 073-58-27.0 W 0003369695 Northrop Grumman Information TechnologNew York 03/24/2008 23175.00000 40-46-45.3 N NY NE 073-58-55.0 W 0003369697 Northrop Grumman Information TechnologNew York 03/24/2008 21975.00000 40-46-33.4 N NY NE 073-58-55.0 W 0003369697 Northrop Grumman Information TechnologNew York 03/24/2008 23075.00000 40-46-33.4 N NY NE 073-58-04.1 W 0003369732 Northrop Grumman Information TechnologNew York 03/24/2008 21825.00000 40-46-18.5 N NY NE 073-58-04.1 W 0003369732 Northrop Grumman Information TechnologNew York 03/24/2008 21875.00000 40-46-18.5 N NY NE 073-58-04.1 W 0003369732 Northrop Grumman Information TechnologNew York 03/24/2008 21875.00000 40-46-18.5 N NY NE 073-58-04.1 W 0003369732 Northrop Grumman Information TechnologNew York 03/24/2008 22325.00000 40-46-18.5 N GA NE 084-35-13.6 W 0003369805 Clearwire Spectrum 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281262A1.pdf  
- 14000.0000 - 14500.0000 MHz 36M0G72 QPSK; DIGITAL DATA AND VIDEO 11700.0000 - 12200.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E970071 SES-RWL-20080327-00364 E Date Effective: 03/28/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/28/2008 - 03/28/2023 Renewal Crawford Communications, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" (OFFSAT) 72.40 dBW ANALOG TV & VIDEO 5945.0000 - 6405.0000 MHz 36M0F3F 65.90 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 4M00G7W- 75.44 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E880629 SES-RWL-20080327-00365 E Date Effective: 03/28/2008 Class of Station: Fixed Earth Stations Grant of Authority 04/29/2008 - 04/29/2023 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281382A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281382A1.txt  
- Latitude City MA MD WLV786 070-57-15.2 W 0003382292 CELLCO PARTNERSHIP GEORGETOWN 04/02/2008 10705.00000 42-43-02.3 N IA MD WQCJ486 091-10-23.4 W 0003382408 USCOC OF GREATER IOWA, INC. STANWOOD 04/02/2008 06745.00000 41-53-12.9 N IA MD WQCJ486 091-10-23.4 W 0003382408 USCOC OF GREATER IOWA, INC. STANWOOD 04/02/2008 06765.00000 41-53-12.9 N OH MD WQHH825 080-39-53.3 W 0003382507 FiberTower Network Service Corp. VIENNA 04/02/2008 10755.00000 41-14-04.1 N OH MD WQHH825 080-39-53.3 W 0003382507 FiberTower Network Service Corp. VIENNA 04/02/2008 10835.00000 41-14-04.1 N IL MD WQHR611 087-40-37.5 W 0003382975 SPARKPLUG CHICAGO, INC. CHICAGO 04/02/2008 21870.00000 41-52-36.7 N WA MD WPOQ797 121-58-10.4 W 0003383223 T-Mobile License LLC ISSAQUAH 04/03/2008 06735.00000 47-30-16.3 N WA MD WPOQ797 121-58-10.4 W 0003383223 T-Mobile License LLC ISSAQUAH 04/03/2008 10755.00000 47-30-16.3 N WA MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281566A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281566A1.txt  
- 04/08/2008 06315.84000 35-03-40.2 N NC NE 080-30-56.3 W 0003389529 METROPOLITAN AREA NETWORKS, INMONROE 04/08/2008 06063.80000 34-58-36.8 N NC NE 080-30-56.3 W 0003389529 METROPOLITAN AREA NETWORKS, INMONROE 04/08/2008 11365.00000 34-58-36.8 N SC NE 080-51-14.2 W 0003389530 METROPOLITAN AREA NETWORKS, INPleasant Valley 04/08/2008 10755.00000 35-00-36.0 N SC NE 080-55-10.6 W 0003389531 METROPOLITAN AREA NETWORKS, INFort Mill 04/08/2008 11245.00000 35-03-28.6 N NC NE 080-35-04.1 W 0003389533 METROPOLITAN AREA NETWORKS, INMONROE 04/08/2008 11605.00000 35-01-43.1 N NC NE 080-45-39.6 W 0003389534 METROPOLITAN AREA NETWORKS, INWAXHAW 04/08/2008 11075.00000 34-58-03.2 N NC NE 080-37-25.5 W 0003389535 METROPOLITAN AREA NETWORKS, INHouston 04/08/2008 10875.00000 34-58-35.2 N NC NE 080-37-25.5 W 0003389535 METROPOLITAN AREA NETWORKS, INHouston 04/08/2008 11115.00000 34-58-35.2 N SC NE 081-01-19.0 W 0003389536 METROPOLITAN AREA NETWORKS, INROCK HILL 04/08/2008 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281567A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281567A1.txt  
- N MN MD WPNB522 095-07-40.0 W 0003388962 RCC Minnesota, Inc. OSAKIS 04/08/2008 06152.75000 45-49-25.0 N MN MD WPNB522 095-07-40.0 W 0003388962 RCC Minnesota, Inc. OSAKIS 04/08/2008 06375.14000 45-49-25.0 N MN MD WPNC987 095-23-29.0 W 0003388991 RCC Minnesota, Inc. ALEXANDRIA 04/08/2008 06226.89000 45-51-21.0 N MN MD WPNC987 095-23-29.0 W 0003388991 RCC Minnesota, Inc. ALEXANDRIA 04/08/2008 06404.79000 45-51-21.0 N WA MD WPJB542 119-53-04.1 W 0003389003 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 04/08/2008 06345.49000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0003389003 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 04/08/2008 06421.25000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0003389003 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 04/08/2008 06855.00000 46-48-55.4 N Page 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281568A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281568A1.txt  
- Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA NE 079-54-10.7 W 0003388379 HENRY, COUNTY OF Collinsville 04/08/2008 10795.00000 36-43-30.7 N VA NE 080-02-02.2 W 0003388380 HENRY, COUNTY OF Bassett 04/08/2008 06845.00000 36-45-44.9 N VA NE 080-02-02.2 W 0003388380 HENRY, COUNTY OF Bassett 04/08/2008 06865.00000 36-45-44.9 N VA NE 079-55-04.1 W 0003388381 HENRY, COUNTY OF Ridgeway 04/08/2008 06835.00000 36-36-49.1 N VA NE 079-55-04.1 W 0003388381 HENRY, COUNTY OF Ridgeway 04/08/2008 06855.00000 36-36-49.1 N CO NE 102-48-53.0 W 0003390189 Yuma, County of Yuma 04/09/2008 10583.12500 40-08-35.0 N CO NE 102-48-53.0 W 0003390189 Yuma, County of Yuma 04/09/2008 10648.12500 40-08-35.0 N CO NE 102-43-18.0 W 0003390204 Yuma, County of Yuma 04/09/2008 10583.12500 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281713A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281713A1.txt  
- 17915.00000 45-27-07.5 N Page 30 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR MD WQIP289 122-28-59.9 W 0003395017 CLEARWIRE SPECTRUM HOLDINGS II PORTLAND 04/14/2008 17815.00000 45-29-28.3 N OR MD WQIP289 122-28-59.9 W 0003395017 CLEARWIRE SPECTRUM HOLDINGS II PORTLAND 04/14/2008 17915.00000 45-29-28.3 N OK MD WNTR373 094-51-04.1 W 0003395541 Vastar Resources Inc. RED OAK 04/14/2008 00928.18125 35-03-32.0 N IL MD WQEC856 088-17-03.3 W 0003396085 Fox Valley Internet, Inc. Elgin, Illinois 04/14/2008 17840.00000 42-02-14.9 N IL MD WQEC858 088-30-02.2 W 0003396087 Fox Valley Internet, Inc. Hampshire, Illinois 04/14/2008 11545.00000 42-08-11.3 N TX MD WQBD290 098-22-15.5 W 0003396461 Tejas Gas LLC Mission 04/15/2008 00928.74375 26-19-13.6 N TX MD WQBD290 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281728A1.pdf  
- E Date Effective: 04/21/2008 Class of Station: Fixed Earth Stations Grant of Authority 03/27/2008 - 03/27/2023 Renewal The University of Montana Nature of Service: Domestic Fixed Satellite Service 46 ° 51 ' 49.00 " N LAT. SITE ID: 1 PAR TV BLDG., ROOM 180, MISSOULA, MISSOULA, MT 113 ° 59 ' 2.70 " W LONG. LOCATION: COMTECH ANTENNA CORP 1 4.1 meters ANTENNA ID: "18FT" (OFFSAT) 56.10 dBW 5925.0000 - 6425.0000 MHz 76K8G7W 60.80 dBW 5925.0000 - 6425.0000 MHz 230KG7W 3700.0000 - 4200.0000 MHz 76K8G7W 3700.0000 - 4200.0000 MHz 230KG7W Points of Communication: 1 - ALSAT - (ALSAT) E870490 SES-RWL-20080421-00478 E Date Effective: 04/22/2008 Class of Station: Fixed Earth Stations Grant of Authority 07/15/2008 - 07/15/2023 Renewal Commonwealth of Kentucky-Kentucky Authority 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281857A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281857A1.txt  
- Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA MD WQFU753 077-22-27.0 W 0003408377 FIBERTOWER NETWORK SERVICES COFAIRFAX 04/23/2008 11525.00000 38-51-18.0 N CA MD WMW848 118-12-11.2 W 0003408534 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 17800.00000 33-51-31.0 N CA MD WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 10577.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 10592.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/23/2008 10755.00000 33-53-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281981A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281981A1.txt  
- COMMADISON 05/01/2008 11605.00000 43-03-56.9 N TX AM 099-10-36.4 W 0003386793 Conterra Ultra Broadband, LLC Putnam 04/30/2008 11245.00000 32-22-40.6 N TX AM 099-10-36.4 W 0003386793 Conterra Ultra Broadband, LLC Putnam 04/30/2008 11325.00000 32-22-40.6 N TX AM 099-10-36.4 W 0003386793 Conterra Ultra Broadband, LLC Putnam 04/30/2008 11405.00000 32-22-40.6 N CA AM WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/29/2008 10552.50000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/29/2008 10561.25000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/29/2008 10577.50000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/29/2008 10592.50000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0003408545 LOS ANGELES SMSA LIMITED PARTNECOMPTON 04/29/2008 10755.00000 33-53-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281998A1.pdf  
- Earth Stations Amendment FiberSat Global Services, Inc. Nature of Service: Fixed Satellite Service This amendment is associated with pending in part Mod license SES-MOD-20071218-01720, and another AMD filed SES-AMD-20080424-00488. 34 ° 13 ' 55.00 " N LAT. SITE ID: 1 20640 BAHAMA ST., LOS ANGELES, CHATSWORTH, CA 118 ° 34 ' 57.30 " W LONG. LOCATION: COMTECH ANTENNA SYSTEMS 1 4.1 meters ANTENNA ID: 5 METER OFFSAT 67.70 dBW COMPRESSED DIGITAL VIDEO, DVB 6315.0000 - 6324.0000 MHz 9M10G7F 62.85 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 3M00G7W COMPRESSED DIGITAL VIDEO, DVB 3700.0000 - 4200.0000 MHz 9M10G7F DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 3M00G7W 67.66 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 36M0G7W DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 36M0G7W Points of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-281999A1.pdf  
- 05/02/2008 Class of Station: Fixed Earth Stations Grant of Authority 05/08/2008 - 05/08/2023 Renewal Carol L Ives ( d/b/a White Springs Media ) Nature of Service: Domestic Fixed Satellite Service 30 ° 19 ' 39.00 " N LAT. SITE ID: 1 McCLURG LANE, HAMILTON, WHITE SPRINGS, FL 82 ° 47 ' 40.00 " W LONG. LOCATION: COMTECH ANTENNA CORP 1 4.1 meters ANTENNA ID: 5.5 OFFSAT 57.38 dBW 5925.0000 - 6425.0000 MHz 200KF3E 57.38 dBW 5925.0000 - 6425.0000 MHz 200KG7D Page 8 of 10 63.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz Points of Communication: 1 - ALSAT - (ALSAT) E980273 SES-RWL-20080502-00525 E Date Effective: 05/05/2008 Class of Station: Fixed Earth Stations Grant of Authority 07/31/2008 - 07/31/2023 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282120A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282120A1.txt  
- CINGULAR WIRELESS PCS, LLCTUCSON 05/08/2008 23130.00000 32-14-12.5 N OH MD WML780 083-17-22.2 W 0003432200 OHIO RSA 5 LIMITED PARTNERSHIP d/UPPER SANDUSKY 05/08/2008 05945.20000 40-46-51.7 N OH MD WML780 083-17-22.2 W 0003432200 OHIO RSA 5 LIMITED PARTNERSHIP d/UPPER SANDUSKY 05/08/2008 06755.00000 40-46-51.7 N AZ MD WQDK678 112-10-19.2 W 0003432204 NEW CINGULAR WIRELESS PCS, LLCGLENDALE 05/08/2008 23180.00000 33-31-31.2 N AZ MD WQFE247 112-09-04.1 W 0003432216 NEW CINGULAR WIRELESS PCS, LLCGLENDALE 05/08/2008 21930.00000 33-33-08.4 N OH MD WML459 083-32-45.8 W 0003432224 OHIO RSA 5 LIMITED PARTNERSHIP d/FINDLAY 05/08/2008 06845.00000 41-00-14.6 N Page 21 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD MD WQIF617 076-50-34.0 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282121A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282121A1.txt  
- 32-15-51.0 N AZ MD WQCN555 110-57-43.7 W 0003427232 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 23130.00000 32-15-51.0 N AZ MD WQEM720 110-58-46.8 W 0003427311 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 21830.00000 32-18-42.6 N AZ MD WQEM720 110-58-46.8 W 0003427311 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 21880.00000 32-18-42.6 N AZ MD WQCY950 111-00-52.6 W 0003427320 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 23080.00000 32-23-04.1 N AZ MD WQCQ385 111-00-21.5 W 0003427342 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 21830.00000 32-14-36.4 N AZ MD WQCQ385 111-00-21.5 W 0003427342 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 21930.00000 32-14-36.4 N AZ MD WQDD295 111-00-37.8 W 0003427348 NEW CINGULAR WIRELESS PCS, LLCTUCSON 05/05/2008 23030.00000 32-16-51.7 N Page 4 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282134A1.pdf  
- Page 7 of 19 ADVENT 1 1.5 meters ANTENNA ID: NEWSWIFT 150 64.97 dBW PSK DIGITAL VIDEO AUDIO/DATA 14000.0000 - 14500.0000 MHz 24M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E080098 SES-LIC-20080508-00566 E Class of Station: Temporary Fixed Earth Station Application for Authority Crawford Communications, Inc. Nature of Service: Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH Comtech 4.1 meters ANTENNA ID: OFFSAT 61.92 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 3M20G7W 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Analog Video 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282135A1.pdf  
- AUDIO NETWORK SIGNAL DELIVERY TO STATION 3700.0000 - 4200.0000 MHz 36M0F8W Points of Communication: Page 7 of 18 1 - ALSAT - (ALSAT) E980164 SES-RWL-20080507-00559 E Date Effective: 05/09/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 05/08/2008 - 05/08/2023 Renewal SES Americom, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" (OFFSAT) 65.30 dBW 5925.0000 - 6425.0000 MHz 36M0G7W 57.20 dBW 5925.0000 - 6425.0000 MHz 100KG7D Points of Communication: 1 - ALSAT - (ALSAT) E980162 SES-RWL-20080507-00562 E Date Effective: 05/09/2008 Class of Station: Fixed Earth Stations Grant of Authority 05/08/2008 - 05/08/2023 Renewal Americom Government Services, Inc. Nature of Service: Domestic Fixed Satellite Service 64 ° 58 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282422A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282422A1.txt  
- 40-08-28.2 N OH AM KNKA641 083-42-47.7 W 0003286980 Springfield Cellular Telephone CompanySPRINGFIELD 05/21/2008 40-08-28.2 N OH AM KNKA641 083-57-49.8 W 0003286980 Springfield Cellular Telephone CompanyST. PARIS 05/21/2008 40-08-22.0 N IN AM KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 05/21/2008 41-40-07.2 N IN AM KNKN603 086-48-21.1 W 0003287178 Chicago SMSA LP LA PORTE 05/21/2008 41-40-07.2 N IN AM KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 05/21/2008 41-39-27.2 N IN AM KNKN603 086-43-04.1 W 0003287178 Chicago SMSA LP LAPORTE 05/21/2008 41-39-27.2 N IN AM KNKN603 086-53-22.1 W 0003287178 Chicago SMSA LP Westville 05/21/2008 41-35-28.1 N Page 18 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN AM KNKN603 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282439A1.pdf  
- of 7 Remote Terminals - HORIZONS 1 - (127 DEG WL) E080127 SES-LIC-20080520-00664 E Class of Station: Fixed Earth Stations Application for Authority Virginia News Network Nature of Service: Fixed Satellite Service 37 ° 36 ' 51.50 " N LAT. SITE ID: 1 3245 Baise Road, Henrico, Richmond, VA 77 ° 30 ' 51.90 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 0.00 dBW Digital Data 3700.0000 - 4200.0000 MHz 154KG7D 0.00 dBW Digital Data 3700.0000 - 4200.0000 MHz 307KG7D 56.40 dBW Digital Data 5925.0000 - 6425.0000 MHz 154KG7D 59.50 dBW Digital Data 5925.0000 - 6425.0000 MHz 307KG7D Points of Communication: 1 - ALSAT - (ALSAT) E980017 SES-MOD-20080507-00563 E Class of Station: Fixed Earth Stations Application for Modification 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282440A1.pdf  
- 4200.0000 MHz 36M0F8W S-A 2 4.6 meters ANTENNA ID: 8005PF 3700.0000 - 4200.0000 MHz Points of Communication: 1 - ALSAT - (ALSAT) E890643 SES-RWL-20080520-00662 E Date Effective: 05/21/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 07/07/2008 - 07/07/2023 Renewal Mobile Satellite Connection, LLC Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F39 Points of Communication: 1 - ALSAT - (ALSAT) E070002 SES-STA-20080416-00466 E Date Effective: 05/21/2008 Class of Station: Grant of Authority Special Temporary Authority DIRECTV Enterprises, LLC Special temporary authority is GRANTED with condition for a period of 30 days beginning May 25, 2008 and ending June 25, 2008. Points 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282626A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282626A1.txt  
- Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN NE 083-39-59.6 W 0003452741 JENKINS, MICHEAL H SEVIERVILLE 05/28/2008 11325.00000 35-48-45.3 N TN NE 083-39-59.6 W 0003452741 JENKINS, MICHEAL H SEVIERVILLE 05/28/2008 11405.00000 35-48-45.3 N TN NE 083-17-44.6 W 0003452742 JENKINS, MICHEAL H NEWPORT 05/28/2008 11245.00000 35-54-20.3 N TN NE 083-35-10.2 W 0003452743 JENKINS, MICHEAL H SEVIERVILLE 05/28/2008 10915.00000 35-56-04.1 N NY NE 077-40-42.0 W 0003452749 WINC COMMUNICATIONS ROCHESTER 05/28/2008 17800.00000 43-09-23.0 N CO NE 104-43-01.5 W 0003453056 Penrad Imaging LLC Colorado Springs 05/28/2008 21825.00000 38-56-15.7 N CO NE 104-43-01.5 W 0003453056 Penrad Imaging LLC Colorado Springs 05/28/2008 21825.00000 38-56-15.7 N CO NE 104-43-01.5 W 0003453056 Penrad Imaging LLC Colorado Springs 05/28/2008 21925.00000 38-56-15.7 N CO NE 104-43-01.5 W 0003453056 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282813A1.txt  
- . . . . . . . . . Table 3.3 -2005 U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2006. . . . . . . . . . . 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282830A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282830A1.txt  
- CINGULAR WIRELESS PCS, LLCSUN VALLEY 06/03/2008 06004.50000 35-06-24.9 N CA MD WQAF398 120-31-01.5 W 0003461811 NEW CINGULAR WIRELESS PCS, LLCSUN VALLEY 06/03/2008 06034.15000 35-06-24.9 N CA MD WQAF398 120-31-01.5 W 0003461811 NEW CINGULAR WIRELESS PCS, LLCSUN VALLEY 06/03/2008 06063.80000 35-06-24.9 N CA MD WQAF398 120-31-01.5 W 0003461811 NEW CINGULAR WIRELESS PCS, LLCSUN VALLEY 06/03/2008 06093.45000 35-06-24.9 N PA MD WQHD431 080-09-04.1 W 0003461938 Conterra Ultra Broadband, LLC Waynesburg 06/04/2008 23125.00000 39-53-43.4 N PA MD WQHD431 080-09-04.1 W 0003461938 Conterra Ultra Broadband, LLC Waynesburg 06/04/2008 23175.00000 39-53-43.4 N PA MD WQHD430 080-09-04.0 W 0003461949 Conterra Ultra Broadband, LLC Waynesburg 06/04/2008 23025.00000 39-53-37.7 N PA MD WQHD525 080-10-05.4 W 0003461952 Conterra Ultra Broadband, LLC FRANKLIN TWP. 06/04/2008 11485.00000 39-54-52.3 N PA MD WQHD525 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-282851A1.pdf  
- of Authority Amendment FiberSat Global Services, Inc. Nature of Service: Fixed Satellite Service This amendment is associated with pending in part Mod license SES-MOD-20071218-01720, and another AMD filed SES-AMD-20080424-00488. 34 ° 13 ' 55.00 " N LAT. SITE ID: 1 20640 BAHAMA ST., LOS ANGELES, CHATSWORTH, CA 118 ° 34 ' 57.30 " W LONG. LOCATION: COMTECH ANTENNA SYSTEMS 1 4.1 meters ANTENNA ID: 5 METER OFFSAT 67.70 dBW COMPRESSED DIGITAL VIDEO, DVB 6315.0000 - 6324.0000 MHz 9M10G7F 62.85 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 3M00G7W COMPRESSED DIGITAL VIDEO, DVB 3700.0000 - 4200.0000 MHz 9M10G7F DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 3M00G7W 67.66 dBW DIGITAL-COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 36M0G7W DIGITAL-COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 36M0G7W Points of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283016A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283016A1.txt  
- 06/12/2008 19560.00000 26-55-35.6 N FL MD WQFS938 082-02-21.0 W 0003470521 Trillion Partners, Inc. Punta Gorda 06/12/2008 23025.00000 26-55-35.6 N FL MD WQFS938 082-02-21.0 W 0003470521 Trillion Partners, Inc. Punta Gorda 06/12/2008 23075.00000 26-55-35.6 N FL MD WQFS938 082-02-21.0 W 0003470521 Trillion Partners, Inc. Punta Gorda 06/12/2008 23125.00000 26-55-35.6 N NM MD KTF32 107-46-57.2 W 0003470535 Qwest Corporation MCCARTYS 06/12/2008 10623.75000 35-04-04.1 N LA NE 089-54-54.0 W 0003465142 Verizon Wireless Personal CommunicationLACOMBE 06/06/2008 06004.50000 30-18-43.0 N LA NE 089-54-54.0 W 0003465142 Verizon Wireless Personal CommunicationLACOMBE 06/06/2008 06034.15000 30-18-43.0 N LA NE 089-54-54.0 W 0003465142 Verizon Wireless Personal CommunicationLACOMBE 06/06/2008 06063.80000 30-18-43.0 N LA NE 089-54-54.0 W 0003465142 Verizon Wireless Personal CommunicationLACOMBE 06/06/2008 06093.45000 30-18-43.0 N PR NE 067-10-09.8 W 0003465325 Centennial Puerto 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283018A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283018A1.txt  
- N NY NE 073-13-14.4 W 0003467270 NEW YORK, STATE OF, OFFICE FOR TEHauppauge 06/10/2008 06845.00000 40-48-33.3 N NY NE 073-47-15.9 W 0003467275 NEW YORK, STATE OF, OFFICE FOR TEValhalla 06/10/2008 06315.84000 41-04-12.0 N NY NE 071-58-31.2 W 0003467277 NEW YORK, STATE OF, OFFICE FOR TEMontauk 06/10/2008 06745.62500 41-01-55.5 N IN NE 086-02-31.6 W 0003467374 INDIANA DEPARTMENT OF TRANSPORWhiteland 06/10/2008 11215.00000 39-42-04.1 N IN NE 086-04-28.4 W 0003467377 INDIANA DEPARTMENT OF TRANSPORGreenwood 06/10/2008 10715.00000 39-38-08.9 N IN NE 086-04-28.4 W 0003467377 INDIANA DEPARTMENT OF TRANSPORGreenwood 06/10/2008 11285.00000 39-38-08.9 N PA NE 077-09-39.1 W 0003467839 CUMBERLAND, COUNTY OF CARLISLE 06/10/2008 10795.00000 40-12-52.1 N PA NE 077-09-38.6 W 0003467842 CUMBERLAND, COUNTY OF CARLISLE 06/10/2008 11285.00000 40-12-54.1 N NY NE 072-46-08.9 W 0003468045 NEW YORK, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283040A1.pdf  
- ALSAT - (ALSAT) Page 2 of 13 E872070 SES-LIC-20080613-00772 E Class of Station: Fixed Earth Stations Application for Authority Saga Radio Networks, LLC Nature of Service: Fixed Satellite Service 42 ° 41 ' 26.50 " N LAT. SITE ID: Lansing 600 W. Cavanaugh, Ingham, Lansing, MI 84 ° 33 ' 36.00 " W LONG. LOCATION: Comtech Antenna Systems, Inc. AI 4.1 meters ANTENNA ID: OFFSAT 128 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 154KG7W 55.85 dBW 128 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 154KG7W 256 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 230KG7W 55.85 dBW 256 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 230KG7W Points of Communication: Lansing - ALSAT - (ALSAT) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283041A1.pdf  
- PSK DIGITAL VIDEO AUDIO/DATA 14000.0000 - 14500.0000 MHz 24M0G7W Points of Communication: 1 - ALSAT - (ALSAT) Page 4 of 23 E080098 SES-LIC-20080508-00566 E Date Effective: 06/16/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 06/16/2008 - 06/16/2023 Application for Authority Crawford Communications, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 61.92 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 3M20G7W 72.43 dBW BPSK, QPSK, 8PSK, QAM, FEC Rates 1/2-7/8, Various Data Rates from 64kbps, Various Information. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW Standard Analog Video 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283153A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283153A1.pdf  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Note 1 to Table 1. 47 C.F.R. § 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1310. 47 C.F.R. § 1.1310. Guidelines, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283223A1.pdf  
- LIST - () E872070 SES-LIC-20080613-00772 E Class of Station: Fixed Earth Stations Application for Authority Saga Radio Networks, LLC Nature of Service: Fixed Satellite Service Page 3 of 18 42 ° 41 ' 26.50 " N LAT. SITE ID: Lansing 600 W. Cavanaugh, Ingham, Lansing, MI 84 ° 33 ' 36.00 " W LONG. LOCATION: Comtech Antenna Systems, Inc. AI 4.1 meters ANTENNA ID: OFFSAT 128 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 154KG7W 55.85 dBW 128 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 154KG7W 256 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 230KG7W 55.85 dBW 256 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 230KG7W Points of Communication: Lansing - ALSAT - (ALSAT) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283424A1.pdf  
- LONG. LOCATION: SCIENTIFIC ATLANTA 1 11 meters ANTENNA ID: 8007 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 80.90 dBW QPSK, DIGITAL VOICE AND DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK, DIGITAL VOICE AND DATA SERVICES 3700.0000 - 4200.0000 MHz 36M0G7W COMTECH 2 4.1 meters ANTENNA ID: 18 FT. "OFFSAT" 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W Page 6 of 9 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMSAT/RSI 3 11.3 meters ANTENNA ID: 110 OCS 83.95 dBW QPSK DIGITAL, VOICE & DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK DIGITAL, VOICE & DATA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283425A1.pdf  
- (114.9 W.L.) E080127 SES-LIC-20080520-00664 E Date Effective: 06/30/2008 Class of Station: Fixed Earth Stations Grant of Authority 06/30/2008 - 06/30/2023 Application for Authority Virginia News Network Nature of Service: Fixed Satellite Service 37 ° 36 ' 51.50 " N LAT. SITE ID: 1 3245 Baise Road, Henrico, Richmond, VA 77 ° 30 ' 51.90 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 0.00 dBW Digital Data 3700.0000 - 4200.0000 MHz 154KG7D 0.00 dBW Digital Data 3700.0000 - 4200.0000 MHz 307KG7D 56.40 dBW Digital Data 5925.0000 - 6425.0000 MHz 154KG7D 59.50 dBW Digital Data 5925.0000 - 6425.0000 MHz 307KG7D Points of Communication: 1 - ALSAT - (ALSAT) E970381 SES-MOD-20070921-01309 E Date Effective: 06/30/2008 Class of Station: Mobile Earth Station 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283520A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283520A1.txt  
- Name Latitude City IN NE 087-24-28.4 W 0003493333 Joink, LLC Terre Haute 07/03/2008 17765.00000 39-29-03.2 N PR NE 065-42-01.5 W 0003493360 SunCom Wireless Puerto Rico License CoNAGUABO 07/03/2008 11205.00000 18-11-50.1 N CA NE 118-00-11.8 W 0003493371 NEW CINGULAR WIRELESS PCS, LLCBALDWIN PARK 07/03/2008 19320.00000 34-03-40.6 N CA NE 117-59-37.8 W 0003493380 NEW CINGULAR WIRELESS PCS, LLCCITY OF INDUSTRY 07/03/2008 17760.00000 34-03-04.1 N CA NE 118-05-15.2 W 0003493399 NEW CINGULAR WIRELESS PCS, LLCPASADENA 07/03/2008 19415.00000 34-09-01.0 N CA NE 118-05-15.2 W 0003493399 NEW CINGULAR WIRELESS PCS, LLCPASADENA 07/03/2008 19445.00000 34-09-01.0 N CA NE 118-05-52.2 W 0003493413 NEW CINGULAR WIRELESS PCS, LLCPASADENA 07/03/2008 17885.00000 34-08-47.2 N CA NE 118-05-01.4 W 0003493439 NEW CINGULAR WIRELESS PCS, LLCPASADENA 07/03/2008 17855.00000 34-08-05.5 N HI NE 155-51-31.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283738A1.pdf  
- 6425.0000 MHz 4M00G7W 73.00 dBW COMPRESSED DIGITAL VIDEO, DATA, TELEPHONY 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E920477 SES-RWL-20080708-00906 E Date Effective: 07/09/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 08/21/2008 - 08/21/2023 Renewal CRAWFORD COMMUNICATIONS, INC. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 73.80 dBW COMPRESSED DIGITAL VIDEO, DATA, TELEPHONY 5925.0000 - 6425.0000 MHz 4M00G7W 73.30 dBW COMPRESSED DIGITAL VIDEO, DATA, TELEPHONY 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E980314 SES-RWL-20080708-00908 E Date Effective: 07/09/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 09/11/2008 - 09/11/2023 Renewal RGP Printing & Office 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283917A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283917A1.txt  
- TeleMed, Inc. ATLANTA 07/16/2008 00956.43750 33-56-03.0 N MI NE P 086-46-53.0 W 0003505870 VILLAGE OF MICHIANA OFFSHORE 07/16/2008 00956.36875 41-50-50.5 N TX NE 101-50-20.8 W 0003507500 CLEARWIRE SPECTRUM HOLDINGS II AMARILLO 07/17/2008 21975.00000 35-12-20.1 N TX NE 101-50-16.1 W 0003507502 CLEARWIRE SPECTRUM HOLDINGS II Amarillo 07/17/2008 23175.00000 35-10-40.0 N NY NE 077-36-36.6 W 0003508099 Microwave Data Systems ROCHESTER 07/17/2008 00928.06875 43-07-04.1 N NY NE 077-36-36.6 W 0003508099 Microwave Data Systems ROCHESTER 07/17/2008 00952.06875 43-07-04.1 N Page 35 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City LA NE 090-57-02.8 W 0003508160 ENTERGY SERVICES, INC. LABADIEVILLE 07/17/2008 06610.00000 29-49-50.5 N CA NE 119-01-14.3 W 0003508410 Southern California Gas Company 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-283963A1.pdf  
- 2.8 meters ANTENNA ID: MODEL 9000 3700.0000 - 4200.0000 MHz 200F9 Points of Communication: 1 - ALSAT - (ALSAT) Page 24 of 27 E910164 SES-RWL-20080721-00959 E Date Effective: 07/22/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 09/25/2008 - 09/25/2023 Renewal Remote Manage, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT OFFSAT" 72.40 dBW STANDARD ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F 72.90 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 36M0G7W 54.00 dBW DIGITAL TRAFFIC, VARIOUS INFORMATION, VARIOUS DATA RATES, VARIOUS FEC 5925.0000 - 6425.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E950253 SES-STA-20080617-00809 E Date Effective: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284159A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284159A1.txt  
- WPDH773 071-03-34.0 W 0003516285 Arch Wireless License Co LLC FALL RIVER 07/25/2008 00929.96250 41-43-17.0 N MA RM WPDH773 071-09-31.2 W 0003516285 Arch Wireless License Co LLC TAUNTON 07/25/2008 00929.96250 41-52-59.4 N Page 6 GS - Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA RM WPDH773 070-44-04.1 W 0003516285 Arch Wireless License Co LLC WAREHAM 07/25/2008 00929.96250 41-46-57.4 N RI RM WPDH773 071-31-56.2 W 0003516285 Arch Wireless License Co LLC WEST WARWICK 07/25/2008 00929.96250 41-42-28.4 N FL RM WPDJ404 081-47-12.0 W 0003516570 Arch Wireless License Co LLC BONITA SPRINGS 07/25/2008 00929.96250 26-19-01.0 N FL RM WPDJ404 081-32-17.0 W 0003516570 Arch Wireless License Co LLC FROSTPROOF 07/25/2008 00929.96250 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284170A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284170A1.txt  
- School Board of Charlotte County 154.49000000 Rotonda West 26-54-51.0 N FL 82-17-18.0 W 3 1 08/16/2007 WPUG835 MO The School Board of Charlotte County 154.49000000 -- -- 4 1 08/16/2007 WPUG835 MO The School Board of Charlotte County 159.51000000 -- -- 4 1 06/25/2008 WQAZ397 FB2C DEACONESS HEALTH SYSTEM LLC D B A DEAC 461.63750000 OKLAHOMA C 35-31-35.2 N OK 97-35-4.1 W 1 1 06/25/2008 WQAZ397 FB2C DEACONESS HEALTH SYSTEM LLC D B A DEAC 463.46250000 OKLAHOMA C 35-31-35.2 N OK 97-35-4.1 W 1 1 06/25/2008 WQAZ397 FB2C DEACONESS HEALTH SYSTEM LLC D B A DEAC 464.43750000 OKLAHOMA C 35-31-35.2 N OK 97-35-4.1 W 1 1 06/25/2008 WQAZ397 MO DEACONESS HEALTH SYSTEM LLC D B A DEAC 461.63750000 -- -- 2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284190A1.pdf  
- E Date Effective: 07/29/2008 Class of Station: Fixed Earth Stations Grant of Authority 07/29/2008 - 07/29/2023 Application for Authority Saga Radio Networks, LLC Nature of Service: Fixed Satellite Service 42 ° 41 ' 26.50 " N LAT. SITE ID: Lansing 600 W. Cavanaugh, Ingham, Lansing, MI 84 ° 33 ' 36.00 " W LONG. LOCATION: Comtech Antenna Systems, Inc. AI 4.1 meters ANTENNA ID: OFFSAT 128 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 154KG7W 55.85 dBW 128 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 154KG7W 256 KB Digital Coded SCPC Voice 3700.0000 - 4200.0000 MHz 230KG7W 55.85 dBW 256 KB Digital Coded SCPC Voice 5925.0000 - 6425.0000 MHz 230KG7W Points of Communication: Lansing - ALSAT - (ALSAT) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284321A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284321A2.txt  
- 54.4 $561,771 0.0 0.0 0.0 0.0100.0 $27,977 0.0 0.0 0.0 0.0100.0 76,845,009 0.016.5 1.617.8 64.1 Angola $6,702,223 0.023.6 6.1 7.9 62.4 $142,872 0.0 0.0 0.0 0.0100.0 $22,706 0.0 0.0 0.0 0.0100.0 26,262,698 0.014.910.016.6 58.5 Benin $2,187,003 0.0 6.1 7.243.2 43.5 $92,925 0.0 0.0 0.0 4.8 95.2 $128 0.0 0.0 0.0 0.0100.0 27,092,126 0.0 2.1 8.648.6 40.7 Botswana $5,664,507 0.876.5 0.0 4.1 18.5 $101,935 0.0 5.9 0.0 0.0 94.1 $48 0.0 0.0 0.0 0.0100.0 33,593,992 0.571.6 0.0 5.3 22.6 Burkina $3,199,797 0.017.1 8.546.1 28.3 $206,928 0.0 0.0 0.010.3 89.7 $1,803 0.0 0.0 0.0 0.0100.0 21,276,558 0.011.7 7.951.2 29.3 Burundi $372,892 0.016.613.836.6 33.1 $108,780 0.0 0.0 0.0 0.0100.0 $501 0.0 0.0 0.0 0.0100.0 6,566,244 0.010.8 4.727.1 57.4 Cameroon $13,086,623 2.618.9 1.132.6 44.8 $994,922 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284363A1.pdf  
- LONG. LOCATION: SCIENTIFIC ATLANTA 1 11 meters ANTENNA ID: 8007 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 80.90 dBW QPSK, DIGITAL VOICE AND DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK, DIGITAL VOICE AND DATA SERVICES 3700.0000 - 4200.0000 MHz 36M0G7W COMTECH 2 4.1 meters ANTENNA ID: 18 FT. "OFFSAT" 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F9W COMSAT/RSI 3 11.3 meters ANTENNA ID: 110 OCS 83.95 dBW QPSK DIGITAL, VOICE & DATA SERVICES 5925.0000 - 6425.0000 MHz 36M0G7W QPSK DIGITAL, VOICE & DATA SERVICES 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284492A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284492A1.txt  
- 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY NE 073-50-56.6 W 0003536298 Northrop Grumman Information TechnologQueens 08/06/2008 23175.00000 40-41-41.8 N NY NE 073-50-56.6 W 0003536298 Northrop Grumman Information TechnologQueens 08/06/2008 23225.00000 40-41-41.8 N NY NE 073-53-16.0 W 0003536299 Northrop Grumman Information TechnologBrooklyn 08/06/2008 23125.00000 40-38-04.1 N NY NE 073-53-16.0 W 0003536299 Northrop Grumman Information TechnologBrooklyn 08/06/2008 23175.00000 40-38-04.1 N NY NE 073-53-16.0 W 0003536299 Northrop Grumman Information TechnologBrooklyn 08/06/2008 23225.00000 40-38-04.1 N NY NE 073-52-43.5 W 0003536301 Northrop Grumman Information TechnologBrooklyn 08/06/2008 23025.00000 40-39-52.8 N NY NE 073-52-43.5 W 0003536301 Northrop Grumman Information TechnologBrooklyn 08/06/2008 23075.00000 40-39-52.8 N NY NE 073-52-43.5 W 0003536301 Northrop Grumman 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284659A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284659A1.txt  
- CA MD KNKN228 118-09-34.3 W 0003546160 Cellco Partnership INDEPENDENCE 08/15/2008 36-47-54.8 N CA MD KNKA228 121-54-17.8 W 0003546967 GTE Mobilnet of California Limited PartneDanville 08/15/2008 37-49-27.7 N CA MD KNKA228 121-34-56.9 W 0003546967 GTE Mobilnet of California Limited PartneIselton 08/15/2008 38-07-38.7 N CA MD KNKA228 122-42-59.1 W 0003546967 GTE Mobilnet of California Limited PartneLagunitas 08/15/2008 38-01-38.2 N CA MD KNKA228 122-24-04.1 W 0003546967 GTE Mobilnet of California Limited PartnePescadero 08/15/2008 37-14-20.8 N CA MD KNKN346 119-43-35.7 W 0003547131 California RSA No. 4 Limited PartnershipCoarsegold 08/15/2008 37-15-39.4 N Page 8 CR - Rural Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO KNKM679 0003545915 The Ponderosa Telephone Co. 08/15/2008 RO KNKO710 0003545916 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284698A1.pdf  
- - 6425.0000 MHz 36M0G7F 3700.0000 - 4200.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0G7F Points of Communication: 1 - ALSAT - (ALSAT) E900620 SES-RWL-20080812-01052 E Date Effective: 08/14/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 09/21/2008 - 09/21/2023 Renewal Sure Shot Transmissions, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F39 Points of Communication: 1 - ALSAT - (ALSAT) E000700 SES-STA-20080702-00872 E Date Effective: 08/19/2008 Class of Station: Grant of Authority Special Temporary Authority MCI COMMUNICATIONS SERVICES, INC. (FKA MCI WOLRDCOM COMMUNICATIONS, INC.) Extension of special temporary authority is GRANTED for an additional 180 days beginning September 8, 2008 and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284856A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284856A1.txt  
- N UT NE 113-22-26.5 W 0003556918 WWC License, L.L.C. Cedar City 08/21/2008 06197.24000 37-38-38.8 N OK NE 097-17-07.0 W 0003557137 Cox Oklahoma Telcom Inc. NORMAN 08/21/2008 11345.00000 35-15-27.0 N OK NE 097-25-20.2 W 0003557227 Cox Oklahoma Telcom Inc. Oklahoma City 08/21/2008 10855.00000 35-13-29.2 N ID NE 112-35-16.0 W 0003557265 WWC Holding Co., Inc. SHELLY 08/21/2008 06605.00000 43-32-15.0 N PA NE 076-44-04.1 W 0003557354 TELECOM TRANSPORT MANAGEMENTMIDDLETOWN 08/21/2008 21480.00000 40-12-57.0 N PA NE 076-41-09.5 W 0003557355 TELECOM TRANSPORT MANAGEMENTMiddletown 08/21/2008 11095.00000 40-11-09.7 N PA NE 076-41-09.5 W 0003557355 TELECOM TRANSPORT MANAGEMENTMiddletown 08/21/2008 21580.00000 40-11-09.7 N PA NE 076-42-02.0 W 0003557356 TELECOM TRANSPORT MANAGEMENTMiddletown 08/21/2008 11265.00000 40-13-15.0 N PA NE 076-42-02.0 W 0003557356 TELECOM TRANSPORT MANAGEMENTMiddletown 08/21/2008 11325.00000 40-13-15.0 N PA NE 076-42-02.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284926A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284926A1.txt  
- 36.0 313 1.5 144 0.7 271 1.3 146 0.7 12,128 59.7 20,302 Kansas 5,097 31.2 533 3.3 122 0.7 266 1.6 175 1.1 10,144 62.1 16,337 Kentucky 7,602 36.3 521 2.5 103 0.5 433 2.1 144 0.7 12,133 57.9 20,937 Louisiana 8,672 41.6 561 2.7 116 0.6 485 2.3 222 1.1 10,781 51.7 20,837 Maine 2,575 47.5 29 0.5 224 4.1 100 1.8 41 0.8 2,450 45.2 5,418 Maryland 14,751 57.5 66 0.3 269 1.0 609 2.4 185 0.7 9,785 38.1 25,666 Massachusetts 19,499 51.6 57 0.2 735 1.9 833 2.2 266 0.7 16,405 43.4 37,794 Michigan 19,653 39.3 601 1.2 292 0.6 937 1.9 657 1.3 27,884 55.7 50,024 Minnesota 11,438 42.2 218 0.8 345 1.3 487 1.8 196 0.7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284932A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-284932A1.txt  
- Chart 2.11Percent of U.S. Households with Internet Connections: Rural vs Urban.....................2-13 Consumer Expenditures.......................................................................................3-1 Table 3.1Household Expenditures for Telephone Service................................................3-3 Table 3.2Average Monthly Household Telecommunications Expenditures by Type of Provider....................................................................................3-4 Table 3.3Personal Consumption Expenditures.............................................................3-5 Chart 3.1Personal Consumption Expenditures for Telephone Service.................................3-6 Chart 3.2Monthly Personal Consumption Expenditures for Telephone Service per Household......3-6 Introduction.................................................................................................... Access Charges................................................................................................ Advanced Telecommunications.............................................................................. i Earnings ....................................................................................................... 4-1 Table 4.1Interstate Rate of Return Summary: Years 1998 through 2006 ..............................4-3 Employment and Labor Productivity ................................................................... 5-1 Table 5.1Average Number of Employees in the Telecommunications Industry ..................... 5-3 Chart 5.1Average Number of Employees in the Telecommunications Industry ........................5-3 Table 5.2Labor Productivity Index for the Wired and Wireless Telecommunications Industry .....................................................................5-4 Chart 5.2Wired and Wireless Telecommunications Carriers (NAICS 5171 and 5172) Labor Productivity 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285239A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285239A1.txt  
- Company, LLCARNOLD 09/02/2008 11225.00000 39-01-40.5 N MD NE 076-30-14.3 W 0003565138 Sprint Wireless Broadband Company, LLCARNOLD 09/02/2008 11265.00000 39-01-40.5 N MD NE 076-30-14.3 W 0003565138 Sprint Wireless Broadband Company, LLCARNOLD 09/02/2008 11385.00000 39-01-40.5 N MD NE 076-30-14.3 W 0003565138 Sprint Wireless Broadband Company, LLCARNOLD 09/02/2008 11425.00000 39-01-40.5 N MD NE 076-36-39.0 W 0003565139 Sprint Wireless Broadband Company, LLCBaltimore 09/02/2008 11095.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003565139 Sprint Wireless Broadband Company, LLCBaltimore 09/02/2008 11175.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003565139 Sprint Wireless Broadband Company, LLCBaltimore 09/02/2008 23325.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003565139 Sprint Wireless Broadband Company, LLCBaltimore 09/02/2008 23425.00000 39-19-04.1 N MD NE 076-36-38.8 W 0003565140 Sprint Wireless Broadband Company, LLCBALTIMORE 09/02/2008 22125.00000 39-17-21.5 N MD NE 076-36-38.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285241A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285241A1.txt  
- W 0003568084 WINNEBAGO, COUNTY OF Oshkosh 09/04/2008 10551.87500 44-01-17.0 N WI NE 088-39-15.0 W 0003568085 WINNEBAGO, COUNTY OF OMRO 09/04/2008 06825.62500 44-01-51.0 N WI NE 088-39-15.0 W 0003568085 WINNEBAGO, COUNTY OF OMRO 09/04/2008 10616.87500 44-01-51.0 N WI NE 088-39-15.0 W 0003568085 WINNEBAGO, COUNTY OF OMRO 09/04/2008 10623.12500 44-01-51.0 N FL NE 082-47-41.7 W 0003568109 PINELLAS, COUNTY OF Largo 09/04/2008 11245.00000 27-54-04.1 N FL NE 082-47-41.7 W 0003568109 PINELLAS, COUNTY OF Largo 09/04/2008 11325.00000 27-54-04.1 N CA NE 118-13-31.3 W 0003568660 Los Angeles, County of Compton 09/04/2008 10623.75000 33-53-39.1 N CA NE 118-13-31.3 W 0003568731 Los Angeles, County of Compton 09/04/2008 18815.00000 33-53-39.1 N CA NE 118-13-31.3 W 0003570190 Los Angeles, County of Compton 09/05/2008 18785.00000 33-53-39.1 N CA NE 118-13-31.3 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285256A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285256A1.txt  
- 5 meters ANTENNA ID: ES-40200CD 3700.0000 - 4200.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) Page 24 of 40 E890931 SES-RWL-20080829-01119 E Date Effective: 09/04/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 10/06/2008 - 10/06/2023 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 63.90 dBW 5925.0000 - 6425.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E910543 SES-RWL-20080829-01120 E Date Effective: 09/04/2008 Class of Station: Temporary Fixed Earth Station Grant of Authority 10/04/2008 - 10/04/2023 Renewal RCN License Subsidiary, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: DALSAT 1 4.5 meters ANTENNA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285508A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285508A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285508A1.txt  
- (UNEs) that they leased from other carriers, and 22% through resale arrangements with unaffiliated carriers. Incumbent LECs reported providing about 11% fewer UNE loops with switching (referred to as the UNE-Platform) to unaffiliated carriers at the end of December 2007 than they reported six months earlier (5.5 million compared to 6.2 million) and about 4% fewer UNE loops without switching (4.1 million compared to 4.3 million). Incumbent LECs were the presubscribed interstate long distance carrier for 59% of the switched access lines they provided to end users, while CLECs were the interstate long distance carrier for 78% of their switched access lines. As additional information becomes available, it will be posted on the Commission's Internet site. Note that, on June 12, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285754A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285754A1.txt  
- Name Latitude City TX MD WPUU769 099-25-01.0 W 0003589558 Forest Oil Corporation San Ygnacio 09/23/2008 00928.63125 27-05-56.0 N TX MD WPUU769 099-25-01.0 W 0003589558 Forest Oil Corporation San Ygnacio 09/23/2008 00952.35625 27-05-56.0 N TX MD WPUU769 099-25-01.0 W 0003589558 Forest Oil Corporation San Ygnacio 09/23/2008 00952.63125 27-05-56.0 N TX MD WPXF926 099-15-01.1 W 0003589575 Forest Oil Corporation ZAPATA 09/23/2008 00928.28125 26-55-04.1 N TX MD WPXF926 099-15-01.1 W 0003589575 Forest Oil Corporation ZAPATA 09/23/2008 00952.05625 26-55-04.1 N TX MD WPXF926 099-15-01.1 W 0003589575 Forest Oil Corporation ZAPATA 09/23/2008 00952.28125 26-55-04.1 N CO MD WQCT261 106-49-06.6 W 0003589962 RESORT BROADBAND, LLC STEAMBOAT SPRIN 09/23/2008 18065.00000 40-27-34.9 N CO MD WQCT261 106-49-06.6 W 0003589962 RESORT BROADBAND, LLC STEAMBOAT SPRIN 09/23/2008 22575.00000 40-27-34.9 N CO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285930A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-285930A1.txt  
- action. E080206 SES-AMD-20080925-01238 E Class of Station: Fixed Earth Stations Amendment America's Collectible Network, Inc. d/b/a Jewelry Television Nature of Service: Fixed Satellite Service "AMD" to change emission designator and related service. 35 ° 54 ' 43.80 " N LAT. SITE ID: 1 190 Hayfield DR, Knox, Knoxville, TN 84 ° 6 ' 8.00 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 71.34 dBW Digital traffic, various FEC, various data rates, various modulation 5925.0000 - 6425.0000 MHz 36M0G7W 64.81 dBW Digital traffic, various FEC, various data rates, various modulation 5925.0000 - 6425.0000 MHz 8M00G7W 72.40 dBW Analog video 5925.0000 - 6425.0000 MHz 36M0F3F Digital traffic, various FEC, various data rates, various modulation 3700.0000 - 4200.0000 MHz 36M0G7W Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286178A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286178A1.txt  
- Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD WNTU733 087-18-44.1 W 0003611752 NORTHERN INDIANA PUBLIC SERVICETHAYER 10/15/2008 06743.75000 41-10-27.1 N IN MD WNTU732 087-01-23.0 W 0003611754 NORTHERN INDIANA PUBLIC SERVICEWHEATFIELD 10/15/2008 06583.75000 41-13-01.1 N IN MD WED429 087-23-56.1 W 0003611755 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 10/15/2008 06588.75000 41-27-04.1 N IN MD WHJ971 087-27-53.1 W 0003611756 NORTHERN INDIANA PUBLIC SERVICEST. JOHN 10/15/2008 06748.75000 41-25-05.1 N IN MD WNEM823 087-19-09.1 W 0003611757 NORTHERN INDIANA PUBLIC SERVICEGARY 10/15/2008 11621.25000 41-35-18.1 N IN MD KSH40 087-17-58.1 W 0003611758 NORTHERN INDIANA PUBLIC SERVICEGARY 10/15/2008 11131.25000 41-35-30.1 N IN MD WED819 087-27-35.1 W 0003611759 NORTHERN INDIANA PUBLIC SERVICEHIGHLAND 10/15/2008 06583.75000 41-31-38.1 N IN MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286201A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286201A1.txt  
- ALSAT - (ALSAT) E980388 SES-RWL-20081015-01326 E Date Effective: 10/20/2008 Class of Station: Fixed Earth Stations Grant of Authority 11/18/2008 - 11/18/2023 Renewal Videocom Satellite Associates,inc Nature of Service: Domestic Fixed Satellite Service 30 ° 30 ' 14.00 " N LAT. SITE ID: 1 1801 HALSTEAD BLVD., LEON, TALLAHASSEE, FL 84 ° 14 ' 53.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW ANALOG, VIDEO/AUDIO 6385.0000 - 6405.0000 MHz 36M0F3F 73.20 dBW COMPRESSED DIGITAL VIDEO 6291.2900 - 6425.0000 MHz 8M00G7F 72.40 dBW ANALOG, VIDEO/AUDIO 6245.0000 - 6245.0000 MHz 36M0F3F 73.20 dBW COMPRESSED DIGITAL VIDEO 6212.3400 - 6281.0900 MHz 8M00G7F 72.40 dBW ANALOG, VIDEO/AUDIO 5985.0000 - 6145.0000 MHz 36M0F3F 73.20 dBW COMPRESSED DIGITAL VIDEO 5960.3000 - 6182.1400 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286358A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286358A1.txt  
- IL NE 087-41-10.9 W 0003614468 Sprint Wireless Broadband Company, LLCMarkham 10/17/2008 21925.00000 41-36-43.3 N IL NE 087-41-10.9 W 0003614468 Sprint Wireless Broadband Company, LLCMarkham 10/17/2008 21975.00000 41-36-43.3 N IL NE 087-48-31.7 W 0003614469 Sprint Wireless Broadband Company, LLCPalos Hills 10/17/2008 23075.00000 41-41-18.4 N IL NE 087-48-31.7 W 0003614469 Sprint Wireless Broadband Company, LLCPalos Hills 10/17/2008 23175.00000 41-41-18.4 N IL NE 087-56-04.1 W 0003614470 Sprint Wireless Broadband Company, LLCHinsdale 10/17/2008 23175.00000 41-45-09.8 N IL NE 088-09-51.5 W 0003614471 Sprint Wireless Broadband Company, LLCWest Chicago 10/17/2008 19325.00000 41-54-28.7 N IL NE 088-09-51.5 W 0003614471 Sprint Wireless Broadband Company, LLCWest Chicago 10/17/2008 19375.00000 41-54-28.7 N IL NE 088-09-51.5 W 0003614471 Sprint Wireless Broadband Company, LLCWest Chicago 10/17/2008 19425.00000 41-54-28.7 N IL NE 088-09-51.5 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286359A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286359A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD MD WQIW431 076-56-22.0 W 0003617189 FiberTower Network Services Corp. CLARKSVILLE 10/21/2008 23075.00000 39-12-47.9 N MD MD WQIY713 076-31-35.4 W 0003617192 FiberTower Network Services Corp. Annapolis 10/21/2008 10715.00000 38-59-50.0 N MD MD WQIY713 076-31-35.4 W 0003617192 FiberTower Network Services Corp. Annapolis 10/21/2008 23175.00000 38-59-50.0 N MD MD WQIX935 076-59-04.1 W 0003617195 FiberTower Network Services Corp. DAYTON 10/21/2008 11285.00000 39-15-35.2 N MD MD WQIX935 076-59-04.1 W 0003617195 FiberTower Network Services Corp. DAYTON 10/21/2008 11325.00000 39-15-35.2 N CA MD WQJE906 121-21-23.0 W 0003617594 NEXTLINK WIRELESS INC. ROSEVILLE 10/21/2008 11285.00000 38-45-03.0 N CA MD WQJE906 121-21-23.0 W 0003617594 NEXTLINK WIRELESS INC. ROSEVILLE 10/21/2008 11325.00000 38-45-03.0 N CA MD WQJE906 121-21-23.0 W 0003617594 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286679A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286679A1.txt  
- the dates specified. E080206 SES-AMD-20080925-01238 E Date Effective: 11/10/2008 Class of Station: Fixed Earth Stations Grant of Authority Amendment America's Collectible Network, Inc. d/b/a Jewelry Television Nature of Service: Fixed Satellite Service 35 ° 54 ' 43.80 " N LAT. SITE ID: 1 190 Hayfield DR, Knox, Knoxville, TN 84 ° 6 ' 8.00 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: Offsat 71.34 dBW Digital traffic, various FEC, various data rates, various modulation 5925.0000 - 6425.0000 MHz 36M0G7W 64.81 dBW Digital traffic, various FEC, various data rates, various modulation 5925.0000 - 6425.0000 MHz 8M00G7W 72.40 dBW Analog video 5925.0000 - 6425.0000 MHz 36M0F3F Digital traffic, various FEC, various data rates, various modulation 3700.0000 - 4200.0000 MHz 36M0G7W Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286683A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286683A1.txt  
- - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ID NE 113-23-57.0 W 0003640174 HJ LLC Carey 11/07/2008 10975.00000 42-43-53.0 N ID NE 113-23-57.0 W 0003640174 HJ LLC Carey 11/07/2008 11175.00000 42-43-53.0 N ID NE 112-26-52.1 W 0003640177 HJ LLC Pocatello 11/07/2008 23025.00000 42-51-48.8 N FL RM WNEQ368 082-31-04.1 W 0003635302 Florida Power Corporation, d/b/a ProgressHOMOSASSA SPRI 11/03/2008 00928.83125 28-49-49.1 N FL RM WNEQ368 082-31-04.1 W 0003635302 Florida Power Corporation, d/b/a ProgressHOMOSASSA SPRI 11/03/2008 00952.83125 28-49-49.1 N TX RM KDQ93 101-12-31.4 W 0003637214 COLORADO RIVER MUNICIPAL WATERIRA 11/05/2008 06685.00000 32-35-00.4 N TX RM KDQ92 101-19-01.4 W 0003638840 COLORADO RIVER MUNICIPAL WATERBIG SPRING 11/06/2008 06585.00000 32-27-00.4 N TX RM KDQ92 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286685A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286685A1.txt  
- 120-57-16.8 W 0003636311 Oregon State of (OWIN) PRINEVILLE 11/04/2008 00958.15000 44-26-15.8 N OR MD WNTD884 120-57-16.8 W 0003636311 Oregon State of (OWIN) PRINEVILLE 11/04/2008 06093.45000 44-26-15.8 N OR MD WNTD884 120-57-16.8 W 0003636311 Oregon State of (OWIN) PRINEVILLE 11/04/2008 06123.10000 44-26-15.8 N OR MD WNTD884 120-57-16.8 W 0003636311 Oregon State of (OWIN) PRINEVILLE 11/04/2008 06585.00000 44-26-15.8 N OR MD WQHF919 122-33-04.1 W 0003636312 Oregon State of (OWIN) PORTLAND 11/04/2008 06286.19000 45-27-16.0 N OR MD WQHF919 122-33-04.1 W 0003636312 Oregon State of (OWIN) PORTLAND 11/04/2008 06315.84000 45-27-16.0 N OR MD WQHF919 122-33-04.1 W 0003636312 Oregon State of (OWIN) PORTLAND 11/04/2008 10755.00000 45-27-16.0 N OR MD WQHP811 123-07-26.8 W 0003636314 Oregon State of (OWIN) SALEM 11/04/2008 06034.15000 44-51-13.5 N OR MD WQHP811 123-07-26.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286830A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286830A1.txt  
- MN NE 093-14-57.1 W 0003646724 Telecom Transport Management, Inc. Spring Lake Park 11/12/2008 22510.00000 45-07-04.0 N MN NE 093-15-34.6 W 0003646741 Telecom Transport Management, Inc. Minneapolis 11/12/2008 22180.00000 44-57-40.0 N MN NE 093-15-34.6 W 0003646741 Telecom Transport Management, Inc. Minneapolis 11/12/2008 22230.00000 44-57-40.0 N MN NE 093-15-34.6 W 0003646741 Telecom Transport Management, Inc. Minneapolis 11/12/2008 22280.00000 44-57-40.0 N MN NE 093-16-04.1 W 0003646831 Telecom Transport Management, Inc. Minneapolis 11/12/2008 23380.00000 44-58-09.1 N MN NE 093-15-25.9 W 0003646833 Telecom Transport Management, Inc. Minneapolis 11/12/2008 23430.00000 44-58-17.0 N MN NE 093-17-02.0 W 0003646845 Telecom Transport Management, Inc. Minneapolis 11/12/2008 17935.00000 45-00-45.0 N MN NE 093-17-02.0 W 0003646845 Telecom Transport Management, Inc. Minneapolis 11/12/2008 21560.00000 45-00-45.0 N MN NE 093-17-02.0 W 0003646845 Telecom Transport 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286834A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286834A1.txt  
- 0003649556 NORTHERN INDIANA PUBLIC SERVICETHAYER 11/14/2008 06743.75000 41-10-27.1 N Page 19 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD WNTU732 087-01-23.0 W 0003649557 NORTHERN INDIANA PUBLIC SERVICEWHEATFIELD 11/14/2008 06583.75000 41-13-01.1 N IN MD WED429 087-23-56.1 W 0003649558 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 11/14/2008 06588.75000 41-27-04.1 N IN MD WHJ971 087-27-53.1 W 0003649559 NORTHERN INDIANA PUBLIC SERVICEST. JOHN 11/14/2008 06748.75000 41-25-05.1 N IN MD WNEM823 087-19-09.1 W 0003649560 NORTHERN INDIANA PUBLIC SERVICEGARY 11/14/2008 11621.25000 41-35-18.1 N IN MD KSH40 087-17-58.1 W 0003649561 NORTHERN INDIANA PUBLIC SERVICEGARY 11/14/2008 11131.25000 41-35-30.1 N IN MD WED819 087-27-35.1 W 0003649562 NORTHERN INDIANA PUBLIC SERVICEHIGHLAND 11/14/2008 06583.75000 41-31-38.1 N IN MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286957A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286957A1.txt  
- LLC WALBRIDGE 11/17/2008 41-31-57.2 N OH MD KNKA283 084-06-51.8 W 0003652512 Alltel Communications, LLC Wauseon 11/17/2008 41-33-07.2 N NC MD KNKN641 076-45-48.7 W 0003652513 Alltel Communications, LLC Aurora 11/17/2008 35-18-12.6 N NC MD KNKN641 076-52-08.1 W 0003652513 Alltel Communications, LLC AURORA 11/17/2008 35-17-50.9 N NC MD KNKN641 077-25-55.8 W 0003652513 Alltel Communications, LLC AYDEN 11/17/2008 35-29-27.4 N NC MD KNKN641 077-22-04.1 W 0003652513 Alltel Communications, LLC BETHEL 11/17/2008 35-47-11.4 N NC MD KNKN641 075-32-37.0 W 0003652513 Alltel Communications, LLC BUXTON 11/17/2008 35-16-02.0 N NC MD KNKN641 077-02-40.8 W 0003652513 Alltel Communications, LLC CHOCOWINITY TOW 11/17/2008 35-29-14.6 N NC MD KNKN641 076-12-52.0 W 0003652513 Alltel Communications, LLC Columbia 11/17/2008 35-55-16.6 N Page 42 CL - Cellular State Purpose Call Sign Longitude Area 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286958A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-286958A1.txt  
- Michigan RSA #1 andNEWBERRY 11/18/2008 46-18-53.0 N MI MD KNKQ320 085-04-09.1 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andNEWBERRY 11/18/2008 46-37-50.8 N MI MD KNKQ320 086-59-21.4 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andRAPID RIVER 11/18/2008 45-55-18.5 N MI MD KNKQ320 084-49-55.6 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSAINT IGNACE 11/18/2008 45-53-13.8 N MI MD KNKQ320 084-20-04.1 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSAULT SAINT MAR 11/18/2008 46-29-08.0 N MI MD KNKQ320 084-24-41.5 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSault Sainte Marie 11/18/2008 46-21-52.8 N MI MD KNKQ320 085-57-38.5 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSENEY 11/18/2008 46-20-36.9 N MI MD KNKQ320 087-08-26.4 W 0003652676 ALLTEL Wireless of Michigan RSA #1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287093A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287093A1.txt  
- of the SouthwesAlbuquerque 11/24/2008 35-12-23.4 N NM MD KNKA332 106-27-08.8 W 0003658142 ALLTEL Communications of the SouthwesAlbuquerque 11/24/2008 35-13-00.0 N NM MD KNKA332 106-41-45.1 W 0003658142 ALLTEL Communications of the SouthwesALBUQUERQUE 11/24/2008 34-59-04.2 N NM MD KNKA332 106-31-05.1 W 0003658142 ALLTEL Communications of the SouthwesALBUQUERQUE 11/24/2008 35-04-16.2 N NM MD KNKA332 106-26-58.1 W 0003658142 ALLTEL Communications of the SouthwesALBUQUERQUE 11/24/2008 35-23-04.1 N NM MD KNKA332 106-21-36.1 W 0003658142 ALLTEL Communications of the SouthwesCedar Crest 11/24/2008 35-07-23.1 N Page 42 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NM MD KNKA332 107-27-51.0 W 0003658142 ALLTEL Communications of the SouthwesCounselor 11/24/2008 36-12-32.3 N NM MD KNKA332 107-00-34.3 W 0003658142 ALLTEL Communications 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287094A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287094A1.txt  
- LLC YOUNGSVILLE 11/25/2008 35-58-27.7 N NC AM KNKN770 078-14-55.0 W 0003652509 Alltel Communications, LLC ZEBULON 11/25/2008 35-50-06.6 N NC AM KNKN641 076-45-48.7 W 0003652513 Alltel Communications, LLC Aurora 11/25/2008 35-18-12.6 N NC AM KNKN641 076-52-08.1 W 0003652513 Alltel Communications, LLC AURORA 11/25/2008 35-17-50.9 N NC AM KNKN641 077-25-55.8 W 0003652513 Alltel Communications, LLC AYDEN 11/25/2008 35-29-27.4 N NC AM KNKN641 077-22-04.1 W 0003652513 Alltel Communications, LLC BETHEL 11/25/2008 35-47-11.4 N NC AM KNKN641 075-32-37.0 W 0003652513 Alltel Communications, LLC BUXTON 11/25/2008 35-16-02.0 N NC AM KNKN641 077-02-40.8 W 0003652513 Alltel Communications, LLC CHOCOWINITY TOW 11/25/2008 35-29-14.6 N NC AM KNKN641 076-12-52.0 W 0003652513 Alltel Communications, LLC Columbia 11/25/2008 35-55-16.6 N NC AM KNKN641 076-22-59.8 W 0003652513 Alltel Communications, LLC Creswell 11/25/2008 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287180A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287180A1.txt  
- Telecommunications Regulation and Market Developments September 2008 US Online Population (2000  2007) 0 20 40 60 80 100 120 140 160 180 2000 2001 2002 2003 2004 2005 2006 2007 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% Online Population (Number) Online Population (Percent) Millions of Adu lts Percent of Population Source: Harris Interactive. 23.0 100.9 4.1 15.8 65.3 9.2 32.0 42.5 0 20 40 60 80 100 2000 2001 2002 2003 2004 2005 2006 Millio ns Power Line and Other Satellite and Wireless Devices Fiber Cable Modem SDSL and Traditional Wireline ADSL High Speed Line Growth (2000  2007)* · All figures as of June 30th. Source: FCC's High Speed Services for Internet Access Report, March 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287183A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287183A1.txt  
- Content-Type: text/plain Content-Transfer-Encoding: 8bit Collaborative Convergence: User Empowerment in the Global Digital Economy October 2008 23.0 100.9 4.1 15.8 65.3 9.2 32.0 42.5 0 20 40 60 80 100 2000 2001 2002 2003 2004 2005 2006 Millio ns Power Line and Other Satellite and Wireless Devices Fiber Cable Modem SDSL and Traditional Wireline ADSL High Speed Line Growth (2000  2007)* · All figures as of June 30th. Source: FCC's High Speed Services for Internet Access Report, March 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287184A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287184A1.txt  
- J. Martin US Online Population (2000  2007) 0 20 40 60 80 100 120 140 160 180 2000 2001 2002 2003 2004 2005 2006 2006 2007 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% Online Population (Number) Online Population (Percent) Millions of Adu lts Percent of Population Source: Harris Interactive. Chairman Kevin J. Martin 23.0 100.9 4.1 15.8 65.3 9.2 32.0 42.5 0 20 40 60 80 100 2000 2001 2002 2003 2004 2005 2006 Millio ns Power Line and Other Satellite and Wireless Devices Fiber Cable Modem SDSL and Traditional Wireline ADSL High Speed Line Growth (2000  2007)* · All figures as of June 30th. Source: FCC's High Speed Services for Internet Access Report, March 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287238A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287238A1.txt  
- 12/01/2008 10835.00000 45-50-09.9 N MN NE 095-12-11.7 W 0003663232 Wisper Wireless Solutions, LLC Osakis 12/01/2008 10915.00000 45-50-09.9 N MN NE 094-58-49.3 W 0003663233 Wisper Wireless Solutions, LLC SAUK CENTRE 12/01/2008 05974.85000 45-44-28.2 N MN NE 094-58-49.3 W 0003663233 Wisper Wireless Solutions, LLC SAUK CENTRE 12/01/2008 11405.00000 45-44-28.2 N MN NE 095-08-41.6 W 0003663234 Wisper Wireless Solutions, LLC Osakis 12/01/2008 11325.00000 45-52-04.1 N MN NE 094-39-05.2 W 0003663235 Wisper Wireless Solutions, LLC Swanville 12/01/2008 11245.00000 45-58-43.3 N MN NE 094-54-00.0 W 0003663236 Wisper Wireless Solutions, LLC LONG PRAIRIE 12/01/2008 06226.89000 45-58-38.0 N MN NE 094-54-00.0 W 0003663236 Wisper Wireless Solutions, LLC LONG PRAIRIE 12/01/2008 10755.00000 45-58-38.0 N WV NE 081-39-21.4 W 0003664125 Gray Television License, Inc. Charleston 12/02/2008 21825.00000 - 21925.00000 38-22-31.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287583A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287583A1.txt  
- PERMITTED LIST - () E080250 SES-LIC-20081222-01678 E Class of Station: Fixed Earth Stations Application for Authority VCY AMERICA INC. Nature of Service: Fixed Satellite Service 43 ° 2 ' 57.00 " N LAT. SITE ID: 1 2700 W. VLIET STREET, MILWAUKEE, MILWAUKEE, WI 87 ° 56 ' 51.30 " W LONG. LOCATION: Page 2 of 6 COMTECH ANT. SYSTEMS A1 4.1 meters ANTENNA ID: "OFFSAT" "18FT." DIGITAL RADIO 3700.0000 - 4200.0000 MHz 240KG7E 54.40 dBW DIGITAL RADIO 5925.0000 - 6425.0000 MHz 240KG7E Points of Communication: 1 - ALSAT - (ALSAT) E020169 SES-MFS-20081201-01521 E Class of Station: Fixed Earth Stations Modification Intelsat North America LLC Nature of Service: Fixed Satellite Service Intelsat North America LLC herein seeks to modify the license of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287647A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287647A1.txt  
- 06556.25000 46-20-53.5 N WA MD WPOP336 117-36-09.6 W 0003686987 WASHINGTON, STATE OF POMEROY 12/24/2008 06561.25000 46-20-53.5 N PA NE 075-26-16.0 W 0003686265 LEHIGH, COUNTY OF ALLENTOWN 12/23/2008 11035.00000 40-33-54.0 N PA NE 075-25-11.0 W 0003686268 LEHIGH, COUNTY OF SALISBURY TWP. 12/23/2008 06645.00000 40-35-55.0 N PA NE 075-25-11.0 W 0003686268 LEHIGH, COUNTY OF SALISBURY TWP. 12/23/2008 11605.00000 40-35-55.0 N PA NE 075-28-04.1 W 0003686270 LEHIGH, COUNTY OF ALLENTOWN 12/23/2008 10755.00000 40-36-12.0 N PA NE 075-28-04.1 W 0003686270 LEHIGH, COUNTY OF ALLENTOWN 12/23/2008 11115.00000 40-36-12.0 N PA NE 075-38-18.0 W 0003686272 LEHIGH, COUNTY OF Bowmanstown 12/23/2008 06805.00000 40-46-29.1 N PA NE 075-28-17.8 W 0003686274 LEHIGH, COUNTY OF Allentown 12/23/2008 11245.00000 40-36-07.0 N PA NE 075-28-17.8 W 0003686274 LEHIGH, COUNTY OF Allentown 12/23/2008 11525.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A1.pdf  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 5 Index 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A11.pdf  
- Downtime in Seconds per Switch* For All Events 0.0 395.6 487.9 73.8 12,080.7 372.7 5,150.2 9,221.5 22,813.6 For Unscheduled Events Over 2 Minutes NA NA 461.3 73.8 12,085.0 369.9 5,150.2 8,982.9 22,669.8 For Unscheduled Downtime More Than 2 Minutes Number of Occurrences or Events 0 0 9 3 136 2 42 130 360 Events per Hundred Switches 0.0 0.0 4.4 4.1 10.3 1.5 15.7 52.2 127.7 Events per Million Access Lines 0.00 0.00 7.95 4.48 21.58 3.68 200.80 188.13 809.91 Average Outage Duration in Minutes NA NA 175.1 30.3 1953.4 413.0 547.7 286.8 296.0 Average Lines Affected per Event in Thousands NA NA 3.6 3.8 4.7 3.0 0.6 0.7 0.4 Outage Line-Minutes per Event in Thousands NA NA 314.5 96.5 28,397.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A2.pdf  
- Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ......................................Table 3.8 Safety Valve Support Payments by Study Area ...........................................Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 5 Index 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A6.pdf  
- than $1.41 billion of Funding Year 2006 funds. As of the same date, USAC had committed nearly $2.42 billion, and disbursed over $676 million of Funding Year 2007 funds.6 USAC supplies the Commission with funding commitments and disbursements information for the E-rate program for all active funding years. USAC provided the Commission with data as of June 30, 2008. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A8.pdf  
- Telephone Penetration by State (Percentage of Occupied Housing Units with Telephone Service) 2003 2004 2005 2006 2007 6 - 15 Table 6.5 Telephone Penetration by State (Annual Average Percentage of Households with Telephone Service) State 1984 2007 Change Alabama 88.4% 91.8% 3.4% Alaska 86.5 96.5 10.0 * Arizona 86.9 92.9 6.0 * Arkansas 86.6 92.0 5.4 * California 92.5 96.5 4.1 * Colorado 93.2 96.8 3.6 * Connecticut 95.5 96.6 1.1 Delaware 94.3 94.9 0.6 District of Columbia 94.9 91.6 -3.3 Florida 88.7 93.6 4.9 * Georgia 86.2 92.6 6.4 * Hawaii 93.5 96.0 2.5 Idaho 90.7 96.4 5.7 * Illinois 94.2 94.1 -0.1 Indiana 91.6 90.4 -1.2 Iowa 96.2 97.0 0.8 Kansas 94.3 96.2 1.8 Kentucky 88.1 94.4 6.2 * 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287688A9.pdf  
- in long distance prices. 6 Access Charge Reform, CC Docket No. 96-262, Sixth Report and Order, 15 Rcd. 12962 (CALLS Order). 7 Telecommunications Act of 1996, Pub. L. No. 104-104, 110 Stat. 56 (1996) (1996 Act). The 1996 Act amended the Communications Act of 1934. 47 U.S.C. §§ 151 et seq. 1957 - 2007 1997 - 2007 CPI All Items 4.1 % 2.7% CPI All Services 5.0 3.3 CPI Telephone Services ** 1.2 -0.1 CPI Major Categories: - Food & Beverages * 2.7 - Housing * 3.0 - Apparel 2.2 -1.1 - Transportation 3.3 2.9 - Medical Care 5.1 4.2 - Recreation * 1.1 - Other Goods & Services * 3.9 CPI Public Transportation 4.5 2.4 CPI Utility Natural Gas Service 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287745A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-287745A1.txt  
- 1/2, 3/4 FEC 1544 kbps 3700.0000 - 4200.0000 MHz 1M85G7D Points of Communication: 1 - ALSAT - (ALSAT) E980488 SES-RWL-20081217-01626 E Date Effective: 01/06/2009 Class of Station: Temporary Fixed Earth Station Grant of Authority 02/05/2009 - 02/05/2024 Renewal Sure Shot Transmissions, Inc. Nature of Service: Domestic Fixed Satellite Service, International Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW ANALOG-VIDEO WITH ASSOCIATED AUDIO 5925.0000 - 6425.0000 MHz 36M0F3F ANALOG-VIDEO WITH ASSOCIATED AUDIO 3700.0000 - 4200.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) 1 - ANIK E2 - (111.1 W.L) 1 - PAS-1R - (45.0 W.L.) 1 - PAS-9 - (58.0 W.L.) 1 - SOLIDARIDAD F-1 - (109.2 W.L.) Page 16 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288105A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288105A1.txt  
- Reading 01/15/2009 11525.00000 40-19-14.5 N PA AM WQJF804 075-57-00.2 W 0003701429 Telecom Transport Management, Inc. Reading 01/15/2009 19425.00000 40-19-14.5 N PA AM WQJF804 075-57-00.2 W 0003701429 Telecom Transport Management, Inc. Reading 01/15/2009 19475.00000 40-19-14.5 N WA AM 122-43-36.2 W 0003703113 StarTouch Inc BLOME 01/15/2009 10995.00000 48-53-12.8 N OH MD WPOS957 084-45-54.8 W 0003699757 Centennial Michiana License Company LLHICKSVILLE 01/12/2009 06197.24000 41-16-04.1 N OH MD WPOS957 084-45-54.8 W 0003699757 Centennial Michiana License Company LLHICKSVILLE 01/12/2009 06226.89000 41-16-04.1 N OH MD WPOS957 084-45-54.8 W 0003699757 Centennial Michiana License Company LLHICKSVILLE 01/12/2009 06345.49000 41-16-04.1 N OH MD WPOS957 084-45-54.8 W 0003699757 Centennial Michiana License Company LLHICKSVILLE 01/12/2009 06404.79000 41-16-04.1 N IN MD WPOR241 085-13-14.9 W 0003699761 Centennial Michiana License Company LLFORT WAYNE 01/12/2009 06286.19000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288108A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288108A1.txt  
- N VA MD WQIR646 080-02-02.2 W 0003713638 HENRY, COUNTY OF Bassett 01/23/2009 06845.00000 36-45-44.9 N VA MD WQIR646 080-02-02.2 W 0003713638 HENRY, COUNTY OF Bassett 01/23/2009 06865.00000 36-45-44.9 N VA MD WQIR650 079-42-51.8 W 0003713641 HENRY, COUNTY OF Axton 01/23/2009 06675.00000 36-39-47.2 N VA MD WQIR650 079-42-51.8 W 0003713641 HENRY, COUNTY OF Axton 01/23/2009 06705.00000 36-39-47.2 N VA MD WQIR636 079-55-04.1 W 0003713644 HENRY, COUNTY OF Ridgeway 01/23/2009 06835.00000 36-36-49.1 N Page 11 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA MD WQIR636 079-55-04.1 W 0003713644 HENRY, COUNTY OF Ridgeway 01/23/2009 06855.00000 36-36-49.1 N VA MD WQIR634 079-53-34.6 W 0003713648 HENRY, COUNTY OF Martinsville 01/23/2009 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288271A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288271A1.txt  
- SES-LIC-20081222-01678 E Date Effective: 01/29/2009 Class of Station: Fixed Earth Stations Grant of Authority 01/29/2009 - 01/29/2024 Application for Authority VCY AMERICA INC. Nature of Service: Fixed Satellite Service 43 ° 2 ' 57.00 " N LAT. SITE ID: 1 2700 W. VLIET STREET, MILWAUKEE, MILWAUKEE, WI 87 ° 56 ' 51.30 " W LONG. LOCATION: COMTECH ANT. SYSTEMS A1 4.1 meters ANTENNA ID: "OFFSAT" "18FT." DIGITAL RADIO 3700.0000 - 4200.0000 MHz 240KG7E 54.40 dBW DIGITAL RADIO 5925.0000 - 6425.0000 MHz 240KG7E Points of Communication: 1 - ALSAT - (ALSAT) E050029 SES-MFS-20080926-01242 E Date Effective: 01/30/2009 Class of Station: Fixed Earth Stations Grant of Authority 01/30/2009 - 01/30/2019 Modification EchoStar Satellite Operating L.L.C. Nature of Service: Direct Broadcast Satellite Service SITE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288533A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288533A1.txt  
- TechnologBrooklyn 02/09/2009 21975.00000 40-40-09.7 N Page 28 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY MD WQHS395 074-01-08.9 W 0003731733 Northrop Grumman Information TechnologBrooklyn 02/09/2009 23025.00000 40-37-22.2 N NY MD WQHS395 074-01-08.9 W 0003731733 Northrop Grumman Information TechnologBrooklyn 02/09/2009 23075.00000 40-37-22.2 N NY MD WQIB502 073-55-04.1 W 0003731734 Northrop Grumman Information TechnologBrooklyn 02/09/2009 23075.00000 40-41-45.3 N NY MD WQIB502 073-55-04.1 W 0003731734 Northrop Grumman Information TechnologBrooklyn 02/09/2009 23125.00000 40-41-45.3 N NY MD WQHT478 073-59-10.5 W 0003731736 Northrop Grumman Information TechnologBrooklyn 02/09/2009 21875.00000 40-41-50.8 N NY MD WQHT478 073-59-10.5 W 0003731736 Northrop Grumman Information TechnologBrooklyn 02/09/2009 23175.00000 40-41-50.8 N NY MD WQHT479 073-59-42.1 W 0003731738 Northrop Grumman 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288979A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-288979A1.txt  
- Michigan RSA #1 andNEWBERRY 02/23/2009 46-18-53.0 N MI AM KNKQ320 085-04-09.1 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andNEWBERRY 02/23/2009 46-37-50.8 N MI AM KNKQ320 086-59-21.4 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andRAPID RIVER 02/23/2009 45-55-18.5 N MI AM KNKQ320 084-49-55.6 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSAINT IGNACE 02/23/2009 45-53-13.8 N MI AM KNKQ320 084-20-04.1 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSAULT SAINT MAR 02/23/2009 46-29-08.0 N MI AM KNKQ320 084-24-41.5 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSault Sainte Marie 02/23/2009 46-21-52.8 N MI AM KNKQ320 085-57-38.5 W 0003652676 ALLTEL Wireless of Michigan RSA #1 andSENEY 02/23/2009 46-20-36.9 N MI AM KNKQ320 087-08-26.4 W 0003652676 ALLTEL Wireless of Michigan RSA #1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289105A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289105A1.txt  
- N NM MD WPNF928 108-13-07.2 W 0003758377 KOB-TV, LLC FARMINGTON 03/03/2009 02061.50000 - 02073.50000 36-43-40.0 N NM MD WHY315 105-14-17.2 W 0003758381 KOB-TV, LLC CAPITAN 03/03/2009 02097.50000 - 02109.50000 33-37-39.4 N NM MD WHS632 105-14-17.2 W 0003758389 KOB-TV, LLC CAPITAN 03/03/2009 02073.50000 - 02085.50000 33-37-39.4 N NM MD WLE314 105-56-07.0 W 0003758394 KOB-TV, LLC SANTA FE 03/03/2009 02037.50000 - 02049.50000 35-40-04.1 N NM MD WHS646 105-47-19.0 W 0003758407 KOB-TV, LLC CORONA 03/03/2009 02025.50000 - 02037.50000 34-14-46.0 N NM MD WHY917 104-22-45.0 W 0003758434 KOB-TV, LLC ROSWELL 03/03/2009 02097.50000 - 02109.50000 33-24-05.0 N NM MD WLF723 107-13-27.0 W 0003758435 KOB-TV, LLC TRUTH / CONSEQU 03/03/2009 02097.50000 - 02109.50000 32-58-17.2 N NM MD WLF738 108-14-28.1 W 0003758440 KOB-TV, LLC PINOS ALTOS 03/03/2009 02097.50000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289107A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289107A1.txt  
- Date File Number Frequency (MHz) Applicant Name Latitude City RO KKB641 0003763531 WESTERN RADIO SERVICES CO., INC. 03/06/2009 RO KNKP612 0003763542 AUTOTEL 03/06/2009 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO NE 107-56-23.2 W 0003762703 STELERA WIRELESS, LLC AUSTIN 03/06/2009 11265.00000 38-49-04.1 N CO NE 107-56-23.2 W 0003762703 STELERA WIRELESS, LLC AUSTIN 03/06/2009 11345.00000 38-49-04.1 N CO NE 108-32-17.2 W 0003762704 STELERA WIRELESS, LLC GRAND JUNCTION 03/06/2009 11425.00000 39-07-00.6 N CO NE 108-32-17.2 W 0003762704 STELERA WIRELESS, LLC GRAND JUNCTION 03/06/2009 11505.00000 39-07-00.6 N CO NE 107-52-20.3 W 0003762705 STELERA WIRELESS, LLC Montrose 03/06/2009 11225.00000 38-29-26.3 N CO NE 107-52-20.3 W 0003762705 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289122A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289122A1.txt  
- E990026 SES-RWL-20090306-00268 E Date Effective: 03/09/2009 Class of Station: Fixed Earth Stations Grant of Authority 04/01/2009 - 04/01/2024 Renewal VIDEOCOM SATELLITE ASSOCIATES, INC. Nature of Service: Domestic Fixed Satellite Service 42 ° 13 ' 58.00 " N LAT. SITE ID: 1 502 SPRAGUE STREET, NORFOLK, DEDHAM, MA 71 ° 8 ' 25.00 " W LONG. LOCATION: COMTECH ANT CORP 1 4.1 meters ANTENNA ID: "18FT" OFFSAT 54.30 dBW QPSK DIGITAL, 1/2, 3/4 FEC, 64 KBPS 5925.0000 - 6425.0000 MHz 51K2G7D- 72.90 dBW QPSK DIGITAL, 1/2, 3/4 FEC, 1544 KBPS 5925.0000 - 6425.0000 MHz 36M0G7D 69.90 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 4M00G7F- Page 18 of 24 72.90 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M00G7F QPSK DIGITAL, 1/2, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289167A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289167A1.txt  
- Tables 1(d) and 1(e) are straightforward and reflect the data in the format filed. Complete data descriptions are available in several Commission orders.25 4. Qualifications Overall, we caution readers to be aware of potential inconsistencies in the service quality data and methodological shortcomings affecting both the collection and interpretation of the data. Some common sources of issues are described below. 4.1 Data Re-filings Commission staff generally screen company-filed service quality data for irregularities and provide feedback to reporting companies on suspected problems. The reporting companies are then given an opportunity to re-file. Re-filed data appear in this report if they are received in time to be included in the Commission's recalculation of holding company totals and other data aggregates described in 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289169A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289169A1.txt  
- Telephone Penetration by State (Percentage of Households with Telephone Service) State Alabama 87.9% 95.4% 7.5% * Alaska 83.8 96.1 12.3 * Arizona 88.8 94.6 5.9 Arkansas 88.2 93.6 5.5 California 91.7 96.4 4.7 * Colorado 94.4 98.0 3.6 Connecticut 95.5 96.9 1.4 Delaware 95.0 92.3 -2.7 District of Columbia 94.7 91.8 -2.9 Florida 85.5 93.1 7.6 * Georgia 88.9 92.9 4.1 Hawaii 94.6 97.1 2.5 Idaho 89.5 95.2 5.8 * Illinois 95.0 94.2 -0.8 Indiana 90.3 92.6 2.2 Iowa 95.4 98.1 2.7 Kansas 94.9 96.7 1.8 Kentucky 86.9 94.7 7.8 * Louisiana 88.9 95.9 6.9 Maine 90.7 97.6 6.9 * Maryland 96.3 93.3 -2.9 Massachusetts 94.3 96.7 2.4 Michigan 93.8 96.0 2.2 Minnesota 96.4 98.3 2.0 Mississippi 82.4 93.0 10.7 * 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289555A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289555A1.txt  
- KY MD WNTT690 083-58-10.3 W 0003778424 EAST KENTUCKY POWER COOPERATIGRAY 03/18/2009 06034.15000 36-56-41.2 N KY MD WNTT690 083-58-10.3 W 0003778424 EAST KENTUCKY POWER COOPERATIGRAY 03/18/2009 06063.80000 36-56-41.2 N KY MD WNTT690 083-58-10.3 W 0003778424 EAST KENTUCKY POWER COOPERATIGRAY 03/18/2009 06726.87500 36-56-41.2 N AK MD WHC864 149-44-58.2 W 0003779517 ConocoPhillips Communications Inc. KUPARUK FIELD 03/19/2009 17905.00000 70-20-38.9 N AK MD WPNH786 150-01-04.1 W 0003779770 ConocoPhillips Communications Inc. KUPARUK FIELD 03/19/2009 17815.00000 70-16-21.9 N Page 19 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AK MD WPNH786 150-01-04.1 W 0003779770 ConocoPhillips Communications Inc. KUPARUK FIELD 03/19/2009 23335.00000 70-16-21.9 N AK MD WPNH787 150-06-28.1 W 0003779776 ConocoPhillips Communications Inc. 'KUPARUK 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289731A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289731A1.txt  
- 03/23/2009 00931.93750 18-21-31.0 N NJ RM KNKG783 074-58-30.6 W 0003782606 Bell Industries, Inc. CHERRY HILL 03/23/2009 00931.93750 39-54-45.4 N NJ RM KNKG783 075-03-01.6 W 0003782606 Bell Industries, Inc. CHERRY HILL 03/23/2009 00931.93750 39-55-32.4 N VA RM KNKG783 076-16-55.7 W 0003782606 Bell Industries, Inc. CHESAPEAKE 03/23/2009 00931.93750 36-48-38.5 N OH RM KNKG783 081-41-39.4 W 0003782606 Bell Industries, Inc. CLEVELAND 03/23/2009 00931.93750 41-30-04.1 N SC RM KNKG783 081-02-04.3 W 0003782606 Bell Industries, Inc. COLUMBIA 03/23/2009 00931.93750 34-00-04.5 N TX RM KNKG783 096-44-40.9 W 0003782606 Bell Industries, Inc. DALLAS 03/23/2009 00931.93750 32-55-46.4 N MI RM KNKG783 083-15-42.7 W 0003782606 Bell Industries, Inc. DEARBORN 03/23/2009 00931.93750 42-18-13.1 N CO RM KNKG783 104-59-22.9 W 0003782606 Bell Industries, Inc. DENVER 03/23/2009 00931.93750 39-44-27.9 N NC RM KNKG783 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289859A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289859A1.txt  
- BROADCASTING, INC. Dubois 04/03/2009 02025.00000 - 02042.00000 41-07-12.3 N PA MD WPZZ407 078-45-36.6 W 0003796783 NEXSTAR BROADCASTING, INC. Dubois 04/03/2009 02049.50000 - 02061.50000 41-07-12.3 N PA MD WPNN748 078-33-05.0 W 0003796784 NEXSTAR BROADCASTING, INC. Rockton 04/03/2009 02059.00000 - 02076.00000 41-04-34.0 N PA MD WPNN748 078-33-05.0 W 0003796784 NEXSTAR BROADCASTING, INC. Rockton 04/03/2009 02073.50000 - 02085.50000 41-04-34.0 N PA MD WPNG696 078-54-04.1 W 0003796785 NEXSTAR BROADCASTING, INC. JOHNSTOWN 04/03/2009 02059.00000 - 02076.00000 40-26-25.3 N PA MD WPNG696 078-54-04.1 W 0003796785 NEXSTAR BROADCASTING, INC. JOHNSTOWN 04/03/2009 02073.50000 - 02085.50000 40-26-25.3 N PA MD WQAH854 078-45-36.6 W 0003796786 NEXSTAR BROADCASTING, INC. Dubois 04/03/2009 02093.00000 - 02110.00000 41-07-12.3 N PA MD WQAH854 078-45-36.6 W 0003796786 NEXSTAR BROADCASTING, INC. Dubois 04/03/2009 02097.50000 - 02109.50000 41-07-12.3 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289861A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-289861A1.txt  
- 21-17-25.4 N HI NE 157-45-53.3 W 0003794181 HONOLULU BOARD OF WATER SUPPLHonolulu 04/01/2009 11055.00000 21-17-25.4 N HI NE 157-54-45.7 W 0003794182 HONOLULU BOARD OF WATER SUPPLAiea 04/01/2009 10935.00000 21-23-05.2 N HI NE 157-54-45.7 W 0003794182 HONOLULU BOARD OF WATER SUPPLAiea 04/01/2009 11135.00000 21-23-05.2 N HI NE 158-05-24.3 W 0003794183 HONOLULU BOARD OF WATER SUPPLKapolei 04/01/2009 11385.00000 21-18-18.4 N TX NE 095-41-04.1 W 0003796099 HARRIS COUNTY ITC Montgomery 04/03/2009 06197.24000 30-25-27.8 N TX NE 095-41-04.1 W 0003796099 HARRIS COUNTY ITC Montgomery 04/03/2009 06345.49000 30-25-27.8 N TX NE 095-41-46.8 W 0003796100 HARRIS COUNTY ITC MAGNOLIA 04/03/2009 06034.15000 30-13-30.2 N TX NE 095-41-46.8 W 0003796100 HARRIS COUNTY ITC MAGNOLIA 04/03/2009 06093.45000 30-13-30.2 N TX NE 095-25-26.9 W 0003796101 HARRIS COUNTY ITC Conroe 04/03/2009 06286.19000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290060A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290060A1.txt  
- N NM AM WHY315 105-14-17.2 W 0003758381 KOB-TV, LLC CAPITAN 04/07/2009 02097.50000 - 02109.50000 33-37-39.4 N NM AM WHS632 105-14-17.2 W 0003758389 KOB-TV, LLC CAPITAN 04/07/2009 02059.00000 - 02076.00000 33-37-39.4 N NM AM WHS632 105-14-17.2 W 0003758389 KOB-TV, LLC CAPITAN 04/07/2009 02073.50000 - 02085.50000 33-37-39.4 N NM AM WLE314 105-56-07.0 W 0003758394 KOB-TV, LLC SANTA FE 04/07/2009 02008.00000 - 02025.00000 35-40-04.1 N NM AM WLE314 105-56-07.0 W 0003758394 KOB-TV, LLC SANTA FE 04/07/2009 02037.50000 - 02049.50000 35-40-04.1 N NM AM WHS646 105-47-19.0 W 0003758407 KOB-TV, LLC CORONA 04/07/2009 01990.00000 - 02008.00000 34-14-46.0 N NM AM WHS646 105-47-19.0 W 0003758407 KOB-TV, LLC CORONA 04/07/2009 02025.50000 - 02037.50000 34-14-46.0 N NM AM WHY917 104-22-45.0 W 0003758434 KOB-TV, LLC ROSWELL 04/07/2009 02093.00000 - 02110.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290273A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290273A1.txt  
- 04/13/2009 06726.87500 36-56-41.2 N TX MD WQKD295 096-53-31.0 W 0003806069 AirCanopy Internet Services OVILLA 04/14/2009 19375.00000 32-31-41.7 N TX MD WQKD295 096-53-31.0 W 0003806069 AirCanopy Internet Services OVILLA 04/14/2009 21875.00000 32-31-41.7 N IN MD WHJ971 087-27-53.1 W 0003806104 NORTHERN INDIANA PUBLIC SERVICEST. JOHN 04/14/2009 06735.00000 41-25-05.1 N IN MD WED429 087-23-56.1 W 0003806116 NORTHERN INDIANA PUBLIC SERVICESAINT JOHN 04/14/2009 06565.00000 41-27-04.1 N MD WGX944 0003806246 EAST OHIO GAS COMPANY 04/14/2009 UT MD WHI279 111-56-13.0 W 0003806344 DESERET GENERATION AND TRANSMPROVO 04/14/2009 06685.00000 40-16-57.0 N UT MD WHI280 111-54-13.7 W 0003806351 DESERET GENERATION AND TRANSMSOUTH JORDAN 04/14/2009 06585.00000 40-33-19.8 N LA MD WNTM927 093-38-17.0 W 0003808896 Kinder Morgan Tejas Pipeline GP, LLC TOOMEY 04/15/2009 00928.60625 30-08-43.0 N LA MD WNTM927 093-38-17.0 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290274A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290274A1.txt  
- WPNM821 120-19-30.2 W 0003810863 MCC RADIO, LLC Wenatchee 04/17/2009 00949.00000 47-26-16.3 N CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD KWH311 089-39-26.0 W 0003810174 Consolidated Communications Holdings, ISpringfield 04/17/2009 00158.10000 39-48-37.0 N IL MD KWH311 089-17-49.3 W 0003810187 Consolidated Communications Holdings, ITaylorville 04/17/2009 00075.54000 39-33-04.1 N CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PR AM WPSF925 066-12-40.7 W 0003648350 Centennial Puerto Rico License Corp. BAYAMON 04/16/2009 10622.50000 18-20-30.9 N PR AM WPSF925 066-12-40.7 W 0003648350 Centennial Puerto Rico License Corp. BAYAMON 04/16/2009 10755.00000 18-20-30.9 N PR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290575A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290575A1.txt  
- 087-01-03.1 W 0003823778 Centennial Michiana License Company LLCHALMERS 04/30/2009 06135.45000 40-38-54.1 N MD MD WPOR656 079-24-46.0 W 0003823938 USCOC OF CUMBERLAND, INC. OAKLAND 04/30/2009 06585.00000 39-24-32.0 N MD MD WPOR656 079-24-46.0 W 0003823938 USCOC OF CUMBERLAND, INC. OAKLAND 04/30/2009 06595.00000 39-24-32.0 N MD MD WPOR656 079-24-46.0 W 0003823938 USCOC OF CUMBERLAND, INC. OAKLAND 04/30/2009 11627.50000 39-24-32.0 N MD MD WMR415 079-18-04.1 W 0003824003 USCOC OF CUMBERLAND, INC. THAYERVILLE 04/30/2009 06755.00000 39-31-11.3 N MD MD WMR415 079-18-04.1 W 0003824003 USCOC OF CUMBERLAND, INC. THAYERVILLE 04/30/2009 06765.00000 39-31-11.3 N SD MD WMQ913 100-24-27.8 W 0003824344 WWC License L.L.C. Pierre 04/30/2009 02171.60000 44-22-21.7 N SD MD WMQ913 100-24-27.8 W 0003824344 WWC License L.L.C. Pierre 04/30/2009 06286.19000 44-22-21.7 N SD MD WMQ913 100-24-27.8 W 0003824344 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290578A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290578A1.txt  
- N VA MD WPYK380 077-50-09.4 W 0003821554 WARRENTON FAUQUIER COUNTY JOINWarrenton 04/28/2009 11198.12500 38-44-02.8 N MI MD WPTP860 084-08-12.0 W 0003824050 SAGINAW COUNTY 911 AUTHORITY St. Charles 04/30/2009 06616.25000 43-16-58.0 N MI MD WPTP860 084-08-12.0 W 0003824050 SAGINAW COUNTY 911 AUTHORITY St. Charles 04/30/2009 06718.75000 43-16-58.0 N MI MD WPWD456 083-57-57.6 W 0003824061 SAGINAW COUNTY 911 AUTHORITY SAGINAW 04/30/2009 06788.75000 43-25-04.1 N MI MD WPWD456 083-57-57.6 W 0003824061 SAGINAW COUNTY 911 AUTHORITY SAGINAW 04/30/2009 10616.25000 43-25-04.1 N MI MD WPWD456 083-57-57.6 W 0003824061 SAGINAW COUNTY 911 AUTHORITY SAGINAW 04/30/2009 10653.75000 43-25-04.1 N MD MD WPSJ576 076-04-24.3 W 0003824793 State of Maryland, MIEMSS Perryville 05/01/2009 06635.00000 39-35-22.3 N MD MD WPTM669 077-37-34.2 W 0003824800 State of Maryland, MIEMSS Boonsboro 05/01/2009 06755.00000 39-26-52.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290600A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290600A1.txt  
- Nature of Service: Domestic Fixed Satellite Service 37 ° 21 ' 17.50 " N LAT. SITE ID: 1 1971 UNIVERSITY BLVD, LYNCHBURG, LYNCHBURG, VA 79 ° 10 ' 49.10 " W LONG. LOCATION: ANDREW 1 9.1 meters ANTENNA ID: ESA 91-46 HP 80.89 dBW ANALOG VIDEO 5925.0000 - 6425.0000 MHz 36M0F3F ANALOG VIDEO 3700.0000 - 4200.0000 MHz 36M0F3F COMTECH 2 4.1 meters ANTENNA ID: OFFSAT Page 6 of 9 69.60 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 11M2G7W 46.20 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 11M2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290674A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290674A1.txt  
- BROADCASTING, INC. Dubois 05/08/2009 02025.00000 - 02042.00000 41-07-12.3 N PA AM WPZZ407 078-45-36.6 W 0003796783 NEXSTAR BROADCASTING, INC. Dubois 05/08/2009 02049.50000 - 02061.50000 41-07-12.3 N PA AM WPNN748 078-33-05.0 W 0003796784 NEXSTAR BROADCASTING, INC. Rockton 05/08/2009 02059.00000 - 02076.00000 41-04-34.0 N PA AM WPNN748 078-33-05.0 W 0003796784 NEXSTAR BROADCASTING, INC. Rockton 05/08/2009 02073.50000 - 02085.50000 41-04-34.0 N PA AM WPNG696 078-54-04.1 W 0003796785 NEXSTAR BROADCASTING, INC. JOHNSTOWN 05/08/2009 02059.00000 - 02076.00000 40-26-25.3 N PA AM WPNG696 078-54-04.1 W 0003796785 NEXSTAR BROADCASTING, INC. JOHNSTOWN 05/08/2009 02073.50000 - 02085.50000 40-26-25.3 N PA AM WQAH854 078-45-36.6 W 0003796786 NEXSTAR BROADCASTING, INC. Dubois 05/08/2009 02093.00000 - 02110.00000 41-07-12.3 N PA AM WQAH854 078-45-36.6 W 0003796786 NEXSTAR BROADCASTING, INC. Dubois 05/08/2009 02097.50000 - 02109.50000 41-07-12.3 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290862A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290862A1.txt  
- WQJT734 A 0003834490 Nextel License Holdings 1, Inc. 05/12/2009 00806.00000 - 00821.00000 MD WQJT734 A 0003834490 Nextel License Holdings 1, Inc. 05/12/2009 00808.38750 MD WQJT734 A 0003834490 Nextel License Holdings 1, Inc. 05/12/2009 00853.38750 FL MD WQJT734 X 0003834490 Nextel License Holdings 1, Inc. 05/12/2009 00808.38750 FL MD WQJT734 P 082-22-03.3 W 0003834490 Nextel License Holdings 1, Inc. 05/12/2009 00853.38750 27-55-04.1 N FL MD WQJT734 082-22-03.3 W 0003834490 Nextel License Holdings 1, Inc. TAMPA 05/12/2009 00853.38750 27-55-04.1 N VA MD WQJV761 O 0003834493 Nextel Communications of the Mid-Atlantic 05/12/2009 00806.00000 - 00821.00000 VA MD WQJV761 O 0003834493 Nextel Communications of the Mid-Atlantic 05/12/2009 00806.18750 VA MD WQJV761 077-04-21.0 W 0003834493 Nextel Communications of the Mid-AtlanticARLINGTON 05/12/2009 00851.18750 38-53-42.0 N MD MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290863A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290863A1.txt  
- CORP. HILLS 05/13/2009 00853.33750 41-34-22.1 N IA MD WQIS628 092-24-19.7 W 0003837121 NEXTEL WIP LICENSE CORP. OTTUMWA 05/13/2009 00853.33750 41-00-38.1 N MD WQJD584 A 0003837123 Nextel Communications of the Mid-Atlantic 05/13/2009 00806.00000 - 00821.00000 MD WQJD584 A 0003837123 Nextel Communications of the Mid-Atlantic 05/13/2009 00808.31250 PA MD WQJD584 X 0003837123 Nextel Communications of the Mid-Atlantic 05/13/2009 00808.31250 PA MD WQJD584 079-14-04.1 W 0003837123 Nextel Communications of the Mid-AtlanticDERRY 05/13/2009 00853.31250 40-20-30.3 N Page 7 GX - SMR, 806-821/851-866 MHz, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WQJT229 A 0003837125 NEXTEL OF TEXAS, INC. 05/13/2009 00806.00000 - 00821.00000 MD WQJT229 A 0003837125 NEXTEL OF TEXAS, INC. 05/13/2009 00806.48750 MD WQJT229 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290957A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290957A1.txt  
- DEPARTMENT OKEMMERER 05/21/2009 06635.62500 41-50-55.7 N AZ MD WPXT507 112-33-27.0 W 0003847238 Maricopa County Arizona SURPRISE 05/21/2009 10955.00000 33-34-01.0 N AZ MD WPXT505 112-05-08.2 W 0003847244 Maricopa County Arizona PHOENIX 05/21/2009 11445.00000 33-47-31.3 N AZ MD WAA641 112-07-52.5 W 0003847248 Maricopa County Arizona PHOENIX 05/21/2009 06197.24000 33-25-43.1 N AZ MD WED941 112-20-15.5 W 0003847251 Maricopa County Arizona AVONDALE 05/21/2009 11183.75000 33-27-04.1 N FL MD WPNM321 084-15-56.7 W 0003847409 TALLAHASSEE, CITY OF TALLAHASSEE 05/21/2009 06286.19000 30-34-44.5 N FL MD WPNM321 084-15-56.7 W 0003847409 TALLAHASSEE, CITY OF TALLAHASSEE 05/21/2009 06345.49000 30-34-44.5 N FL MD WPNM318 084-02-38.5 W 0003847448 TALLAHASSEE, CITY OF TALLAHASSEE 05/21/2009 06034.15000 30-34-00.4 N FL MD WPNM318 084-02-38.5 W 0003847448 TALLAHASSEE, CITY OF TALLAHASSEE 05/21/2009 06093.45000 30-34-00.4 N AZ MD WGX904 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290959A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290959A1.txt  
- IIIBOISE CITY 05/19/2009 21875.00000 43-34-25.9 N ID NE 116-12-49.5 W 0003844813 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 21925.00000 43-34-25.9 N ID NE 116-12-49.5 W 0003844813 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 21975.00000 43-34-25.9 N ID NE 116-12-49.5 W 0003844813 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 22025.00000 43-34-25.9 N ID NE 116-28-24.3 W 0003844817 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 17815.00000 43-31-04.1 N ID NE 116-28-24.3 W 0003844817 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 17915.00000 43-31-04.1 N ID NE 116-28-24.3 W 0003844817 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 17965.00000 43-31-04.1 N ID NE 116-28-24.3 W 0003844817 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 05/19/2009 18065.00000 43-31-04.1 N TX NE 099-28-38.4 W 0003845758 American Electric Power Service CorporatLaredo 05/20/2009 06063.80000 27-41-36.8 N TX NE 099-28-38.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290960A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-290960A1.txt  
- License L.L.C. Picks 05/22/2009 06745.00000 43-04-40.0 N SD MD WPNB606 098-28-51.0 W 0003848423 WWC License L.L.C. Picks 05/22/2009 06840.00000 43-04-40.0 N MO NE 089-32-20.9 W 0003845719 Cellco Partnership BENTON 05/20/2009 06645.00000 37-05-39.9 N PR NE 065-59-34.0 W 0003846246 Centennial Puerto Rico License Corp. San Lorenzo 05/20/2009 10715.00000 18-07-38.7 N TX NE 101-27-43.6 W 0003846417 AMA COMMUNICATIONS, LLC PRINGLE 05/20/2009 10995.00000 35-57-04.1 N TX NE 101-27-43.6 W 0003846417 AMA COMMUNICATIONS, LLC PRINGLE 05/20/2009 11075.00000 35-57-04.1 N TX NE 101-24-27.7 W 0003846418 AMA COMMUNICATIONS, LLC GRUVER 05/20/2009 10875.00000 36-16-02.7 N TX NE 101-24-27.7 W 0003846418 AMA COMMUNICATIONS, LLC GRUVER 05/20/2009 11115.00000 36-16-02.7 N TX NE 101-21-25.4 W 0003846419 AMA COMMUNICATIONS, LLC SPEARMEN 05/20/2009 11605.00000 36-23-44.1 N TX NE 101-28-20.8 W 0003846420 AMA COMMUNICATIONS, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291144A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291144A1.txt  
- 07100.00000 40-42-43.3 N TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX AM KRL46 095-20-19.9 W 0003810847 UNIVERSITY OF HOUSTON SYSTEM HOUSTON 05/28/2009 02049.50000 29-43-35.6 N TN MD WPWH818 083-55-21.6 W 0003848949 GANNETT PACIFIC CORPORATION Knoxville 05/26/2009 07050.00000 - 07075.00000 35-59-55.2 N CA MD WBB475 117-48-04.1 W 0003851846 TRINITY BROADCASTING NETWORK, INTUSTIN 05/28/2009 02008.00000 - 02025.00000 33-43-19.0 N CA MD WBB475 117-48-04.1 W 0003851846 TRINITY BROADCASTING NETWORK, INTUSTIN 05/28/2009 02037.50000 - 02049.50000 33-43-19.0 N FL MD WPOQ447 082-15-44.3 W 0003851906 TAMPA BAY TELEVISION, INC. RIVERVIEW 05/28/2009 12900.00000 - 12925.00000 27-50-33.0 N UT MD WPNM989 111-57-10.6 W 0003852306 HIGH PLAINS BROADCASTING LICENSSalt Lake City 05/28/2009 07025.00000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291222A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291222A1.txt  
- Minnesota 96.4 98.2 1.8 Mississippi 82.4 92.3 10.0 * Missouri 92.1 97.0 5.0 * Montana 92.8 93.4 0.6 Nebraska 94.0 93.3 -0.8 Nevada 89.4 92.5 3.1 New Hampshire 95.0 98.1 3.2 New Jersey 94.1 95.4 1.2 New Mexico 85.3 91.4 6.1 New York 90.8 94.7 3.8 * North Carolina 89.3 93.9 4.5 North Dakota 95.1 98.5 3.4 Ohio 92.2 96.4 4.1 * Oklahoma 91.5 95.6 4.1 Oregon 91.2 98.1 6.9 * Pennsylvania 95.1 98.3 3.2 Rhode Island 93.3 96.0 2.6 South Carolina 81.8 91.4 9.6 * South Dakota 92.7 96.4 3.7 Tennessee 87.6 92.9 5.3 Texas 89.0 93.9 4.9 * Utah 90.3 96.3 6.0 * Vermont 92.7 97.4 4.7 Virginia 93.1 95.0 1.9 Washington 92.5 98.0 5.6 West Virginia 88.1 95.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291311A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291311A1.txt  
- 31-30-15.6 N MS MD WQJN570 090-19-55.2 W 0003856571 State of Mississippi Wireless CommunicatBrookhaven 06/02/2009 06315.84000 31-34-30.4 N MS MD WQJN570 090-19-55.2 W 0003856571 State of Mississippi Wireless CommunicatBrookhaven 06/02/2009 06345.49000 31-34-30.4 N MS MD WQJN570 090-19-55.2 W 0003856571 State of Mississippi Wireless CommunicatBrookhaven 06/02/2009 06745.00000 31-34-30.4 N CA MD WPOL382 117-05-26.1 W 0003857194 San Diego, County of Escondido 06/02/2009 06123.10000 33-07-04.1 N CA MD WPOL382 117-05-26.1 W 0003857194 San Diego, County of Escondido 06/02/2009 06745.62500 33-07-04.1 N KS MD WQJK924 094-48-27.9 W 0003857196 KANSAS STATE OF, KANSAS DEPARTMOLATHE 06/02/2009 06197.24000 38-51-52.0 N KS MD WQEC783 095-00-06.0 W 0003857197 Kansas State of, Kansas Department of TPAOLA 06/02/2009 05945.20000 38-35-40.0 N KS MD WQEC783 095-00-06.0 W 0003857197 Kansas State of, Kansas Department of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291314A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291314A1.txt  
- Holdings, LLC PUYALLUP 06/03/2009 19440.00000 47-09-11.2 N WA MD WQFL535 122-16-23.7 W 0003857891 Clearwire Spectrum Holdings, LLC PUYALLUP 06/03/2009 19475.00000 47-09-11.2 N Page 15 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA MD WQFL522 122-18-09.0 W 0003857892 Clearwire Spectrum Holdings, LLC FEDERAL WAY 06/03/2009 17815.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0003857892 Clearwire Spectrum Holdings, LLC FEDERAL WAY 06/03/2009 17840.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0003857892 Clearwire Spectrum Holdings, LLC FEDERAL WAY 06/03/2009 17915.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0003857892 Clearwire Spectrum Holdings, LLC FEDERAL WAY 06/03/2009 18015.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0003857892 Clearwire Spectrum Holdings, LLC FEDERAL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291315A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291315A1.txt  
- 115-08-46.0 W 0003856094 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 06/01/2009 23075.00000 36-05-29.0 N NV MD WQKH243 115-08-46.0 W 0003856094 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 06/01/2009 23125.00000 36-05-29.0 N NV MD WQKH243 115-08-46.0 W 0003856094 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 06/01/2009 23170.00000 36-05-29.0 N NV MD WQKH243 115-08-46.0 W 0003856094 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 06/01/2009 23175.00000 36-05-29.0 N NC MD KMX97 079-41-04.1 W 0003856289 Duke Energy Carolinas, LLC REIDSVILLE 06/02/2009 06605.00000 36-25-29.4 N NC MD KMX97 079-41-04.1 W 0003856289 Duke Energy Carolinas, LLC REIDSVILLE 06/02/2009 06615.00000 36-25-29.4 N NC MD KMX97 079-41-04.1 W 0003856289 Duke Energy Carolinas, LLC REIDSVILLE 06/02/2009 06645.00000 36-25-29.4 N Page 26 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291391A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291391A2.txt  
- 13.3 0.0 17.5 69.2 $64,481,819 0.0 0.0 0.0 0.0100.0 4,547,339,581 0.2 13.8 1.0 30.5 54.6 Western Europe $776,307,034 0.1 28.5 1.3 20.9 49.2 $81,479,312 0.0 18.1 0.0 26.3 55.6 $170,351,650 0.0 0.0 0.0 0.0100.0 13,979,516,518 0.1 15.7 1.9 31.3 51.1 Algeria $8,715,356 0.0 7.0 4.3 21.5 67.3 $411,827 0.0 0.0 0.0 0.0100.0 $4,619 0.0 0.0 0.0 0.0100.0 89,141,636 0.0 4.7 4.1 21.9 69.3 Angola $7,410,226 0.0 30.6 1.3 22.9 45.2 $48,675 0.0 0.0 0.0 0.0100.0 $31,630 0.0 0.0 0.0 0.0100.0 39,282,697 0.0 19.5 1.4 34.8 44.2 Benin $3,447,338 0.0 11.6 9.7 33.0 45.8 $115,134 0.0 0.0 0.0 8.4 91.6 $316,380 0.0 0.0 0.0 0.1 99.9 32,274,360 0.0 7.3 10.6 33.4 48.6 Botswana $1,888,740 0.2 61.9 0.0 4.9 32.9 $100,152 0.0 3.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291566A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291566A1.txt  
- 06/17/2009 19675.00000 29-30-20.6 N SD NE 099-11-26.0 W 0003873592 NorthWestern Corporation REE HEIGHTS 06/17/2009 06093.45000 44-29-03.0 N SD NE 099-11-26.0 W 0003873592 NorthWestern Corporation REE HEIGHTS 06/17/2009 10552.50000 44-29-03.0 N TX NE 098-34-16.3 W 0003873729 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19375.00000 29-26-57.8 N TX NE 098-34-16.3 W 0003873729 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19475.00000 29-26-57.8 N TX NE 098-32-04.1 W 0003873732 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19375.00000 29-23-38.0 N TX NE 098-32-04.1 W 0003873732 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19475.00000 29-23-38.0 N TX NE 098-32-04.1 W 0003873732 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19575.00000 29-23-38.0 N TX NE 098-32-04.1 W 0003873732 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 06/17/2009 19675.00000 29-23-38.0 N Page 47 MG - Microwave Industrial/Business Pool 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291567A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291567A1.txt  
- W 0003874192 CLEARWIRE SPECTRUM HOLDINGS IIILITHONIA 06/17/2009 19575.00000 33-44-37.1 N GA NE 084-08-22.1 W 0003874192 CLEARWIRE SPECTRUM HOLDINGS IIILITHONIA 06/17/2009 19675.00000 33-44-37.1 N GA NE 084-05-22.4 W 0003874193 CLEARWIRE SPECTRUM HOLDINGS IIIDULUTH 06/17/2009 21875.00000 33-57-40.2 N GA NE 084-05-22.4 W 0003874193 CLEARWIRE SPECTRUM HOLDINGS IIIDULUTH 06/17/2009 22025.00000 33-57-40.2 N WA NE 122-20-12.1 W 0003874194 SPECTRUM NETWORKS LLC SEATTLE 06/17/2009 21225.00000 47-37-04.1 N WA NE 122-20-12.1 W 0003874194 SPECTRUM NETWORKS LLC SEATTLE 06/17/2009 21325.00000 47-37-04.1 N WA NE 122-20-45.7 W 0003874195 SPECTRUM NETWORKS LLC SEATTLE 06/17/2009 17765.00000 47-37-01.3 N WA NE 122-20-45.7 W 0003874195 SPECTRUM NETWORKS LLC SEATTLE 06/17/2009 17815.00000 47-37-01.3 N WA NE 122-20-19.6 W 0003874196 SPECTRUM NETWORKS LLC SEATTLE 06/17/2009 19325.00000 47-36-51.4 N WA NE 122-20-19.6 W 0003874196 SPECTRUM NETWORKS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291568A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-291568A1.txt  
- CANYON, COUNTY OF CALDWELL 06/19/2009 06805.00000 43-39-56.4 N ID NE 116-40-40.6 W 0003876199 CANYON, COUNTY OF CALDWELL 06/19/2009 06825.00000 43-39-56.4 N Page 7 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA RM WPOU837 R 114-37-33.8 W 0003874475 SAN DIEGO COUNTY SUPERINTENDENSAN DIEGO 06/18/2009 06437.50000 32-32-04.1 N CA RM WPOU837 R 114-37-33.8 W 0003874475 SAN DIEGO COUNTY SUPERINTENDENSAN DIEGO 06/18/2009 06462.50000 32-32-04.1 N CA RM WPOU837 R 114-37-33.8 W 0003874475 SAN DIEGO COUNTY SUPERINTENDENSAN DIEGO 06/18/2009 06487.50000 32-32-04.1 N CA RM WPOU837 R 114-37-33.8 W 0003874475 SAN DIEGO COUNTY SUPERINTENDENSAN DIEGO 06/18/2009 06512.50000 32-32-04.1 N CA RM WPOU838 116-56-13.0 W 0003874498 SAN DIEGO COUNTY SUPERINTENDENSAN DIEGO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292131A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292131A1.txt  
- Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NC AM KNKN641 076-45-48.7 W 0003652513 Alltel Communications, LLC Aurora 07/14/2009 35-18-12.6 N NC AM KNKN641 076-52-08.1 W 0003652513 Alltel Communications, LLC AURORA 07/14/2009 35-17-50.9 N NC AM KNKN641 077-25-55.8 W 0003652513 Alltel Communications, LLC AYDEN 07/14/2009 35-29-27.4 N NC AM KNKN641 077-22-04.1 W 0003652513 Alltel Communications, LLC BETHEL 07/14/2009 35-47-11.4 N NC AM KNKN641 075-32-37.0 W 0003652513 Alltel Communications, LLC BUXTON 07/14/2009 35-16-02.0 N NC AM KNKN641 077-02-40.8 W 0003652513 Alltel Communications, LLC CHOCOWINITY TOW 07/14/2009 35-29-14.6 N NC AM KNKN641 076-12-52.0 W 0003652513 Alltel Communications, LLC Columbia 07/14/2009 35-55-16.6 N NC AM KNKN641 076-22-59.8 W 0003652513 Alltel Communications, LLC Creswell 07/14/2009 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292192A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292192A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292192A1.txt  
- from other carriers, and 20% through resale arrangements with unaffiliated carriers. Incumbent LECs reported providing about 11% fewer UNE loops with switching (referred to as the UNE-Platform) to unaffiliated carriers at the end of June 2008 than they reported six months earlier (4.9 million compared to 5.5 million) and about 7% fewer UNE loops without switching (3.8 million compared to 4.1 million). Incumbent LECs were the presubscribed interstate long distance carrier for 59% of the switched access lines they provided to end users, while CLECs were the interstate long distance carrier for 79% of their switched access lines. As additional information becomes available, it will be posted on the Commission's Internet site. Note that, on June 12, 2008, the Commission released 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292351A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292351A1.txt  
- Nature of Service: Domestic Fixed Satellite Service, International Fixed Satellite Service 40 ° 32 ' 1.00 " N LAT. SITE ID: 1 201 BROWNTOWN ROAD, WEST MORELAND, NEW KENSINGTON, PA 79 ° 45 ' 17.00 " W LONG. LOCATION: ANDREW CORPORATION 9.1M 9.1 meters ANTENNA ID: ESA91H-46 74.90 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F3F COMTECH 4.1M 4.1 meters ANTENNA ID: "18"FT OFFSAT 72.30 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.30 dBW 5925.0000 - 6425.0000 MHz 9M00G7W 3700.0000 - 4200.0000 MHz 36M0F8W Page 21 of 30 3700.0000 - 4200.0000 MHz 9M00G7W SATCOM TECHNOLOGIES 13M 13 meters ANTENNA ID: 1130C 53.11 dBW 5925.0000 - 6425.0000 MHz 43K0G7D- 82.34 dBW 5925.0000 - 6425.0000 MHz 36M0G7D 82.80 dBW 5925.0000 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292593A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292593A1.txt  
- 9,943 11,435 12,337 13,209 13,459 22,296 22,648 21,655 21,713 21,064 21,188 21,640 21,793 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 75,939 75,477 75,872 Wyoming United States Total West Virginia Wisconsin * Current dollar equivalents are at the end of Table 4 82 Alabama 6.4 Montana 5.7 Alaska 6.0 Nebraska 6.0 Arizona 6.7 Nevada 4.8 Arkansas 5.5 New Hampshire 4.1 California 2.4 New Jersey 4.5 Colorado 4.4 New Mexico 8.5 Connecticut 4.2 New York 3.3 Delaware 5.2 North Carolina 4.6 District Of Columbia 6.3 North Dakota 5.6 Florida 2.8 Ohio 3.9 Georgia 5.7 Oklahoma 5.5 Hawaii 6.2 Oregon 5.1 Idaho 4.9 Pennsylvania 3.4 Illinois 4.5 Rhode Island 5.0 Indiana 5.9 South Carolina 5.1 Iowa 4.3 South Dakota 4.9 Kansas 4.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292736A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292736A1.txt  
- HOLDINGS IIIWillingboro 08/04/2009 18115.00000 40-01-14.7 N PA NE 075-36-24.6 W 0003920962 CLEARWIRE SPECTRUM HOLDINGS IIIPottstown 08/04/2009 10735.00000 40-16-12.9 N PA NE 075-36-24.6 W 0003920962 CLEARWIRE SPECTRUM HOLDINGS IIIPottstown 08/04/2009 10815.00000 40-16-12.9 N PA NE 075-36-24.6 W 0003920962 CLEARWIRE SPECTRUM HOLDINGS IIIPottstown 08/04/2009 17915.00000 40-16-12.9 N PA NE 075-36-24.6 W 0003920962 CLEARWIRE SPECTRUM HOLDINGS IIIPottstown 08/04/2009 18015.00000 40-16-12.9 N NJ NE 074-57-04.1 W 0003920964 CLEARWIRE SPECTRUM HOLDINGS IIIVoorhees 08/04/2009 19425.00000 39-49-09.4 N PA NE 075-20-48.7 W 0003920965 CLEARWIRE SPECTRUM HOLDINGS IIIHARLEYSVILLE 08/04/2009 10735.00000 40-15-34.8 N PA NE 075-20-48.7 W 0003920965 CLEARWIRE SPECTRUM HOLDINGS IIIHARLEYSVILLE 08/04/2009 10815.00000 40-15-34.8 N PA NE 075-20-48.7 W 0003920965 CLEARWIRE SPECTRUM HOLDINGS IIIHARLEYSVILLE 08/04/2009 10855.00000 40-15-34.8 N PA NE 075-20-48.7 W 0003920965 CLEARWIRE SPECTRUM HOLDINGS IIIHARLEYSVILLE 08/04/2009 10935.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292737A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292737A1.txt  
- CLEARWIRE SPECTRUM HOLDINGS IIIMorrisville 08/04/2009 18015.00000 40-11-39.7 N Page 16 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA NE 074-49-48.9 W 0003921461 CLEARWIRE SPECTRUM HOLDINGS IIIMorrisville 08/04/2009 18065.00000 40-11-39.7 N PA NE 074-49-48.9 W 0003921461 CLEARWIRE SPECTRUM HOLDINGS IIIMorrisville 08/04/2009 18115.00000 40-11-39.7 N PA NE 075-08-04.1 W 0003921462 CLEARWIRE SPECTRUM HOLDINGS IIIDoylestown 08/04/2009 17965.00000 40-17-01.7 N PA NE 075-08-04.1 W 0003921462 CLEARWIRE SPECTRUM HOLDINGS IIIDoylestown 08/04/2009 18015.00000 40-17-01.7 N PA NE 075-08-04.1 W 0003921462 CLEARWIRE SPECTRUM HOLDINGS IIIDoylestown 08/04/2009 18065.00000 40-17-01.7 N PA NE 075-08-04.1 W 0003921462 CLEARWIRE SPECTRUM HOLDINGS IIIDoylestown 08/04/2009 18115.00000 40-17-01.7 N PA NE 075-08-50.3 W 0003921463 CLEARWIRE SPECTRUM HOLDINGS IIIPhiladelphia 08/04/2009 22375.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292738A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292738A1.txt  
- MD WQEY752 A 0003922053 RADIO COMMUNICATIONS MANAGEME 08/05/2009 00461.57500 MD WQEY752 A 0003922053 RADIO COMMUNICATIONS MANAGEME 08/05/2009 00466.57500 ME MD WQEY752 069-37-55.1 W 0003922053 RADIO COMMUNICATIONS MANAGEMEBOOTHBAY 08/05/2009 00461.57500 43-52-58.0 N ME MD WQEY752 069-28-50.0 W 0003922053 RADIO COMMUNICATIONS MANAGEMENOBLEBORO 08/05/2009 00461.57500 44-04-17.0 N ME MD WQEY752 069-20-29.5 W 0003922053 RADIO COMMUNICATIONS MANAGEMEWALERBORO 08/05/2009 00461.57500 44-06-32.1 N ME MD WQEY752 069-40-04.1 W 0003922053 RADIO COMMUNICATIONS MANAGEMEWISCASSET 08/05/2009 00461.57500 44-02-09.1 N TN MD WNNN481 086-12-35.3 W 0003927503 CHELLSTORP, CLAUD A TULLAHOMA 08/07/2009 00075.86000 35-21-37.8 N RO WPFV309 0003925491 MJ Communications, Inc. 08/06/2009 Page 13 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WNIT418 0003925780 SLATER 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292824A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-292824A1.txt  
- Smith 08/12/2009 19475.00000 21-23-11.5 N HI NE 158-00-23.0 W 0003931797 CLEARWIRE HAWAII PARTNERS SPECWahiawa 08/12/2009 10855.00000 21-30-24.5 N IL NE 087-55-01.0 W 0003931999 Longview Capital Corporation ALLERTON 08/12/2009 10995.00000 39-53-02.0 N IL NE 088-09-39.9 W 0003932003 Longview Capital Corporation Villa Grove 08/12/2009 11485.00000 39-51-57.2 N CA NE 117-16-45.7 W 0003932023 Skyriver Communications Inc. Moreno 08/12/2009 19560.00000 33-57-34.5 N HI NE 156-27-04.1 W 0003932037 CLEARWIRE HAWAII PARTNERS SPECKihei 08/12/2009 11385.00000 20-43-48.3 N HI NE 156-27-03.6 W 0003932038 CLEARWIRE HAWAII PARTNERS SPECKihei 08/12/2009 11265.00000 20-46-21.0 N HI NE 156-27-03.6 W 0003932038 CLEARWIRE HAWAII PARTNERS SPECKihei 08/12/2009 11425.00000 20-46-21.0 N HI NE 156-27-03.6 W 0003932038 CLEARWIRE HAWAII PARTNERS SPECKihei 08/12/2009 11505.00000 20-46-21.0 N HI NE 156-27-03.6 W 0003932038 CLEARWIRE HAWAII PARTNERS SPECKihei 08/12/2009 11585.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293005A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293005A1.txt  
- W 0003939816 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 17915.00000 39-17-20.3 N MD NE 076-38-04.5 W 0003939816 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 23375.00000 39-17-20.3 N MD NE 076-38-04.5 W 0003939816 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 23475.00000 39-17-20.3 N MD NE 076-40-41.9 W 0003939817 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 19625.00000 39-00-01.0 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 18015.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 18115.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 23075.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 23175.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 08/19/2009 23375.00000 39-19-04.1 N MD NE 076-36-39.0 W 0003939818 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293212A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293212A1.txt  
- (MHz) Applicant Name Latitude City CA NE 117-35-17.2 W 0003942800 CLEARWIRE SPECTRUM HOLDINGS IIISan Clemente 08/21/2009 11545.00000 33-26-38.0 N CA NE 117-35-17.2 W 0003942800 CLEARWIRE SPECTRUM HOLDINGS IIISan Clemente 08/21/2009 23075.00000 33-26-38.0 N CA NE 117-35-17.2 W 0003942800 CLEARWIRE SPECTRUM HOLDINGS IIISan Clemente 08/21/2009 23225.00000 33-26-38.0 N CA NE 117-39-15.1 W 0003942801 CLEARWIRE SPECTRUM HOLDINGS IIISan Juan Capistrano 08/21/2009 19375.00000 33-28-04.1 N CA NE 117-39-15.1 W 0003942801 CLEARWIRE SPECTRUM HOLDINGS IIISan Juan Capistrano 08/21/2009 19475.00000 33-28-04.1 N CA NE 117-39-15.1 W 0003942801 CLEARWIRE SPECTRUM HOLDINGS IIISan Juan Capistrano 08/21/2009 19525.00000 33-28-04.1 N CA NE 117-39-15.1 W 0003942801 CLEARWIRE SPECTRUM HOLDINGS IIISan Juan Capistrano 08/21/2009 19625.00000 33-28-04.1 N CA NE 117-48-40.8 W 0003942803 CLEARWIRE SPECTRUM HOLDINGS IIIIrvine 08/21/2009 11385.00000 33-36-19.4 N CA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293258A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293258A2.txt  
- 0.8 628 3.0 346 1.7 7,592 36.3 20,916 Connecticut 7,897 52.0 355 2.3 107 0.7 330 2.2 198 1.3 6,312 41.5 15,199 Delaware 2,514 54.1 13 0.3 45 1.0 143 3.1 29 0.6 1,904 41.0 4,646 District of Columbia 4,297 74.1 2 0.0 94 1.6 185 3.2 36 0.6 1,187 20.5 5,801 Florida 39,489 55.0 2,359 3.3 391 0.5 2,942 4.1 1,476 2.1 25,164 35.0 71,821 Georgia 19,642 48.4 1,778 4.4 221 0.5 1,414 3.5 695 1.7 16,806 41.4 40,557 Guam 207 34.0 0 0.0 5 0.7 11 1.8 3 0.6 384 62.9 610 Hawaii 2,836 56.6 14 0.3 28 0.6 110 2.2 190 3.8 1,830 36.5 5,007 Idaho 2,671 41.7 65 1.0 317 4.9 152 2.4 104 1.6 3,093 48.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293261A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293261A2.txt  
- of the country. Table 12 Share of Universal Service Contributions 1/ By Principal Type of Contributor 2/ Preliminary 1/ Q3 Service Provider Category 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 Fixed Local Service Providers Regional Bell Operating Companies 11.7%14.4%14.4%16.4%18.4%20.2%20.3%20.4%20.4%18.6%14.5%13.6%12.9% (RBOCs) Including Local Affiliates Other Incumbent Local Exchange 2.6 1.4 1.5 1.7 2.1 2.9 3.3 4.1 4.2 4.2 3.7 3.7 3.5 Carriers (LECs) Including Local Affiliates Competitive Local Exchange Carriers 0.8 1.4 2.7 2.3 2.8 3.4 3.6 3.8 4.4 5.3 6.4 7.8 9.3 (CLECs) Local Resellers, Payphone Providers and Other Local Carriers, Excluding LEC Affiliates Total: Fixed Local Service Providers15.1 17.2 18.6 20.4 23.2 26.5 27.2 28.2 29.0 28.1 24.6 25.1 25.7 Wireless Service Providers Wireless 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293347A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293347A1.txt  
- MD WIA840 109-35-10.2 W 0003953074 EL PASO NATURAL GAS COMPANY BOWIE 09/01/2009 06805.00000 32-13-02.2 N AZ MD WIA840 109-35-10.2 W 0003953074 EL PASO NATURAL GAS COMPANY BOWIE 09/01/2009 06830.62500 32-13-02.2 N AZ MD WIA840 109-35-10.2 W 0003953074 EL PASO NATURAL GAS COMPANY BOWIE 09/01/2009 06835.00000 32-13-02.2 N TX MD WQKN692 098-34-11.6 W 0003953228 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 09/01/2009 17815.00000 29-28-04.1 N TX MD WQKN692 098-34-11.6 W 0003953228 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 09/01/2009 17915.00000 29-28-04.1 N TX MD WQKN692 098-34-11.6 W 0003953228 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 09/01/2009 17965.00000 29-28-04.1 N TX MD WQKN692 098-34-11.6 W 0003953228 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 09/01/2009 18065.00000 29-28-04.1 N TX MD WQKN692 098-34-11.6 W 0003953228 CLEARWIRE SPECTRUM HOLDINGS IIISAN ANTONIO 09/01/2009 23025.00000 29-28-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293451A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293451A1.txt  
- 40-32-55.3 N NY NE 074-07-03.1 W 0003961198 Northrop Grumman Information TechnologStaten Island 09/10/2009 21825.00000 40-38-10.8 N NY NE 074-07-03.1 W 0003961198 Northrop Grumman Information TechnologStaten Island 09/10/2009 21925.00000 40-38-10.8 N NY NE 074-13-24.6 W 0003961200 Northrop Grumman Information TechnologStaten Island 09/10/2009 23125.00000 40-31-29.6 N NY NE 074-13-24.6 W 0003961200 Northrop Grumman Information TechnologStaten Island 09/10/2009 23175.00000 40-31-29.6 N NY NE 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 09/10/2009 23025.00000 40-37-54.1 N NY NE 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 09/10/2009 23075.00000 40-37-54.1 N NY NE 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 09/10/2009 23125.00000 40-37-54.1 N NY NE 074-09-02.6 W 0003961259 Northrop Grumman Information TechnologStaten Island 09/10/2009 21825.00000 40-36-19.6 N NY NE 073-50-12.9 W 0003961260 Northrop Grumman 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293751A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293751A1.txt  
- 073-57-00.9 W 0003977238 Northrop Grumman Information TechnologNew York 09/25/2009 22075.00000 40-47-44.5 N NY MD WQIX249 073-57-00.9 W 0003977238 Northrop Grumman Information TechnologNew York 09/25/2009 23025.00000 40-47-44.5 N NY MD WQIX249 073-57-00.9 W 0003977238 Northrop Grumman Information TechnologNew York 09/25/2009 23075.00000 40-47-44.5 N NY MD WQIX249 073-57-00.9 W 0003977238 Northrop Grumman Information TechnologNew York 09/25/2009 23125.00000 40-47-44.5 N NY MD WQIX392 073-58-04.1 W 0003977239 Northrop Grumman Information TechnologNew York 09/25/2009 21825.00000 40-46-18.5 N NY MD WQIX392 073-58-04.1 W 0003977239 Northrop Grumman Information TechnologNew York 09/25/2009 21875.00000 40-46-18.5 N NY MD WQIX392 073-58-04.1 W 0003977239 Northrop Grumman Information TechnologNew York 09/25/2009 22325.00000 40-46-18.5 N WI MD WQEJ207 089-37-50.9 W 0003977336 WAOW-WYOW Television, Inc. Wausau 09/25/2009 21820.00000 44-57-40.6 N WI MD KSD94 088-24-13.3 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293960A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293960A1.txt  
- First Step Internet LLC Lenore Idaho 10/06/2009 17965.00000 46-35-28.6 N Page 40 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NJ NE P 074-23-36.0 W 0003989305 ATLANTIC CITY MUNICIPAL UTILITIES AOFFSHORE 10/07/2009 00956.38125 39-20-14.0 N NC NE 079-47-35.5 W 0003989314 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 10/07/2009 21825.00000 36-09-04.1 N NC NE 079-47-35.5 W 0003989314 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 10/07/2009 21925.00000 36-09-04.1 N NC NE 079-47-05.6 W 0003989317 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 10/07/2009 18015.00000 36-07-18.0 N NC NE 079-47-05.6 W 0003989317 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 10/07/2009 18115.00000 36-07-18.0 N NC NE 079-47-05.6 W 0003989317 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 10/07/2009 19375.00000 36-07-18.0 N NC NE 079-47-05.6 W 0003989317 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293977A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-293977A1.txt  
- ALSAT - (ALSAT) E890936 SES-RWL-20090924-01230 E Date Effective: 10/09/2009 Class of Station: Fixed Earth Stations Grant of Authority 10/27/2009 - 10/27/2024 Renewal Hearst Radio, Inc. Nature of Service: Domestic Fixed Satellite Service 39 ° 20 ' 5.00 " N LAT. SITE ID: 1 3800 HOOPER AVENUE, BALTIMORE, MD 76 ° 39 ' 3.00 " W LONG. LOCATION: COMTECH "OFFSAT" 1 4.1 meters ANTENNA ID: 54.40 dBW 5990.0000 - 5990.0000 MHz 200KF3E Points of Communication: 1 - ALSAT - (ALSAT) E980205 SES-RWL-20091001-01251 E Date Effective: 10/09/2009 Class of Station: Temporary Fixed Earth Station Grant of Authority 10/27/2009 - 10/27/2024 Renewal Telesat Network Services, Inc. Nature of Service: Domestic Fixed Satellite Service, International Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Page 5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294114A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294114A1.txt  
- of applications, subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI NE 085-15-17.0 W 0003996299 DUNCAN AVIATION INC Battle Creek 10/14/2009 00122.95000 42-18-04.1 N MI NE 085-33-06.0 W 0003996358 DUNCAN AVIATION INC Kalamazoo 10/14/2009 00122.95000 42-14-06.2 N CA NE 121-29-15.9 W 0003997844 CALIFORNIA, STATE OF SACRAMENTO 10/15/2009 00123.07500 38-35-56.3 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV AM WHS468 115-08-17.4 W 0003960564 UNIVERSITY SYSTEM OF HIGHER 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294136A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294136A1.txt  
- (ALSAT) E990340 SES-RWL-20091001-01252 E Date Effective: 10/19/2009 Class of Station: Fixed Earth Stations Grant of Authority 10/12/2009 - 10/12/2024 Renewal APOSTOLATE FOR FAMILY CONSECRATION INC. Nature of Service: Domestic Fixed Satellite Service 40 ° 23 ' 15.00 " N LAT. SITE ID: 1 3375 COUNTY ROAD 36, BLOOMINGDALE, OH 80 ° 48 ' 36.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 63.68 dBW DIGITAL COMPRESSED VIDEO 5925.0000 - 6425.0000 MHz 2M40G7F DIGITAL COMPRESSED VIDEO 3700.0000 - 4200.0000 MHz 2M40G7F Points of Communication: 1 - ALSAT - (ALSAT) E000013 SES-RWL-20091019-01335 E Date Effective: 10/20/2009 Class of Station: Fixed Earth Stations Grant of Authority 12/23/2009 - 12/23/2024 Renewal Cox Communications Louisiana, LLC Page 17 of 22 Nature of Service: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294276A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294276A1.txt  
- MD WPNL477 103-48-28.3 W 0004003197 NE Colorado Wireless Technologies, Inc.CEDAR POINT 10/21/2009 06123.10000 39-22-13.9 N CO MD WQKD487 103-32-28.8 W 0004003198 NE Colorado Wireless Technologies, Inc.La Junta 10/21/2009 06197.24000 37-57-39.6 N CO MD WQKB438 103-53-04.8 W 0004003201 NE Colorado Wireless Technologies, Inc.Hoffmans Creek 10/21/2009 06375.14000 39-50-33.2 N CA MD WMQ712 118-11-22.3 W 0004003351 LOS ANGELES SMSA LIMITED PARTNECOMPTON 10/21/2009 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004003351 LOS ANGELES SMSA LIMITED PARTNECOMPTON 10/21/2009 10561.25000 33-53-04.1 N Page 13 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WMQ712 118-11-22.3 W 0004003351 LOS ANGELES SMSA LIMITED PARTNECOMPTON 10/21/2009 10577.50000 33-53-04.1 N CA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294277A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294277A1.txt  
- 0004003882 CLEARWIRE SPECTRUM HOLDINGS IIIMcKinney 10/21/2009 17815.00000 33-11-18.0 N TX NE 096-45-11.0 W 0004003882 CLEARWIRE SPECTRUM HOLDINGS IIIMcKinney 10/21/2009 21825.00000 33-11-18.0 N TX NE 096-45-11.0 W 0004003882 CLEARWIRE SPECTRUM HOLDINGS IIIMcKinney 10/21/2009 21875.00000 33-11-18.0 N TX NE 096-45-11.0 W 0004003882 CLEARWIRE SPECTRUM HOLDINGS IIIMcKinney 10/21/2009 21925.00000 33-11-18.0 N TX NE 097-16-39.1 W 0004003883 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 10/21/2009 11225.00000 32-42-04.1 N TX NE 097-16-39.1 W 0004003883 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 10/21/2009 11305.00000 32-42-04.1 N TX NE 097-16-39.1 W 0004003883 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 10/21/2009 11385.00000 32-42-04.1 N Page 19 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 097-16-39.1 W 0004003883 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294278A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294278A1.txt  
- Private Carrier Paging, 929-930 MHz State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WNQP984 0004005540 LUCZAK, THOMAS W 10/22/2009 RO WNQP985 0004005552 LUCZAK, THOMAS W 10/22/2009 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY AM 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 10/23/2009 23025.00000 40-37-54.1 N NY AM 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 10/23/2009 23075.00000 40-37-54.1 N NY AM 074-09-04.1 W 0003961257 Northrop Grumman Information TechnologStaten Island 10/23/2009 23125.00000 40-37-54.1 N NY AM 073-49-49.9 W 0003961273 Northrop Grumman Information TechnologKew Gardens 10/23/2009 21925.00000 40-42-08.0 N NY AM 073-49-49.9 W 0003961273 Northrop Grumman 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294459A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294459A1.txt  
- 34-48-10.0 N CO NE 108-18-36.0 W 0004011601 New Cingular Wireless PCS, LLC Palisade 10/28/2009 10622.50000 39-08-38.0 N CO NE 108-20-44.9 W 0004011612 New Cingular Wireless PCS, LLC Palisade 10/28/2009 10557.50000 39-05-30.7 N CA NE 123-34-46.4 W 0004011704 Willits Online LLC Laytonville 10/28/2009 06286.19000 39-41-39.2 N CA NE 123-34-46.4 W 0004011704 Willits Online LLC Laytonville 10/28/2009 11685.00000 39-41-39.2 N CA NE 123-29-04.1 W 0004011708 Willits Online LLC Laytonville 10/28/2009 11185.00000 39-41-12.9 N WY NE 107-35-53.1 W 0004011966 Union Telephone Company Baggs 10/29/2009 06755.00000 41-03-02.3 N OR NE 121-49-08.2 W 0004012528 Edge Wireless, LLC Klamath Falls 10/29/2009 11147.50000 42-07-13.5 N OR NE 121-49-08.2 W 0004012528 Edge Wireless, LLC Klamath Falls 10/29/2009 11667.50000 42-07-13.5 N OR NE 121-55-45.3 W 0004012584 Edge Wireless, LLC Klamath 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294461A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294461A1.txt  
- IIIDARIEN 10/29/2009 21825.00000 41-44-24.6 N IL MD WQKQ471 088-00-30.8 W 0004012561 CLEARWIRE SPECTRUM HOLDINGS IIIDARIEN 10/29/2009 21925.00000 41-44-24.6 N Page 7 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WQKQ471 088-00-30.8 W 0004012561 CLEARWIRE SPECTRUM HOLDINGS IIIDARIEN 10/29/2009 22075.00000 41-44-24.6 N CA MD KMM27 117-07-04.1 W 0004012624 San Diego Gas & Electric Company ESCONDIDO 10/29/2009 11035.00000 33-07-32.1 N MD MD WQKW482 076-41-09.2 W 0004012632 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 10/29/2009 19375.00000 39-21-15.0 N MD MD WQKW482 076-41-09.2 W 0004012632 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 10/29/2009 19425.00000 39-21-15.0 N MD MD WQKW482 076-41-09.2 W 0004012632 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 10/29/2009 19475.00000 39-21-15.0 N MD MD WQKW482 076-41-09.2 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294462A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294462A1.txt  
- Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO NE 094-36-05.8 W 0004013851 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 11345.00000 39-04-41.0 N MO NE 094-36-05.8 W 0004013851 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 23125.00000 39-04-41.0 N MO NE 094-36-05.8 W 0004013851 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 23275.00000 39-04-41.0 N MO NE 094-31-04.1 W 0004013852 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 10975.00000 39-05-40.1 N MO NE 094-31-04.1 W 0004013852 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 11015.00000 39-05-40.1 N MO NE 094-31-04.1 W 0004013852 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 11055.00000 39-05-40.1 N MO NE 094-31-04.1 W 0004013852 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/30/2009 11095.00000 39-05-40.1 N MO NE 094-25-19.0 W 0004013853 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294598A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294598A1.txt  
- 21875.00000 21-18-45.4 N HI AM WQDT893 157-51-36.1 W 0003990965 Clearwire Hawaii Partners Spectrum LLCHonolulu 11/02/2009 23375.00000 21-18-45.4 N HI AM WQDT893 157-51-36.1 W 0003990965 Clearwire Hawaii Partners Spectrum LLCHonolulu 11/02/2009 23475.00000 21-18-45.4 N Page 29 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KMM27 117-07-04.1 W 0004012624 San Diego Gas & Electric Company ESCONDIDO 11/03/2009 11185.00000 33-07-32.1 N CA AM WNEQ695 116-58-22.1 W 0004012646 San Diego Gas & Electric Company RAMONA 11/03/2009 11685.00000 33-00-32.1 N NC MD WQEY821 078-52-14.3 W 0004014041 Clearwire Spectrum Holdings, LLC Cary, NC 10/30/2009 10775.00000 35-45-57.8 N NC MD WQEY821 078-52-14.3 W 0004014041 Clearwire Spectrum Holdings, LLC Cary, NC 10/30/2009 10855.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294599A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294599A1.txt  
- Number Frequency (MHz) Applicant Name Latitude City KS NE 094-45-41.3 W 0004021130 CLEARWIRE SPECTRUM HOLDINGS IIILenexa 11/04/2009 23275.00000 38-55-40.9 N KS NE 094-41-07.7 W 0004021131 CLEARWIRE SPECTRUM HOLDINGS IIIOverland Park 11/04/2009 21875.00000 39-01-59.4 N KS NE 094-41-07.7 W 0004021131 CLEARWIRE SPECTRUM HOLDINGS IIIOverland Park 11/04/2009 22025.00000 39-01-59.4 N KS NE 094-36-35.2 W 0004021132 CLEARWIRE SPECTRUM HOLDINGS IIIMission Woods 11/04/2009 18015.00000 39-02-04.1 N KS NE 094-36-35.2 W 0004021132 CLEARWIRE SPECTRUM HOLDINGS IIIMission Woods 11/04/2009 18115.00000 39-02-04.1 N MO NE 094-28-55.9 W 0004021133 CLEARWIRE SPECTRUM HOLDINGS IIILiberty 11/04/2009 10735.00000 39-12-37.1 N MO NE 094-28-55.9 W 0004021133 CLEARWIRE SPECTRUM HOLDINGS IIILiberty 11/04/2009 10855.00000 39-12-37.1 N MO NE 094-28-55.9 W 0004021133 CLEARWIRE SPECTRUM HOLDINGS IIILiberty 11/04/2009 23075.00000 39-12-37.1 N MO NE 094-28-55.9 W 0004021133 CLEARWIRE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294682A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294682A1.txt  
- PACIFIC, INC. Mt. Alutom 11/13/2009 02128.00000 13-25-58.2 N WV NE 080-15-01.6 W 0004031582 HARDY CELLULAR TELEPHONE COMPFairview 11/13/2009 11632.50000 39-35-16.1 N Page 9 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WV NE 080-13-30.8 W 0004031594 HARDY CELLULAR TELEPHONE COMPFairview 11/13/2009 11142.50000 39-38-04.1 N LA NE 092-42-16.8 W 0004031947 DETEL Wireless LLC Elton 11/13/2009 19680.00000 30-29-13.3 N LA NE 092-55-13.8 W 0004031957 DETEL Wireless LLC Fenton 11/13/2009 11345.00000 30-22-08.4 N LA NE 092-04-19.8 W 0004031962 DETEL Wireless LLC Marksville 11/13/2009 19320.00000 31-07-30.7 N LA NE 093-20-40.7 W 0004031967 DETEL Wireless LLC Coushatta 11/13/2009 17760.00000 32-00-57.1 N LA NE 093-20-40.7 W 0004031967 DETEL Wireless 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294700A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294700A1.txt  
- Date Effective: 11/13/2009 Class of Station: Fixed Earth Stations Grant of Authority 01/21/2010 - 01/21/2025 Renewal Atlantic Telecommunications Services Corp. Nature of Service: Fixed Satellite Service 42 ° 37 ' 30.00 " N LAT. SITE ID: 1 SR99, 4240 N. MICHIGAN ROAD, EATON, DIMONDALE, MI 84 ° 37 ' 29.00 " W LONG. LOCATION: Page 3 of 7 COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 72.40 dBW COMPRESSED DIGITAL VIDEO 5925.0000 - 6425.0000 MHz 8M60G1F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz 8M60G1F Points of Communication: 1 - ALSAT - (ALSAT) E990341 SES-RWL-20091105-01417 E Date Effective: 11/13/2009 Class of Station: Fixed Earth Stations Grant of Authority 02/03/2010 - 02/03/2025 Renewal Trinity Christian Center of Santa Ana, Inc. Nature of Service: Fixed 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294833A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294833A1.txt  
- MD WQKY614 079-04-11.5 W 0004035684 CLEARWIRE SPECTRUM HOLDINGS IIICarrboro 11/17/2009 11345.00000 35-54-08.9 N PA MD WQIQ641 076-55-08.0 W 0004036154 LAST MILE INC. dba STING COMMUNICCAMP HILL 11/17/2009 19675.00000 40-15-20.0 N PA MD WQJJ466 076-57-53.0 W 0004036155 LAST MILE INC. dba STING COMMUNICMechanicsburg 11/17/2009 19315.00000 40-12-46.8 N PA MD WQJV713 076-54-43.2 W 0004036156 LAST MILE INC. dba STING COMMUNICWormleysburg 11/17/2009 19495.00000 40-16-04.1 N CA MD KFH45 121-18-10.5 W 0004036211 UNION PACIFIC RAILROAD ROSEVILLE 11/17/2009 06585.00000 38-44-16.8 N NV MD WQJL988 115-16-44.4 W 0004036358 CLEARWIRE SPECTRUM HOLDINGS II LAS VEGAS 11/17/2009 23025.00000 36-11-10.3 N NV MD WQJL988 115-16-44.4 W 0004036358 CLEARWIRE SPECTRUM HOLDINGS II LAS VEGAS 11/17/2009 23075.00000 36-11-10.3 N NV MD WQJL988 115-16-44.4 W 0004036358 CLEARWIRE SPECTRUM HOLDINGS II LAS VEGAS 11/17/2009 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294834A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294834A1.txt  
- New Mexico, FARMINGTON 11/20/2009 06765.00000 36-48-54.5 N NM MD WHC932 107-53-30.5 W 0004039862 ALLTEL Communications of New Mexico, FARMINGTON 11/20/2009 19465.00000 36-48-54.5 N NM MD KTF35 107-10-00.1 W 0004040075 Qwest Corporation CORREO 11/20/2009 06256.54000 35-00-48.1 N NM MD KTF35 107-10-00.1 W 0004040075 Qwest Corporation CORREO 11/20/2009 06404.79000 35-00-48.1 N NM MD KTF32 107-46-57.2 W 0004040174 Qwest Corporation MCCARTYS 11/20/2009 06004.50000 35-04-04.1 N NM MD KTF32 107-46-57.2 W 0004040174 Qwest Corporation MCCARTYS 11/20/2009 06034.15000 35-04-04.1 N AR MD WPXV569 093-53-23.9 W 0004040396 ALLTEL Communications of Southwest ArFOUKE 11/20/2009 05945.20000 33-06-39.9 N AR MD WPXV569 093-53-23.9 W 0004040396 ALLTEL Communications of Southwest ArFOUKE 11/20/2009 06034.15000 33-06-39.9 N AR MD WPXV569 093-53-23.9 W 0004040396 ALLTEL Communications of Southwest ArFOUKE 11/20/2009 06093.45000 33-06-39.9 N AR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294927A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-294927A1.txt  
- IIITinley Park 11/23/2009 17765.00000 41-35-44.9 N IL NE 088-09-52.0 W 0004042063 CLEARWIRE SPECTRUM HOLDINGS IIIPlainfield 11/23/2009 11265.00000 41-37-32.2 N IL NE 088-09-52.0 W 0004042063 CLEARWIRE SPECTRUM HOLDINGS IIIPlainfield 11/23/2009 11345.00000 41-37-32.2 N IL NE 088-09-52.0 W 0004042063 CLEARWIRE SPECTRUM HOLDINGS IIIPlainfield 11/23/2009 23175.00000 41-37-32.2 N IL NE 088-09-52.0 W 0004042063 CLEARWIRE SPECTRUM HOLDINGS IIIPlainfield 11/23/2009 23275.00000 41-37-32.2 N IL NE 087-56-04.1 W 0004042070 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 11/23/2009 11095.00000 41-45-09.8 N IL NE 087-56-04.1 W 0004042070 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 11/23/2009 23375.00000 41-45-09.8 N IL NE 087-56-04.1 W 0004042070 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 11/23/2009 23475.00000 41-45-09.8 N IL NE 088-03-59.7 W 0004042074 CLEARWIRE SPECTRUM HOLDINGS IIIGlen Ellyn 11/23/2009 21825.00000 41-49-39.9 N IL NE 087-54-35.5 W 0004042082 CLEARWIRE SPECTRUM HOLDINGS IIIWestchester 11/23/2009 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295089A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295089A1.txt  
- 0004050357 CLEARWIRE SPECTRUM HOLDINGS IIIBedford 12/02/2009 19525.00000 32-50-16.4 N TX NE 097-08-02.8 W 0004050357 CLEARWIRE SPECTRUM HOLDINGS IIIBedford 12/02/2009 23025.00000 32-50-16.4 N TX NE 097-08-02.8 W 0004050357 CLEARWIRE SPECTRUM HOLDINGS IIIBedford 12/02/2009 23125.00000 32-50-16.4 N TX NE 097-08-02.8 W 0004050357 CLEARWIRE SPECTRUM HOLDINGS IIIBedford 12/02/2009 23225.00000 32-50-16.4 N TX NE 097-18-57.9 W 0004050358 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 12/02/2009 19375.00000 32-51-04.1 N TX NE 097-18-57.9 W 0004050358 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 12/02/2009 19475.00000 32-51-04.1 N TX NE 097-18-57.9 W 0004050358 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 12/02/2009 19575.00000 32-51-04.1 N TX NE 097-18-57.9 W 0004050358 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 12/02/2009 19675.00000 32-51-04.1 N TX NE 097-18-57.9 W 0004050358 CLEARWIRE SPECTRUM HOLDINGS IIIFort Worth 12/02/2009 21825.00000 32-51-04.1 N TX NE 097-09-22.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295090A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295090A1.txt  
- IIIColleyville 12/04/2009 21875.00000 32-54-24.9 N TX AM 097-10-16.2 W 0004004082 CLEARWIRE SPECTRUM HOLDINGS IIIColleyville 12/04/2009 23175.00000 32-54-24.9 N TX AM 097-10-16.2 W 0004004082 CLEARWIRE SPECTRUM HOLDINGS IIIColleyville 12/04/2009 23275.00000 32-54-24.9 N TX AM 097-10-16.2 W 0004004082 CLEARWIRE SPECTRUM HOLDINGS IIIColleyville 12/04/2009 23425.00000 32-54-24.9 N TX AM 097-10-16.2 W 0004004082 CLEARWIRE SPECTRUM HOLDINGS IIIColleyville 12/04/2009 23525.00000 32-54-24.9 N CA AM KMM27 117-07-04.1 W 0004012624 San Diego Gas & Electric Company ESCONDIDO 12/04/2009 11185.00000 33-07-32.1 N NC AM 078-39-47.9 W 0004013459 CLEARWIRE SPECTRUM HOLDINGS IIIRALEIGH 12/03/2009 11265.00000 35-54-47.2 N NC AM 078-39-47.9 W 0004013459 CLEARWIRE SPECTRUM HOLDINGS IIIRALEIGH 12/03/2009 11345.00000 35-54-47.2 N NC AM 078-39-47.9 W 0004013459 CLEARWIRE SPECTRUM HOLDINGS IIIRALEIGH 12/03/2009 11465.00000 35-54-47.2 N NC AM 078-39-47.9 W 0004013459 CLEARWIRE SPECTRUM HOLDINGS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295110A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295110A1.txt  
- (ALSAT) Page 9 of 12 E020024 SES-MOD-20091203-01545 E Class of Station: Fixed Earth Stations Application for Modification Broadcast Facilities, Inc. Nature of Service: Fixed Satellite Service "MOD" to add antenna. 34 ° 6 ' 58.50 " N LAT. SITE ID: 1 3030 ANDRITA STREET, LOS ANGELES, LOS ANGELES, CA 118 ° 14 ' 39.70 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: 5 Meter Offsat 72.40 dBW Digital Data 5925.0000 - 6425.0000 MHz 36M0G7D 68.90 dBW Digital Data 5925.0000 - 6425.0000 MHz 4M00G7D 72.40 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 36M0G7W 68.90 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 4M00G7W 72.40 dBW Standard Video 5925.0000 - 6425.0000 MHz 36M0F3F Digital Data 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295212A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295212A1.txt  
- (Percentage of Households with Telephone Service) State Alabama 87.9% 95.3% 7.3% * Alaska 83.8 95.9 12.1 * Arizona 88.8 93.5 4.7 Arkansas 88.2 92.8 4.7 California 91.7 96.6 4.9 * Colorado 94.4 97.0 2.6 Connecticut 95.5 98.5 3.0 Delaware 95.0 96.5 1.5 District of Columbia 94.7 91.3 -3.4 Florida 85.5 92.9 7.4 * Georgia 88.9 93.8 4.9 Hawaii 94.6 98.7 4.1 Idaho 89.5 96.3 6.8 * Illinois 95.0 95.9 0.9 Indiana 90.3 92.3 2.0 Iowa 95.4 98.3 2.9 Kansas 94.9 97.1 2.2 Kentucky 86.9 94.8 7.9 * Louisiana 88.9 94.9 6.0 Maine 90.7 97.1 6.3 * Maryland 96.3 95.0 -1.3 Massachusetts 94.3 98.2 3.9 Michigan 93.8 97.1 3.3 Minnesota 96.4 98.1 1.7 Mississippi 82.4 94.1 11.8 * Missouri 92.1 95.1 3.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295251A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295251A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA MD WQGT518 120-28-59.9 W 0004055645 Clearwire Spectrum Holdings II, LLC UNION GAP 12/08/2009 17815.00000 46-33-54.0 N WA MD WQGT518 120-28-59.9 W 0004055645 Clearwire Spectrum Holdings II, LLC UNION GAP 12/08/2009 17915.00000 46-33-54.0 N WA MD WQFL522 122-18-09.0 W 0004055646 Clearwire Spectrum Holdings, LLC FEDERAL WAY 12/08/2009 11385.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0004055646 Clearwire Spectrum Holdings, LLC FEDERAL WAY 12/08/2009 17815.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0004055646 Clearwire Spectrum Holdings, LLC FEDERAL WAY 12/08/2009 17840.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0004055646 Clearwire Spectrum Holdings, LLC FEDERAL WAY 12/08/2009 17915.00000 47-21-04.1 N WA MD WQFL522 122-18-09.0 W 0004055646 Clearwire Spectrum Holdings, LLC FEDERAL 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295335A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295335A1.txt  
- N WA MD WQEI750 119-50-34.4 W 0004068864 WESTERN SUB-RSA LIMITED PARTNERMoxee 12/17/2009 06140.40000 46-36-45.7 N WA MD WQEI750 119-50-34.4 W 0004068864 WESTERN SUB-RSA LIMITED PARTNERMoxee 12/17/2009 06606.25000 46-36-45.7 N WA MD WQEI750 119-50-34.4 W 0004068864 WESTERN SUB-RSA LIMITED PARTNERMoxee 12/17/2009 06656.25000 46-36-45.7 N WA MD WQEI750 119-50-34.4 W 0004068864 WESTERN SUB-RSA LIMITED PARTNERMoxee 12/17/2009 10643.75000 46-36-45.7 N WA MD WPJB542 119-53-04.1 W 0004068870 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 12/17/2009 06345.49000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0004068870 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 12/17/2009 06392.44000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0004068870 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 12/17/2009 06855.00000 46-48-55.4 N Page 8 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295377A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295377A1.txt  
- Tables 1(d) and 1(e) are straightforward and reflect the data in the format filed. Complete data descriptions are available in several Commission orders.26 4. Qualifications Overall, we caution readers to be aware of potential inconsistencies in the service quality data and methodological shortcomings affecting both the collection and interpretation of the data. Some common sources of issues are described below. 4.1 Data Re-filings Commission staff generally screen company-filed service quality data for irregularities and provide feedback to reporting companies on suspected problems. The reporting companies are then given an opportunity to re-file. Re-filed data appear in this report if they are received in time to be attached tables. Other charts contain data that were taken directly from company provided composite data. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295406A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295406A1.txt  
- Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO NE 102-37-01.6 W 0004071957 NE Colorado Wireless Technologies, Inc.Springfield 12/21/2009 06063.80000 37-24-03.9 N CA NE 123-34-46.4 W 0004074928 Willits Online LLC Laytonville 12/22/2009 06286.19000 39-41-39.2 N CA NE 123-34-46.4 W 0004074928 Willits Online LLC Laytonville 12/22/2009 11685.00000 39-41-39.2 N CA NE 123-29-04.1 W 0004074929 Willits Online LLC Laytonville 12/22/2009 11185.00000 39-41-12.9 N ID NE 111-07-36.1 W 0004076046 Silver Star Telephone Company, Inc. AFTON 12/23/2009 11385.00000 42-41-17.8 N RO WNEW314 0004073404 SOUTHERN CALIFORNIA EDISON COM 12/22/2009 RO KMO48 0004073405 SOUTHERN CALIFORNIA EDISON COM 12/22/2009 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A1.txt  
- by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ...................................... Table 3.8 Safety Valve Support Payments by Study Area ........................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type ..... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State .......... Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type ............................. Table 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A11.txt  
- 15.4 15.1 12.9 12.4 17.2 Average Repair Interval (hours) 8.3 11.1 11.8 4.3 3.1 2.6 2.5 8.5 8.4 ACCESS SERVICES PROVIDED TO CARRIERS -- SPECIAL ACCESS Percent Installation Commitments Met 89.4 99.4 94.6 97.5 98.4 96.5 95.0 94.7 96.3 Average Installation Interval (days) 18.0 14.2 16.3 16.0 19.3 4.3 12.9 12.9 11.8 Average Repair Interval (hours) 6.0 3.5 5.8 5.0 4.1 3.7 4.0 3.7 3.8 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 98.4 97.3 99.5 99.1 99.7 99.7 99.0 98.3 98.0 Residence 98.5 98.5 99.6 99.0 99.7 99.8 99.1 98.4 98.2 Business 98.3 89.5 99.3 99.0 99.5 99.1 98.2 97.4 95.8 Average Installation Interval (days) 1.8 1.3 1.2 1.0 1.3 0.1 2.5 1.8 1.1 Residence 1.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A2.txt  
- by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ...................................... Table 3.8 Safety Valve Support Payments by Study Area ........................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type ..... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State .......... Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type ............................. Table 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A6.txt  
- nearly $1.73 billion of Funding Year 2007 funds. As of the same date, USAC had committed nearly $2.33 billion, and disbursed nearly $1.07 billion of Funding Year 2008 funds.7 USAC supplies the Commission with funding commitments and disbursements information for the E-rate program for all active funding years. USAC provided the Commission with data as of June 30, 2009. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A9.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295442A9.txt  
- the Communications Act of 1934. 47 U.S.C. §§ 151 et seq. 1958 - 2008 1998 - 2008 CPI All Items 4.0 % 2.5 % CPI All Services 5.0 3.3 CPI Telephone Services 1 1.7 0.1 CPI Major Categories: - Food & Beverages * 3.0 - Housing * 3.0 - Apparel 1.9 -1.1 - Transportation 3.5 1.6 - Medical Care 5.9 4.1 - Recreation * 1.2 - Other Goods & Services * 3.4 CPI Public Transportation 4.9 2.3 CPI Utility (Piped) Gas Service 5.5 7.3 CPI Electricity 3.8 4.4 CPI Water & Sewerage Maintenance 5.6 4.5 CPI Postage 4.6 3.0 Source: Bureau of Labor Statistics. Long-Term Changes for Various Price Indices Chart 7.1 CPI All Items and CPI Telephone Services Base Periods: 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295656A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295656A1.txt  
- MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E940443 SES-MOD-20091217-01643 E Class of Station: Temporary Fixed Earth Station Application for Modification CRAWFORD COMMUNICATIONS, INC. Nature of Service: Fixed Satellite Service "MOD" to change assigned frequency(ies) from Ku-band to C-band, emission designator, and replace antenna on existing earth station license. SITE ID: 1 VARIOUS LOCATION: COMTECH "18 FT" 1 4.1 meters ANTENNA ID: 5.5 "OFFSAT" 43.97 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45MBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW HDTV CARRIER 5925.0000 - 6425.0000 MHz 36M0G2F Points of Communication: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295657A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295657A1.txt  
- E020024 SES-MOD-20091203-01545 E Date Effective: 01/12/2010 Class of Station: Fixed Earth Stations Grant of Authority 04/08/2002 - 04/08/2012 Application for Modification Broadcast Facilities, Inc. Nature of Service: Fixed Satellite Service 34 ° 6 ' 58.50 " N LAT. SITE ID: 1 3030 ANDRITA STREET, LOS ANGELES, LOS ANGELES, CA 118 ° 14 ' 39.70 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: 5 Meter Offsat 72.40 dBW Digital Data 5925.0000 - 6425.0000 MHz 36M0G7D 68.90 dBW Digital Data 5925.0000 - 6425.0000 MHz 4M00G7D 72.40 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 36M0G7W 68.90 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 4M00G7W 72.40 dBW Standard Video 5925.0000 - 6425.0000 MHz 36M0F3F Digital Data 3700.0000 - 4200.0000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295779A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295779A1.txt  
- LLC Stinnett 01/14/2010 11325.00000 35-50-44.9 N TX MD WQIW427 101-26-53.5 W 0004092489 AMA COMMUNICATIONS, LLC Stinnett 01/14/2010 11565.00000 35-50-44.9 N TX MD WQIW442 101-26-49.3 W 0004092492 AMA COMMUNICATIONS L.L.C. BORGER 01/14/2010 10755.00000 35-38-15.9 N TX MD WQIW442 101-26-49.3 W 0004092492 AMA COMMUNICATIONS L.L.C. BORGER 01/14/2010 10835.00000 35-38-15.9 N TX MD WQKL438 101-27-43.6 W 0004092495 AMA COMMUNICATIONS, LLC PRINGLE 01/14/2010 10995.00000 35-57-04.1 N TX MD WQKL438 101-27-43.6 W 0004092495 AMA COMMUNICATIONS, LLC PRINGLE 01/14/2010 11075.00000 35-57-04.1 N SC MD WQJQ521 081-02-23.3 W 0004092815 Conterra Ultra Broadband, LLC ROCK HILL 01/14/2010 10955.00000 34-56-42.7 N NC MD WQJC689 080-50-54.1 W 0004092822 Conterra Ultra Broadband LLC DAVIDSON 01/14/2010 11245.00000 35-35-35.4 N NC MD WQJC689 080-50-54.1 W 0004092822 Conterra Ultra Broadband LLC DAVIDSON 01/14/2010 11445.00000 35-35-35.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295960A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295960A1.txt  
- 01/22/2010 06615.00000 38-15-17.7 N CO MD WQEP233 108-41-21.0 W 0004099225 STATE OF COLORADO NUCLA 01/22/2010 10552.50000 38-15-17.7 N FL MD WPOV207 081-47-10.2 W 0004099249 POLK, COUNTY OF POLK 01/22/2010 06675.00000 28-11-47.0 N Page 5 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WPTG652 079-00-04.1 W 0004099747 COMMONWEALTH OF PENNSYLVANIAWARREN 01/22/2010 06705.00000 41-49-59.2 N PA MD WPTG652 079-00-04.1 W 0004099747 COMMONWEALTH OF PENNSYLVANIAWARREN 01/22/2010 06745.00000 41-49-59.2 N AZ NE 111-53-02.8 W 0004094175 SCOTTSDALE, CITY OF SCOTTSDALE 01/19/2010 11225.00000 33-34-09.3 N AZ NE 111-53-02.8 W 0004094175 SCOTTSDALE, CITY OF SCOTTSDALE 01/19/2010 11425.00000 33-34-09.3 N AZ NE 111-53-02.8 W 0004094175 SCOTTSDALE, CITY OF SCOTTSDALE 01/19/2010 11585.00000 33-34-09.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295961A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295961A1.txt  
- IIIARLINGTON 01/19/2010 21925.00000 38-50-38.9 N VA NE 077-30-19.0 W 0004095366 CLEARWIRE SPECTRUM HOLDINGS IIIASHBURN 01/19/2010 21875.00000 39-03-16.7 N VA NE 077-30-19.0 W 0004095366 CLEARWIRE SPECTRUM HOLDINGS IIIASHBURN 01/19/2010 22025.00000 39-03-16.7 N VA NE 077-04-26.4 W 0004095367 CLEARWIRE SPECTRUM HOLDINGS IIIArlington 01/19/2010 22225.00000 38-53-26.8 N MT NE 112-01-30.5 W 0004096312 Cutthroat Communications Helena MT 59601 01/19/2010 19585.00000 46-35-49.6 N MT NE 111-55-04.1 W 0004096315 Cutthroat Communications Montana City, MT 01/19/2010 18025.00000 46-33-15.4 N TX NE 096-29-16.4 W 0004096409 TierOne Converged Networks, Inc. Princeton 01/19/2010 11505.00000 33-06-49.3 N TX NE 096-29-16.4 W 0004096409 TierOne Converged Networks, Inc. Princeton 01/19/2010 11585.00000 33-06-49.3 N TX NE 096-35-03.0 W 0004096456 TierOne Converged Networks, Inc. Allen 01/19/2010 11015.00000 33-03-50.4 N UT NE 113-37-23.1 W 0004096460 InfoWest, Inc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295982A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-295982A1.txt  
- LOCATION: FT. WORTH TOWER, FWT-5 1 5 meters ANTENNA ID: 3700.0000 - 4200.0000 MHz 36000F9 Points of Communication: 1 - ALSAT - (ALSAT) E000056 SES-RWL-20100119-00094 E Date Effective: 01/25/2010 Class of Station: Temporary Fixed Earth Station Grant of Authority 03/14/2010 - 03/14/2025 Renewal SES Americom, Inc. Nature of Service: Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: Comtech 1 4.1 meters ANTENNA ID: 18FTOffsat Reflector 57.20 dBW Angle modulated digital data (min. rate). 5925.0000 - 6425.0000 MHz 100KG7D 65.30 dBW Angle modulated digital data (max. data rate) 5925.0000 - 6425.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) WZ34 SES-RWL-20100119-00095 E Date Effective: 01/20/2010 Class of Station: Fixed Earth Stations Grant of Authority 03/09/2010 - 03/09/2025 Renewal Comcast 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296121A1.pdf  
- 7.1 * Maryland 96.3 95.6 -0.6 Massachusetts 94.3 98.4 4.0 Michigan 93.8 95.8 2.0 Minnesota 96.4 97.0 0.6 Mississippi 82.4 94.3 11.9 * Missouri 92.1 96.7 4.6 * Montana 92.8 92.0 -0.8 Nebraska 94.0 95.3 1.3 Nevada 89.4 94.3 4.9 * New Hampshire 95.0 98.4 3.4 New Jersey 94.1 97.0 2.9 New Mexico 85.3 90.9 5.6 New York 90.8 95.0 4.1 * North Carolina 89.3 93.9 4.6 North Dakota 95.1 97.6 2.5 Ohio 92.2 97.1 4.9 * Oklahoma 91.5 96.5 5.0 Oregon 91.2 99.0 7.8 * Pennsylvania 95.1 98.6 3.5 * Rhode Island 93.3 96.3 2.9 South Carolina 81.8 92.1 10.3 * South Dakota 92.7 96.8 4.1 Tennessee 87.6 93.8 6.2 Texas 89.0 94.8 5.8 * Utah 90.3 96.7 6.4 * 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296129A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296129A1.txt  
- MD WQHJ434 122-09-33.0 W 0004107736 WiLine Networks Inc. Palo Alto 01/28/2010 11305.00000 37-26-56.0 N CA MD WQFY914 122-08-33.0 W 0004107748 Wiline Networks Inc Cupertino 01/28/2010 10775.00000 37-19-13.0 N CA MD WQFY914 122-08-33.0 W 0004107748 Wiline Networks Inc Cupertino 01/28/2010 11095.00000 37-19-13.0 N CA MD WQIK475 121-58-26.3 W 0004107752 WiLine Networks Inc. Santa Clara 01/28/2010 21375.00000 37-23-17.4 N NE MD WQLC851 098-34-04.1 W 0004107995 USCOC NEBRASKA/KANSAS, LLC Greeley 01/29/2010 06605.00000 41-29-39.1 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NE MD WQLC851 098-34-04.1 W 0004107995 USCOC NEBRASKA/KANSAS, LLC Greeley 01/29/2010 06615.00000 41-29-39.1 N NE MD WQGI274 098-36-48.7 W 0004108011 USCOC NEBRASKA/KANSAS, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296239A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296239A1.txt  
- 9,769 6,409 16,178 7,052 15,839 13,428 15,060 22,804 11,503 178 85,865 102,043 Percentages aDSL 3.9 8.1 12.0 6.9 19.8 30.6 27.7 2.5 0.4 0.0 88.0 100.0 sDSL 0.0 0.0 0.0 44.9 32.5 * 1.6 0.0 * 0.0 100.0 100.0 Other Wireline 0.0 0.0 0.0 15.5 12.3 55.1 8.7 3.1 2.2 3.1 100.0 100.0 Cable Modem 1.1 1.5 2.5 0.8 2.8 4.1 13.9 53.0 22.6 0.3 97.5 100.0 FTTP 0.2 0.0 0.2 0.7 1.4 2.7 24.2 1.3 68.4 1.2 99.8 100.0 Satellite 53.2 35.0 88.3 * * * * 0.0 0.0 0.0 11.7 100.0 Fixed Wireless 14.2 4.5 18.7 20.8 22.3 25.2 9.2 1.9 1.8 0.2 81.3 100.0 Mobile Wireless 30.2 11.9 42.1 17.1 33.3 7.0 0.5 0.0 0.0 0.0 57.9 100.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296303A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296303A1.txt  
- - (ALSAT) Page 1 of 3 E990429 SES-MOD-20100119-00099 E Class of Station: Temporary Fixed Earth Station Application for Modification Allen Holdings, Inc. d/b/a Allen Communications Nature of Service: Fixed Satellite Service "MOD" to convert license to C-Band. 0 ° 0 ' 0.00 " N LAT. SITE ID: 1 VARIOUS 0 ° 0 ' 0.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 18FT (OFFSAT) 72.39 dBW DIGITAL CARRIER 5925.0000 - 6425.0000 MHz 8M00G7D 56.10 dBW DIGITAL CARRIER 5925.0000 - 6425.0000 MHz 76K8G7D 72.40 dBW ANALOG, VIDEO/AUDIO 5925.0000 - 6425.0000 MHz 36M0F8F Points of Communication: 1 - ALSAT - (ALSAT) E070153 SES-MOD-20100128-00133 E Class of Station: Fixed Earth Stations Application for Modification Direct Shopping Network Nature of Service: Fixed Satellite 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296463A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296463A1.txt  
- 32-41-02.3 N CA NE 117-08-18.3 W 0004130284 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 02/19/2010 19575.00000 32-42-37.2 N CA NE 117-08-18.3 W 0004130284 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 02/19/2010 19675.00000 32-42-37.2 N CA NE 117-04-30.0 W 0004130285 CLEARWIRE SPECTRUM HOLDINGS IIINational City 02/19/2010 23075.00000 32-39-49.0 N CA NE 117-04-30.0 W 0004130285 CLEARWIRE SPECTRUM HOLDINGS IIINational City 02/19/2010 23225.00000 32-39-49.0 N CA NE 117-04-04.1 W 0004130286 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 02/19/2010 23075.00000 32-40-45.8 N CA NE 117-04-04.1 W 0004130286 CLEARWIRE SPECTRUM HOLDINGS IIISan Diego 02/19/2010 23225.00000 32-40-45.8 N TX NE 095-14-07.4 W 0004130325 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/19/2010 22175.00000 29-36-41.2 N TX NE 095-19-13.0 W 0004130326 CLEARWIRE SPECTRUM HOLDINGS IIIHouston 02/19/2010 22025.00000 29-56-16.0 N TX NE 095-41-02.3 W 0004130327 CLEARWIRE SPECTRUM HOLDINGS IIISUGARLAND 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296483A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296483A1.txt  
- STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS. 11700.0000 - 12200.0000 MHz 36M0F3F Points of Communication: 1 - ALSAT - (ALSAT) E940443 SES-MOD-20091217-01643 E Date Effective: 02/17/2010 Class of Station: Temporary Fixed Earth Station Grant of Authority 11/04/2004 - 11/04/2019 Application for Modification CRAWFORD MEDIA SERVICES, INC. Nature of Service: Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH "18 FT" 1 4.1 meters ANTENNA ID: 5.5 "OFFSAT" 43.97 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES FROM 64KBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 51K2G7W 72.40 dBW BPSK, QPSK, 8PSK, QAM, FEC RATES 1/2-7/8, VARIOUS DATA RATES TO 45MBPS, VARIOUS INFORMATION. 5925.0000 - 6425.0000 MHz 36M0G7W 72.40 dBW HDTV CARRIER 5925.0000 - 6425.0000 MHz 36M0G2F Points of Communication: 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296634A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296634A1.txt  
- 06063.80000 31-12-24.6 N TX MD WQIU819 094-46-30.3 W 0004133821 San Antonio MTA, L.P. Diboll 02/23/2010 06123.10000 31-12-24.6 N LA MD WQIZ868 090-54-16.7 W 0004135229 Verizon Wireless Personal CommunicationTHIBODAUX 02/24/2010 06315.84000 29-49-22.8 N LA MD WQIZ861 090-42-12.7 W 0004135270 Verizon Wireless Personal CommunicationRaceland 02/24/2010 06345.49000 29-44-42.0 N CA MD WMQ712 118-11-22.3 W 0004135782 Los Angeles SMSA Limited Partnership COMPTON 02/24/2010 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004135782 Los Angeles SMSA Limited Partnership COMPTON 02/24/2010 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004135782 Los Angeles SMSA Limited Partnership COMPTON 02/24/2010 10577.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004135782 Los Angeles SMSA Limited Partnership COMPTON 02/24/2010 10592.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004135782 Los Angeles SMSA Limited Partnership 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296750A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296750A1.txt  
- 22125.00000 41-04-13.4 N NY NE 073-39-33.3 W 0004141548 CLEARWIRE SPECTRUM HOLDINGS IIIPort Chester 03/02/2010 23025.00000 41-00-39.7 N NY NE 073-39-33.3 W 0004141548 CLEARWIRE SPECTRUM HOLDINGS IIIPort Chester 03/02/2010 23175.00000 41-00-39.7 N NY NE 073-49-51.6 W 0004141549 CLEARWIRE SPECTRUM HOLDINGS IIIMt Vernon 03/02/2010 23025.00000 40-55-03.0 N NY NE 073-48-17.9 W 0004141550 CLEARWIRE SPECTRUM HOLDINGS IIIEastchester 03/02/2010 19425.00000 40-58-14.4 N NY NE 073-55-04.1 W 0004141551 CLEARWIRE SPECTRUM HOLDINGS IIIBrooklyn 03/02/2010 23325.00000 40-41-45.6 N NY NE 073-55-04.1 W 0004141551 CLEARWIRE SPECTRUM HOLDINGS IIIBrooklyn 03/02/2010 23475.00000 40-41-45.6 N NY NE 073-56-48.1 W 0004141552 CLEARWIRE SPECTRUM HOLDINGS IIIBrooklyn 03/02/2010 23375.00000 40-37-29.7 N NY NE 073-52-53.9 W 0004141553 CLEARWIRE SPECTRUM HOLDINGS IIIBronx 03/02/2010 23025.00000 40-51-19.6 N Page 43 MG - Microwave Industrial/Business Pool State Purpose Call Sign 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296753A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296753A1.txt  
- 03/04/2010 00928.11875 35-13-01.0 N NM AM WNTW351 106-27-08.1 W 0004135145 New Mexico Gas Company Inc. Albuqueque 03/04/2010 00952.11875 35-13-01.0 N LA AM WJZ54 091-44-58.0 W 0004143347 UNION PACIFIC RAILROAD MELVILLE 03/04/2010 06755.00000 30-41-37.0 N LA AM WJZ54 091-44-58.0 W 0004143347 UNION PACIFIC RAILROAD MELVILLE 03/04/2010 06805.00000 30-41-37.0 N TX MD WQLD717 097-03-53.4 W 0004144597 CLEARWIRE SPECTRUM HOLDINGS IIIGRAPEVINE 03/04/2010 19475.00000 32-55-04.1 N TX MD WQLD717 097-03-53.4 W 0004144597 CLEARWIRE SPECTRUM HOLDINGS IIIGRAPEVINE 03/04/2010 19525.00000 32-55-04.1 N TX MD WQLD717 097-03-53.4 W 0004144597 CLEARWIRE SPECTRUM HOLDINGS IIIGRAPEVINE 03/04/2010 19575.00000 32-55-04.1 N TX MD WQLD717 097-03-53.4 W 0004144597 CLEARWIRE SPECTRUM HOLDINGS IIIGRAPEVINE 03/04/2010 19625.00000 32-55-04.1 N TX MD WQLD717 097-03-53.4 W 0004144597 CLEARWIRE SPECTRUM HOLDINGS IIIGRAPEVINE 03/04/2010 19675.00000 32-55-04.1 N TX MD WQLF328 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296906A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-296906A1.txt  
- 40-53-11.9 N NY MD WQKK499 073-52-18.5 W 0004156217 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23025.00000 40-41-46.9 N NY MD WQKK499 073-52-18.5 W 0004156217 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23075.00000 40-41-46.9 N NY MD WQKK499 073-52-18.5 W 0004156217 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23175.00000 40-41-46.9 N NY MD WQKK498 073-53-16.0 W 0004156220 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23125.00000 40-38-04.1 N NY MD WQKK498 073-53-16.0 W 0004156220 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23175.00000 40-38-04.1 N NY MD WQKK498 073-53-16.0 W 0004156220 Northrop Grumman Systems Corp. Brooklyn 03/10/2010 23225.00000 40-38-04.1 N NY MD WQKJ868 073-44-19.0 W 0004156223 Northrop Grumman Systems Corp. Queens 03/10/2010 21825.00000 40-39-18.9 N NY MD WQKJ868 073-44-19.0 W 0004156223 Northrop Grumman Systems Corp. Queens 03/10/2010 21875.00000 40-39-18.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297038A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297038A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WQKP780 088-00-24.9 W 0004175773 CLEARWIRE SPECTRUM HOLDINGS IIIDOWNERS GROVE 03/17/2010 23125.00000 41-45-55.7 N IL MD WQKP780 088-00-24.9 W 0004175773 CLEARWIRE SPECTRUM HOLDINGS IIIDOWNERS GROVE 03/17/2010 23325.00000 41-45-55.7 N IL MD WQKP780 088-00-24.9 W 0004175773 CLEARWIRE SPECTRUM HOLDINGS IIIDOWNERS GROVE 03/17/2010 23425.00000 41-45-55.7 N IL MD WQLK407 087-56-04.1 W 0004175776 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 03/17/2010 11095.00000 41-45-09.8 N IL MD WQLK407 087-56-04.1 W 0004175776 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 03/17/2010 23075.00000 41-45-09.8 N IL MD WQLK407 087-56-04.1 W 0004175776 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 03/17/2010 23225.00000 41-45-09.8 N IL MD WQLK407 087-56-04.1 W 0004175776 CLEARWIRE SPECTRUM HOLDINGS IIIWillowbrook 03/17/2010 23375.00000 41-45-09.8 N IL MD WQLK407 087-56-04.1 W 0004175776 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297039A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297039A1.txt  
- NC NE 082-33-22.4 W 0004177098 Conterra Ultra Broadband, LLC Mills River 03/18/2010 10995.00000 35-21-46.4 N NC NE 082-33-22.4 W 0004177098 Conterra Ultra Broadband, LLC Mills River 03/18/2010 11035.00000 35-21-46.4 N NC NE 082-29-56.0 W 0004177099 Conterra Ultra Broadband, LLC Hendersonville 03/18/2010 11215.00000 35-23-30.0 N NC NE 082-29-56.0 W 0004177099 Conterra Ultra Broadband, LLC Hendersonville 03/18/2010 11245.00000 35-23-30.0 N NC NE 082-37-04.1 W 0004177100 Conterra Ultra Broadband, LLC Mills River 03/18/2010 10715.00000 35-20-07.8 N SC NE 081-39-54.3 W 0004177101 Conterra Ultra Broadband, LLC Gaffney 03/18/2010 11075.00000 35-04-04.3 N NC NE 080-10-33.2 W 0004177102 Conterra Ultra Broadband, LLC Polkton 03/18/2010 11445.00000 34-59-36.0 N NC NE 079-25-04.7 W 0004177103 Conterra Ultra Broadband, LLC Maxton 03/18/2010 11445.00000 34-40-46.4 N NC NE 079-21-22.8 W 0004177104 Conterra 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297041A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297041A1.txt  
- CONTROL CENTERTANNERSVILLE 03/18/2010 06595.00000 41-02-37.2 N PA MD WPVP281 075-22-10.6 W 0004178320 MONROE COUNTY CONTROL CENTERTANNERSVILLE 03/18/2010 10633.75000 41-02-37.2 N PA MD WPVP281 075-22-10.6 W 0004178320 MONROE COUNTY CONTROL CENTERTANNERSVILLE 03/18/2010 10875.00000 41-02-37.2 N PA MD WPVP281 075-22-10.6 W 0004178320 MONROE COUNTY CONTROL CENTERTANNERSVILLE 03/18/2010 10915.00000 41-02-37.2 N FL MD WQJI385 082-47-41.7 W 0004178825 Pinellas, County of Largo 03/19/2010 06152.75000 27-54-04.1 N FL MD WNES409 082-48-04.3 W 0004178826 Pinellas, County of CLEARWATER 03/19/2010 06404.79000 27-57-43.0 N PA MD KGC59 075-34-15.7 W 0004180132 Penna. Turnpike Comm. LIONVILLE 03/19/2010 05974.85000 40-04-13.3 N PA MD KGC59 075-34-15.7 W 0004180132 Penna. Turnpike Comm. LIONVILLE 03/19/2010 06063.80000 40-04-13.3 N Page 5 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297056A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297056A1.txt  
- - (15 W.L.) E990429 SES-MOD-20100119-00099 E Date Effective: 03/23/2010 Class of Station: Temporary Fixed Earth Station Grant of Authority 12/08/2009 - 12/08/2024 Application for Modification Allen Holdings, Inc. d/b/a Allen Communications Nature of Service: Fixed Satellite Service 0 ° 0 ' 0.00 " N LAT. SITE ID: 1 VARIOUS 0 ° 0 ' 0.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 18FT (OFFSAT) 72.39 dBW DIGITAL CARRIER 5925.0000 - 6425.0000 MHz 8M00G7D 56.10 dBW DIGITAL CARRIER 5925.0000 - 6425.0000 MHz 76K8G7D 72.40 dBW ANALOG, VIDEO/AUDIO 5925.0000 - 6425.0000 MHz 36M0F8F Points of Communication: 1 - ALSAT - (ALSAT) E070153 SES-MOD-20100128-00133 E Date Effective: 03/23/2010 Class of Station: Fixed Earth Stations Grant of Authority 08/28/2007 - 08/28/2022 Application for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297204A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297204A1.txt  
- 06805.00000 30-11-03.2 N CA NE 121-26-40.8 W 0004183825 UNION PACIFIC RAILROAD PARSONS HILL 03/23/2010 06685.00000 36-34-46.9 N CA NE 120-39-16.6 W 0004183826 UNION PACIFIC RAILROAD SAN LUIS OBISPO 03/23/2010 10553.75000 35-16-34.9 N TX NE 103-34-43.6 W 0004183827 UNION PACIFIC RAILROAD STROBEL 03/23/2010 00957.90000 30-23-22.6 N TX NE 103-39-39.7 W 0004183828 UNION PACIFIC RAILROAD ALPINE 03/23/2010 00954.30000 30-21-20.6 N NM NE 107-33-04.1 W 0004183829 UNION PACIFIC RAILROAD CARNE 03/23/2010 00958.20000 32-17-00.3 N LA NE 091-34-07.4 W 0004183830 UNION PACIFIC RAILROAD LIVONIA 03/23/2010 00956.75000 30-32-36.7 N LA NE 091-33-09.4 W 0004183831 UNION PACIFIC RAILROAD LIVONIA 03/23/2010 00956.75000 30-31-32.7 N TX NE 095-22-32.1 W 0004183899 CLEARWIRE SPECTRUM HOLDINGS IIIPearland 03/23/2010 23275.00000 29-32-46.2 N Page 47 MG - Microwave Industrial/Business Pool State Purpose Call Sign 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297205A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297205A1.txt  
- HOLDINGS IIISan Bruno 03/25/2010 19525.00000 37-36-59.9 N CA NE 122-23-06.0 W 0004186861 CLEARWIRE SPECTRUM HOLDINGS IIISan Bruno 03/25/2010 19625.00000 37-36-59.9 N CA NE 122-23-06.0 W 0004186861 CLEARWIRE SPECTRUM HOLDINGS IIISan Bruno 03/25/2010 21925.00000 37-36-59.9 N CA NE 122-23-06.0 W 0004186861 CLEARWIRE SPECTRUM HOLDINGS IIISan Bruno 03/25/2010 22075.00000 37-36-59.9 N CA NE 122-13-19.6 W 0004186863 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 03/25/2010 19375.00000 37-47-04.1 N CA NE 122-13-19.6 W 0004186863 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 03/25/2010 19475.00000 37-47-04.1 N CA NE 122-13-19.6 W 0004186863 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 03/25/2010 19525.00000 37-47-04.1 N CA NE 122-13-19.6 W 0004186863 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 03/25/2010 19625.00000 37-47-04.1 N CA NE 122-32-03.5 W 0004187153 CLEARWIRE SPECTRUM HOLDINGS IIISan Rafael 03/26/2010 17815.00000 37-58-22.1 N CA NE 122-32-03.5 W 0004187153 CLEARWIRE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297206A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297206A1.txt  
- HOLDINGS IIIBaltimore 03/26/2010 18015.00000 39-18-10.3 N MD MD WQKW460 076-34-36.2 W 0004187983 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 18115.00000 39-18-10.3 N MD MD WQKW460 076-34-36.2 W 0004187983 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 21825.00000 39-18-10.3 N MD MD WQLM347 076-29-57.5 W 0004187987 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 23275.00000 39-16-12.2 N MD MD WQKW496 076-36-39.0 W 0004187990 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 18015.00000 39-19-04.1 N MD MD WQKW496 076-36-39.0 W 0004187990 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 18115.00000 39-19-04.1 N MD MD WQKW496 076-36-39.0 W 0004187990 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 23025.00000 39-19-04.1 N MD MD WQKW496 076-36-39.0 W 0004187990 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 23075.00000 39-19-04.1 N MD MD WQKW496 076-36-39.0 W 0004187990 CLEARWIRE SPECTRUM HOLDINGS IIIBaltimore 03/26/2010 23125.00000 39-19-04.1 N MD MD WQKW496 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297269A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297269A2.txt  
- 0.0 0.0 0.0 30.3 69.7 $3,945,605 0.0 0.0 0.0 0.0100.0 1,790,893,162 0.0 0.2 1.5 29.5 68.8 Albania $10,396,947 0.0 0.0 11.0 12.4 76.6 $134,709 0.0 0.0 0.0 0.0100.0 $1,204 0.0 0.0 0.0 0.0100.0 71,484,158 0.0 0.0 12.2 13.9 73.9 Armenia $3,193,530 0.0 0.0 4.9 39.8 55.3 $15,137 0.0 0.0 0.0 2.0 98.0 $966 0.0 0.0 0.0 0.0100.0 56,537,886 0.0 0.0 4.1 36.1 59.7 Azerbaijan $4,302,024 0.0 0.0 1.7 27.7 70.6 $70,540 0.0 0.0 0.0 6.4 93.6 $9,154 0.0 0.0 0.0 36.8 63.2 37,063,226 0.0 0.0 1.9 26.3 71.8 Belarus $15,337,354 0.0 0.0 1.6 21.5 76.9 $103,220 0.0 0.0 0.0 61.4 38.6 $9,175 0.0 0.0 0.0 0.0100.0 84,346,937 0.0 0.0 1.9 22.2 75.9 Bosnia and Herzegovina $8,690,840 0.0 0.0 6.5 16.7 76.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297358A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297358A1.txt  
- 094-16-25.1 W 0004193864 CLEARWIRE SPECTRUM HOLDINGS IIIBlue Springs 04/01/2010 19575.00000 39-01-52.7 N MO MD WQLQ403 094-16-25.1 W 0004193864 CLEARWIRE SPECTRUM HOLDINGS IIIBlue Springs 04/01/2010 19675.00000 39-01-52.7 N MO MD WQLQ403 094-16-25.1 W 0004193864 CLEARWIRE SPECTRUM HOLDINGS IIIBlue Springs 04/01/2010 23125.00000 39-01-52.7 N MO MD WQLQ403 094-16-25.1 W 0004193864 CLEARWIRE SPECTRUM HOLDINGS IIIBlue Springs 04/01/2010 23275.00000 39-01-52.7 N CO MD WNTK432 106-48-04.1 W 0004194168 HOLY CROSS ELECTRIC ASSOCIATIONEAGLE 04/01/2010 11365.00000 39-44-22.9 N TX MD WQGK210 096-49-47.9 W 0004194288 AirCanopy Internet Services Red Oak 04/01/2010 11385.00000 32-28-00.0 N TX MD WQGK210 096-49-47.9 W 0004194288 AirCanopy Internet Services Red Oak 04/01/2010 17880.00000 32-28-00.0 N TX MD WQGK210 096-49-47.9 W 0004194288 AirCanopy Internet Services Red Oak 04/01/2010 17965.00000 32-28-00.0 N TX MD WQGK210 096-49-47.9 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297359A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297359A1.txt  
- KNKN403 093-04-37.0 W 0004197556 Midwest Wireless Communications, L.L.CNerstrand 04/02/2010 44-21-25.0 N MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD AM WQLG656 076-42-00.9 W 0004118458 CLEARWIRE SPECTRUM HOLDINGS IIIOdenton 04/02/2010 22075.00000 39-05-00.8 N AZ MD KOP76 112-33-32.6 W 0004197118 Arizona Public Service Company BUCKEYE 04/02/2010 06034.15000 33-34-04.1 N AZ MD KOP76 112-33-32.6 W 0004197118 Arizona Public Service Company BUCKEYE 04/02/2010 06093.45000 33-34-04.1 N Page 14 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD KOP76 112-33-32.6 W 0004197118 Arizona Public Service Company BUCKEYE 04/02/2010 06645.00000 33-34-04.1 N AZ MD KOP76 112-33-32.6 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297472A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297472A1.txt  
- CLEARWIRE SPECTRUM HOLDINGS IIIFridley 04/07/2010 18115.00000 45-05-46.3 N MN NE 093-15-35.3 W 0004201202 CLEARWIRE SPECTRUM HOLDINGS IIIFridley 04/07/2010 21825.00000 45-05-46.3 N MN NE 093-15-35.3 W 0004201202 CLEARWIRE SPECTRUM HOLDINGS IIIFridley 04/07/2010 21875.00000 45-05-46.3 N MN NE 093-15-35.3 W 0004201202 CLEARWIRE SPECTRUM HOLDINGS IIIFridley 04/07/2010 21975.00000 45-05-46.3 N MN NE 093-13-56.5 W 0004201203 CLEARWIRE SPECTRUM HOLDINGS IIISpring Lake Park 04/07/2010 19425.00000 45-07-04.1 N MN NE 093-13-56.5 W 0004201203 CLEARWIRE SPECTRUM HOLDINGS IIISpring Lake Park 04/07/2010 19525.00000 45-07-04.1 N MN NE 093-13-56.5 W 0004201203 CLEARWIRE SPECTRUM HOLDINGS IIISpring Lake Park 04/07/2010 19625.00000 45-07-04.1 N MN NE 093-02-57.1 W 0004201204 CLEARWIRE SPECTRUM HOLDINGS IIIMaplewood 04/07/2010 17965.00000 45-00-00.4 N MN NE 093-02-57.1 W 0004201204 CLEARWIRE SPECTRUM HOLDINGS IIIMaplewood 04/07/2010 18065.00000 45-00-00.4 N MN NE 093-02-57.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297473A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297473A1.txt  
- N TX MD WQLK834 095-31-08.2 W 0004203611 CLEARWIRE SPECTRUM HOLDINGS IIISpring 04/08/2010 11095.00000 30-01-16.1 N TX MD WQLK834 095-31-08.2 W 0004203611 CLEARWIRE SPECTRUM HOLDINGS IIISpring 04/08/2010 23075.00000 30-01-16.1 N TX MD WQLK834 095-31-08.2 W 0004203611 CLEARWIRE SPECTRUM HOLDINGS IIISpring 04/08/2010 23175.00000 30-01-16.1 N TX MD WQLK834 095-31-08.2 W 0004203611 CLEARWIRE SPECTRUM HOLDINGS IIISpring 04/08/2010 23225.00000 30-01-16.1 N MO MD WQLG935 094-31-04.1 W 0004204936 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 04/09/2010 10975.00000 39-05-40.1 N MO MD WQLG935 094-31-04.1 W 0004204936 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 04/09/2010 11015.00000 39-05-40.1 N MO MD WQLG935 094-31-04.1 W 0004204936 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 04/09/2010 11055.00000 39-05-40.1 N MO MD WQLG935 094-31-04.1 W 0004204936 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 04/09/2010 11095.00000 39-05-40.1 N PA MD WQLI812 076-48-15.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297624A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297624A1.txt  
- 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/15/2010 17765.00000 40-16-02.6 N PA MD WQLI894 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/15/2010 17815.00000 40-16-02.6 N PA MD WQLI894 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/15/2010 17915.00000 40-16-02.6 N PA MD WQLI894 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/15/2010 21925.00000 40-16-02.6 N PA MD WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/15/2010 11225.00000 40-14-41.1 N PA MD WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/15/2010 11305.00000 40-14-41.1 N Page 29 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/15/2010 18015.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297625A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297625A1.txt  
- W 0004215227 CLEARWIRE SPECTRUM HOLDINGS IIIStoneham 04/16/2010 11465.00000 42-29-59.3 N MA NE 071-06-06.8 W 0004215227 CLEARWIRE SPECTRUM HOLDINGS IIIStoneham 04/16/2010 11545.00000 42-29-59.3 N MA NE 071-06-06.8 W 0004215227 CLEARWIRE SPECTRUM HOLDINGS IIIStoneham 04/16/2010 21875.00000 42-29-59.3 N MA NE 071-06-06.8 W 0004215227 CLEARWIRE SPECTRUM HOLDINGS IIIStoneham 04/16/2010 21975.00000 42-29-59.3 N MA NE 071-13-48.7 W 0004215228 CLEARWIRE SPECTRUM HOLDINGS IIIWellesley 04/16/2010 23275.00000 42-19-04.1 N MA NE 071-27-50.0 W 0004215229 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/16/2010 17815.00000 42-17-35.9 N MA NE 071-27-50.0 W 0004215229 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/16/2010 17915.00000 42-17-35.9 N MA NE 071-27-50.0 W 0004215229 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/16/2010 18015.00000 42-17-35.9 N MA NE 071-27-50.0 W 0004215229 CLEARWIRE SPECTRUM HOLDINGS IIIFramingham 04/16/2010 18115.00000 42-17-35.9 N MA NE 071-24-01.0 W 0004215230 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297626A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297626A1.txt  
- applications, subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL AM WQJI385 082-47-41.7 W 0004178825 Pinellas, County of Largo 04/13/2010 06152.75000 27-54-04.1 N FL AM WNES409 082-48-04.3 W 0004178826 Pinellas, County of CLEARWATER 04/13/2010 06404.79000 27-57-43.0 N PA MD WQIA864 078-33-14.0 W 0004206495 BEDFORD COUNTY 911 NA 04/12/2010 11245.00000 40-00-48.3 N PA MD WQIA864 078-33-14.0 W 0004206495 BEDFORD COUNTY 911 NA 04/12/2010 11305.00000 40-00-48.3 N PA MD WQIA864 078-33-14.0 W 0004206495 BEDFORD COUNTY 911 NA 04/12/2010 11465.00000 40-00-48.3 N CA MD KMT32 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297769A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297769A1.txt  
- 17815.00000 40-16-02.6 N PA AM WQLI894 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/20/2010 17915.00000 40-16-02.6 N PA AM WQLI894 076-58-27.9 W 0004212115 CLEARWIRE SPECTRUM HOLDINGS IIIHAMPDEN TOWNS 04/20/2010 21925.00000 40-16-02.6 N Page 12 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA AM WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/20/2010 11225.00000 40-14-41.1 N PA AM WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/20/2010 11305.00000 40-14-41.1 N PA AM WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/20/2010 11345.00000 40-14-41.1 N PA AM WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 04/20/2010 11425.00000 40-14-41.1 N PA AM WQLI892 077-00-04.1 W 0004212116 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297771A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297771A1.txt  
- W 0004221454 CLEARWIRE SPECTRUM HOLDINGS IIIMERRIMACK 04/22/2010 19375.00000 42-47-41.1 N NH NE 071-28-21.1 W 0004221454 CLEARWIRE SPECTRUM HOLDINGS IIIMERRIMACK 04/22/2010 19475.00000 42-47-41.1 N NH NE 071-28-21.1 W 0004221454 CLEARWIRE SPECTRUM HOLDINGS IIIMERRIMACK 04/22/2010 19575.00000 42-47-41.1 N NH NE 071-28-21.1 W 0004221454 CLEARWIRE SPECTRUM HOLDINGS IIIMERRIMACK 04/22/2010 19675.00000 42-47-41.1 N MA NE 070-58-50.5 W 0004221456 CLEARWIRE SPECTRUM HOLDINGS IIILynn 04/22/2010 17815.00000 42-28-04.1 N MA NE 070-58-50.5 W 0004221456 CLEARWIRE SPECTRUM HOLDINGS IIILynn 04/22/2010 17915.00000 42-28-04.1 N MA NE 071-10-20.2 W 0004221457 CLEARWIRE SPECTRUM HOLDINGS IIIArlington 04/22/2010 23175.00000 42-25-16.8 N MA NE 071-10-20.2 W 0004221457 CLEARWIRE SPECTRUM HOLDINGS IIIArlington 04/22/2010 23275.00000 42-25-16.8 N MA NE 071-12-38.5 W 0004221458 CLEARWIRE SPECTRUM HOLDINGS IIILEXINGTON 04/22/2010 10855.00000 42-24-48.4 N MA NE 071-12-38.5 W 0004221458 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297774A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297774A1.txt  
- 11205.00000 33-31-50.9 N AZ MD WBU992 112-03-34.5 W 0004223462 PHOENIX, CITY OF PHOENIX 04/23/2010 06705.00000 33-20-05.2 N NM NE 103-34-00.0 W 0004217442 New Mexico, State of MALJAMAR 04/19/2010 06286.19000 32-42-15.0 N NM NE 103-18-42.0 W 0004217445 New Mexico, State of MALJAMAR 04/19/2010 06034.15000 32-23-50.8 N IL NE 090-44-54.8 W 0004218581 UNITED CUSD 304 MONMOUTH 04/20/2010 10755.00000 40-56-35.1 N IL NE 090-39-04.1 W 0004218600 UNITED CUSD 304 MONMOUTH 04/20/2010 11245.00000 40-55-17.6 N IL NE 090-39-04.1 W 0004218600 UNITED CUSD 304 MONMOUTH 04/20/2010 11325.00000 40-55-17.6 N IL NE 090-35-30.4 W 0004218610 UNITED CUSD 304 MONMOUTH 04/20/2010 10835.00000 40-54-26.9 N NY NE 074-00-06.5 W 0004219670 New York City Police Department New York 04/20/2010 23320.00000 40-42-41.3 N NY NE 074-00-06.5 W 0004219670 New York City 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297986A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-297986A1.txt  
- 10,320 10,298 10,164 9,903 9,943 9,857 11,435 12,337 13,209 13,459 22,296 22,648 21,655 21,713 21,064 21,188 21,640 21,793 22,472 50,311 50,353 50,785 51,016 78,054 78,265 78,310 77,149 76,447 75,939 75,477 75,872 76,185 * Current dollar equivalents are at the end of Table 4 82 Alabama 6.4 Montana 5.7 Alaska 6.0 Nebraska 6.0 Arizona 6.7 Nevada 4.8 Arkansas 5.5 New Hampshire 4.1 California 2.4 New Jersey 4.5 Colorado 4.4 New Mexico 8.5 Connecticut 4.2 New York 3.3 Delaware 5.2 North Carolina 4.6 District Of Columbia 6.3 North Dakota 5.6 Florida 2.8 Ohio 3.9 Georgia 5.7 Oklahoma 5.5 Hawaii 6.2 Oregon 5.1 Idaho 4.9 Pennsylvania 3.4 Illinois 4.5 Rhode Island 5.0 Indiana 5.9 South Carolina 5.1 Iowa 4.3 South Dakota 4.9 Kansas 4.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298239A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298239A1.txt  
- TRINITY 05/10/2010 06715.00000 30-56-37.7 N TX MD WEG985 095-22-24.8 W 0004239139 UNION PACIFIC RAILROAD TRINITY 05/10/2010 06755.00000 30-56-37.7 N TX MD WEG988 095-26-39.0 W 0004239166 UNION PACIFIC RAILROAD PHELPS 05/10/2010 06545.00000 30-41-48.0 N TX MD WEG988 095-26-39.0 W 0004239166 UNION PACIFIC RAILROAD PHELPS 05/10/2010 06595.00000 30-41-48.0 N TX MD WEH321 095-24-00.2 W 0004239213 UNION PACIFIC RAILROAD NEW WAVERLY 05/10/2010 06755.00000 30-32-04.1 N TX MD WEH321 095-24-00.2 W 0004239213 UNION PACIFIC RAILROAD NEW WAVERLY 05/10/2010 06795.00000 30-32-04.1 N OR MD WQIN382 122-31-17.1 W 0004239257 CLEARWIRE SPECTRUM HOLDINGS II CLACKAMAS 05/10/2010 11225.00000 45-22-55.6 N OR MD WQIN382 122-31-17.1 W 0004239257 CLEARWIRE SPECTRUM HOLDINGS II CLACKAMAS 05/10/2010 11305.00000 45-22-55.6 N OR MD WQIN382 122-31-17.1 W 0004239257 CLEARWIRE SPECTRUM HOLDINGS II CLACKAMAS 05/10/2010 11345.00000 45-22-55.6 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298240A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298240A1.txt  
- 05/14/2010 18065.00000 39-05-35.0 N MD AM WQLF887 077-07-26.0 W 0004191533 CLEARWIRE SPECTRUM HOLDINGS IIIEAST ROCKVILLE 05/14/2010 21825.00000 39-05-35.0 N MD AM WQLF887 077-07-26.0 W 0004191533 CLEARWIRE SPECTRUM HOLDINGS IIIEAST ROCKVILLE 05/14/2010 21875.00000 39-05-35.0 N MD AM WQLF887 077-07-26.0 W 0004191533 CLEARWIRE SPECTRUM HOLDINGS IIIEAST ROCKVILLE 05/14/2010 21925.00000 39-05-35.0 N MD AM 077-06-24.8 W 0004197348 CLEARWIRE SPECTRUM HOLDINGS IIIBethesda 05/14/2010 10975.00000 39-01-04.1 N MD AM 077-06-24.8 W 0004197348 CLEARWIRE SPECTRUM HOLDINGS IIIBethesda 05/14/2010 11055.00000 39-01-04.1 N Page 10 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD AM 077-06-24.8 W 0004197348 CLEARWIRE SPECTRUM HOLDINGS IIIBethesda 05/14/2010 23425.00000 39-01-04.1 N MD AM 077-06-24.8 W 0004197348 CLEARWIRE SPECTRUM HOLDINGS IIIBethesda 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298390A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298390A1.txt  
- IIIRancho Cordova 05/18/2010 23225.00000 38-35-08.8 N CA NE 121-30-36.6 W 0004251012 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 23125.00000 38-36-28.4 N CA NE 121-30-36.6 W 0004251012 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 23275.00000 38-36-28.4 N CA NE 121-30-23.4 W 0004251013 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 22175.00000 38-33-00.0 N CA NE 121-30-23.4 W 0004251013 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 22375.00000 38-33-00.0 N CA NE 121-29-04.1 W 0004251014 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 18015.00000 38-36-56.4 N CA NE 121-29-04.1 W 0004251014 CLEARWIRE SPECTRUM HOLDINGS IIISacramento 05/18/2010 18115.00000 38-36-56.4 N CA NE 121-10-05.0 W 0004251091 CLEARWIRE SPECTRUM HOLDINGS IIIFOLSOM 05/18/2010 21875.00000 38-39-34.0 N Page 26 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298838A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298838A1.txt  
- N VA AM BLP01530 S -- W 0004160300 YOUNG BROADCASTING OF RICHMON 06/07/2010 00494.00000 - 00608.00000 -- N VA AM BLP01530 S -- W 0004160300 YOUNG BROADCASTING OF RICHMON 06/07/2010 00614.00000 - 00697.00000 -- N MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO AM WNTK432 106-48-04.1 W 0004194168 HOLY CROSS ELECTRIC ASSOCIATIONEAGLE 06/08/2010 11365.00000 39-44-22.9 N TX AM WQGK210 096-49-47.9 W 0004220600 AirCanopy Internet Services Red Oak 06/09/2010 11385.00000 32-28-00.0 N TX AM WQGK210 096-49-47.9 W 0004220600 AirCanopy Internet Services Red Oak 06/09/2010 17880.00000 32-28-00.0 N TX AM WQGK210 096-49-47.9 W 0004220600 AirCanopy Internet Services Red Oak 06/09/2010 17965.00000 32-28-00.0 N TX AM WQGK210 096-49-47.9 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298840A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298840A1.txt  
- HOLDINGS IIIOLDSMAR 06/11/2010 10855.00000 28-03-25.1 N FL NE 082-26-08.3 W 0004278392 CLEARWIRE SPECTRUM HOLDINGS IIITAMPA 06/11/2010 11225.00000 28-04-06.2 N FL NE 082-26-08.3 W 0004278392 CLEARWIRE SPECTRUM HOLDINGS IIITAMPA 06/11/2010 11265.00000 28-04-06.2 N FL NE 082-26-08.3 W 0004278392 CLEARWIRE SPECTRUM HOLDINGS IIITAMPA 06/11/2010 11305.00000 28-04-06.2 N FL NE 082-26-08.3 W 0004278392 CLEARWIRE SPECTRUM HOLDINGS IIITAMPA 06/11/2010 11385.00000 28-04-06.2 N FL NE 082-31-04.1 W 0004278393 CLEARWIRE SPECTRUM HOLDINGS IIITampa 06/11/2010 19525.00000 28-05-07.0 N FL NE 082-31-04.1 W 0004278393 CLEARWIRE SPECTRUM HOLDINGS IIITampa 06/11/2010 19575.00000 28-05-07.0 N FL NE 082-31-04.1 W 0004278393 CLEARWIRE SPECTRUM HOLDINGS IIITampa 06/11/2010 19625.00000 28-05-07.0 N FL NE 082-31-04.1 W 0004278393 CLEARWIRE SPECTRUM HOLDINGS IIITampa 06/11/2010 19675.00000 28-05-07.0 N FL NE 082-31-04.1 W 0004278393 CLEARWIRE SPECTRUM HOLDINGS IIITampa 06/11/2010 21825.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298933A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298933A1.txt  
- CA MD KNKA584 119-24-20.0 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCMARICOPA 06/15/2010 34-55-12.8 N CA MD KNKA584 119-43-03.4 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCMCKITTRICK 06/15/2010 35-19-33.7 N CA MD KNKA584 119-14-33.4 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCOLD RIVER 06/15/2010 35-17-43.9 N CA MD KNKA584 117-42-00.6 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 06/15/2010 35-28-40.3 N CA MD KNKA584 117-41-04.1 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 06/15/2010 35-32-25.9 N CA MD KNKA584 117-41-13.2 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 06/15/2010 35-37-23.8 N CA MD KNKA584 118-10-16.7 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCRosamond 06/15/2010 34-49-39.0 N CA MD KNKA584 119-16-02.4 W 0004283724 NEW CINGULAR WIRELESS PCS, LLCSHAFTER 06/15/2010 35-32-11.8 N CA MD KNKA584 119-25-54.4 W 0004283724 NEW CINGULAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298935A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-298935A1.txt  
- Latitude City PR MD WPOU285 066-09-54.6 W 0004287138 T-Mobile Puerto Rico LLC LEVITTOWN 06/18/2010 19385.00000 18-26-23.8 N PR MD WPOU285 066-09-54.6 W 0004287138 T-Mobile Puerto Rico LLC LEVITTOWN 06/18/2010 19520.00000 18-26-23.8 N PR MD WPOU285 066-09-54.6 W 0004287138 T-Mobile Puerto Rico LLC LEVITTOWN 06/18/2010 19640.00000 18-26-23.8 N CA MD WMQ712 118-11-22.3 W 0004287142 LOS ANGELES SMSA LIMITED PARTNECOMPTON 06/18/2010 05974.85000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004287142 LOS ANGELES SMSA LIMITED PARTNECOMPTON 06/18/2010 06034.15000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004287142 LOS ANGELES SMSA LIMITED PARTNECOMPTON 06/18/2010 06063.80000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004287142 LOS ANGELES SMSA LIMITED PARTNECOMPTON 06/18/2010 06093.45000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004287142 LOS ANGELES SMSA LIMITED PARTNECOMPTON 06/18/2010 10552.50000 33-53-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299052A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299052A1.txt  
- Federal Communications Commission Local Telephone Competition: Status as of December 31, 2008 28 Zero 17.4% 18.4% 17.7% 17.7% 17.7% 19.4% 18.3% 7.7% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 Ten or More 36.9 35.0 35.3 34.0 33.5 33.1 33.6 44.7 Zero 2.2% 2.4% 2.3% 2.4% 2.4% 2.8% 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299296A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299296A1.txt  
- 28-24-20.0 N FL MD KNKA515 082-44-45.0 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCSt. Petersburg 06/22/2010 27-43-49.0 N FL MD KNKA515 082-40-39.5 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCSt. Petersburg 06/22/2010 27-44-33.5 N FL MD KNKA515 082-43-55.0 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCSt. Petersburg 06/22/2010 27-46-59.0 N FL MD KNKA515 082-39-38.4 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCST. PETERSBURG 06/22/2010 27-46-04.1 N FL MD KNKA515 082-45-05.5 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCTARPON SPRINGS 06/22/2010 28-08-16.6 N FL MD KNKA515 082-43-14.8 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCTIERRA VERDA 06/22/2010 27-41-31.7 N FL MD KNKA515 082-13-35.3 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCVALRICO 06/22/2010 27-53-15.1 N FL MD KNKA515 082-02-39.4 W 0004295233 NEW CINGULAR WIRELESS PCS, LLCWAUCHULA 06/22/2010 27-28-55.8 N Page 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299297A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299297A1.txt  
- 23025.00000 34-01-04.8 N CA MD WQMB718 118-16-40.8 W 0004298860 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 06/25/2010 23225.00000 34-01-04.8 N CA MD WQMB718 118-16-40.8 W 0004298860 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 06/25/2010 23325.00000 34-01-04.8 N CA MD WQMB718 118-16-40.8 W 0004298860 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 06/25/2010 23425.00000 34-01-04.8 N PA MD WQMA654 080-00-20.2 W 0004299067 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/25/2010 19375.00000 40-27-04.1 N PA MD WQMA654 080-00-20.2 W 0004299067 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/25/2010 19475.00000 40-27-04.1 N PA MD WQMA654 080-00-20.2 W 0004299067 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/25/2010 19525.00000 40-27-04.1 N PA MD WQMA654 080-00-20.2 W 0004299067 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 06/25/2010 19575.00000 40-27-04.1 N Page 40 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299557A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299557A1.txt  
- W 0004302337 New Cingular Wireless PCS, LLC BROCKPORT 06/29/2010 41-15-42.9 N PA MD KNKQ442 078-14-19.0 W 0004302337 New Cingular Wireless PCS, LLC Emporium 06/29/2010 41-31-03.7 N PA MD KNKQ442 078-47-46.6 W 0004302337 New Cingular Wireless PCS, LLC KANE 06/29/2010 41-39-30.5 N PA MD KNKQ442 078-42-30.0 W 0004302337 New Cingular Wireless PCS, LLC Lewis Run 06/29/2010 41-48-48.0 N PA MD KNKQ442 078-41-04.1 W 0004302337 New Cingular Wireless PCS, LLC Ridgway 06/29/2010 41-22-46.0 N PA MD KNKQ442 078-33-12.0 W 0004302337 New Cingular Wireless PCS, LLC Saint Mary's 06/29/2010 41-23-37.6 N PA MD KNKQ442 078-32-30.1 W 0004302337 New Cingular Wireless PCS, LLC SAINT MARY'S 06/29/2010 41-21-19.2 N PA MD KNKQ442 078-26-19.9 W 0004302337 New Cingular Wireless PCS, LLC Smethport 06/29/2010 41-48-51.2 N PA MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299558A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299558A1.txt  
- 17915.00000 36-00-54.0 N NC MD WQEM513 079-51-58.9 W 0004302114 Clearwire Spectrum Holdings, LLC Greensboro 06/29/2010 21925.00000 36-00-54.0 N NC MD WQEM513 079-51-58.9 W 0004302114 Clearwire Spectrum Holdings, LLC Greensboro 06/29/2010 22125.00000 36-00-54.0 N NC MD WQEM513 079-51-58.9 W 0004302114 Clearwire Spectrum Holdings, LLC Greensboro 06/29/2010 22225.00000 36-00-54.0 N NC MD WQLA995 079-47-35.5 W 0004302117 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 06/29/2010 21825.00000 36-09-04.1 N NC MD WQLA995 079-47-35.5 W 0004302117 CLEARWIRE SPECTRUM HOLDINGS IIIGreensboro 06/29/2010 22075.00000 36-09-04.1 N NC MD WQLG944 078-36-00.0 W 0004302120 CLEARWIRE SPECTRUM HOLDINGS IIIGARNER 06/29/2010 19375.00000 35-45-06.0 N NC MD WQLG944 078-36-00.0 W 0004302120 CLEARWIRE SPECTRUM HOLDINGS IIIGARNER 06/29/2010 19475.00000 35-45-06.0 N NC MD WQLG944 078-36-00.0 W 0004302120 CLEARWIRE SPECTRUM HOLDINGS IIIGARNER 06/29/2010 23025.00000 35-45-06.0 N NC MD WQLG944 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299735A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299735A1.txt  
- WLT475 118-08-42.3 W 0004252901 Los Angeles SMSA Limited Partnership PALMDALE 07/08/2010 11155.00000 34-31-47.0 N CA AM WLT475 118-08-42.3 W 0004252901 Los Angeles SMSA Limited Partnership PALMDALE 07/08/2010 11187.50000 34-31-47.0 N CA AM WLT475 118-08-42.3 W 0004252901 Los Angeles SMSA Limited Partnership PALMDALE 07/08/2010 19560.00000 34-31-47.0 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 07/07/2010 05974.85000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 07/07/2010 06034.15000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 07/07/2010 06063.80000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 07/07/2010 06093.45000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299965A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299965A1.txt  
- SMSA LIMITED PARTGEARY 07/13/2010 35-35-31.8 N OK MD KNKA296 097-11-33.2 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTLUTHER 07/13/2010 35-38-42.7 N OK MD KNKA296 097-06-59.1 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTMCLOUD 07/13/2010 35-25-57.2 N OK MD KNKA296 097-47-43.7 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTMUSTANG 07/13/2010 35-24-48.6 N OK MD KNKA296 097-35-39.3 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTNewcastle 07/13/2010 35-14-04.1 N OK MD KNKA296 097-40-06.2 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTNEWCASTLE 07/13/2010 35-16-23.5 N Page 17 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OK MD KNKA296 097-16-56.1 W 0004321482 OKLAHOMA CITY SMSA LIMITED PARTNorman 07/13/2010 35-11-47.5 N OK MD KNKA296 097-10-19.4 W 0004321482 OKLAHOMA CITY SMSA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299967A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-299967A1.txt  
- 07/14/2010 00469.73750 RM WRP313 A 0004323272 ACTION OF MEDFORD INC 07/14/2010 00469.86250 OR RM WRP313 122-29-34.1 W 0004323272 ACTION OF MEDFORD INC LINCOLN 07/14/2010 00461.07500 42-11-53.5 N OR RM WRP313 122-29-34.1 W 0004323272 ACTION OF MEDFORD INC LINCOLN 07/14/2010 00461.52500 42-11-53.5 N OR RM WRP313 122-29-34.1 W 0004323272 ACTION OF MEDFORD INC LINCOLN 07/14/2010 00461.92500 42-11-53.5 N OR RM WRP313 122-45-04.1 W 0004323272 ACTION OF MEDFORD INC MEDFORD 07/14/2010 00461.07500 42-17-42.5 N OR RM WRP313 122-45-04.1 W 0004323272 ACTION OF MEDFORD INC MEDFORD 07/14/2010 00461.52500 42-17-42.5 N OR RM WRP313 122-45-04.1 W 0004323272 ACTION OF MEDFORD INC MEDFORD 07/14/2010 00461.92500 42-17-42.5 N OR RM WRP313 122-52-48.1 W 0004323272 ACTION OF MEDFORD INC MEDFORD 07/14/2010 00461.07500 42-20-00.5 N OR RM WRP313 122-52-48.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300057A1.pdf  
- (JA __) (while Study 6 provides "evidence consistent with overall trends and patterns for the period of time that it studies," it "may not represent the behavior of all news outlets all the time"); id.n.147 (JA __) ("the author of Study 6 acknowledges the limitations of his data"); id.n.151 (JA __) (noting "the limitations of the data" used by Study 4.1). Given gaps in the data, the Commission reasoned that case-by-case review would permit "a more fully informed assessment" of how a given transaction would affect local news coverage in a specific market.Id.¶46 (JA __). 14 NAA argues that "at the very least," the Commission should have categorically authorized "combinations in all markets in which a sufficiently `robust number of diverse 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300379A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300379A1.txt  
- WIRELESS PCS, LLCRIFLE 07/20/2010 39-30-46.7 N Page 12 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO MD KNKN453 106-19-08.1 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCSalida 07/20/2010 38-29-46.5 N CO MD KNKN453 105-53-58.0 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCSILVER PLUME 07/20/2010 39-40-48.5 N CO MD KNKN453 106-04-04.1 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCSILVERTHORNE 07/20/2010 39-36-50.0 N CO MD KNKN453 106-57-26.7 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCSnowmass 07/20/2010 39-12-18.7 N CO MD KNKN453 106-57-32.2 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCSNOWMASS 07/20/2010 39-18-58.2 N CO MD KNKN453 106-21-32.0 W 0004329125 NEW CINGULAR WIRELESS PCS, LLCVail 07/20/2010 39-36-19.5 N CO MD KNKN453 106-23-20.1 W 0004329125 NEW CINGULAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300671A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300671A1.txt  
- IIILos Gatos 07/26/2010 21925.00000 37-14-22.9 N CA NE 121-55-15.5 W 0004335154 CLEARWIRE SPECTRUM HOLDINGS IIILos Gatos 07/26/2010 22075.00000 37-14-22.9 N CA NE 121-50-30.9 W 0004335155 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 17765.00000 37-20-19.7 N CA NE 121-50-30.9 W 0004335155 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 17865.00000 37-20-19.7 N CA NE 121-51-00.9 W 0004335156 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 17815.00000 37-19-04.1 N CA NE 121-51-00.9 W 0004335156 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 17915.00000 37-19-04.1 N CA NE 121-54-29.4 W 0004335158 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 21875.00000 37-21-52.8 N CA NE 121-54-29.4 W 0004335158 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 07/26/2010 22025.00000 37-21-52.8 N PA NE 077-11-18.2 W 0004335279 Netrepid, Inc. Carlisle 07/26/2010 19425.00000 40-12-03.4 N PA NE 077-11-18.2 W 0004335279 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300673A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300673A1.txt  
- 0004338786 BAKER COLLEGE CADILLAC 07/29/2010 10755.00000 44-14-56.0 N MI NE 085-18-48.0 W 0004338786 BAKER COLLEGE CADILLAC 07/29/2010 10795.00000 44-14-56.0 N Page 13 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MI NE 085-12-57.3 W 0004338787 BAKER COLLEGE LAKE CITY 07/29/2010 11245.00000 44-16-10.6 N MI NE 085-23-04.1 W 0004338788 BAKER COLLEGE Cadillac 07/29/2010 11285.00000 44-15-58.6 N MN NE 095-11-55.6 W 0004338956 Minnesota, State of Jeffers 07/29/2010 06595.00000 44-03-10.5 N CA NE 117-11-01.7 W 0004338991 Riverside, County of TEMECULA 07/29/2010 10557.50000 33-28-51.7 N CA NE 117-11-01.7 W 0004338991 Riverside, County of TEMECULA 07/29/2010 10657.50000 33-28-51.7 N CA NE 117-16-21.3 W 0004338992 Riverside, County of TEMECULA 07/29/2010 10622.50000 33-26-57.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300783A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300783A1.txt  
- MN NE 092-06-16.0 W 0004341263 Nextera Communications Duluth 08/02/2010 18065.00000 46-47-03.0 N MN NE 092-06-54.0 W 0004341311 Nextera Communications Duluth 08/02/2010 19525.00000 46-47-14.2 N MN NE 092-06-54.0 W 0004341311 Nextera Communications Duluth 08/02/2010 19625.00000 46-47-14.2 N LA NE 091-54-33.2 W 0004342289 Acadiana Cellular General Partnership Palmetto 08/03/2010 06226.89000 30-47-40.1 N CO NE 104-17-06.3 W 0004342347 Qwest Corporation Pueblo 08/03/2010 11235.00000 38-26-04.1 N CO NE 104-33-39.9 W 0004342615 Qwest Corporation Pueblo 08/03/2010 10745.00000 38-22-21.9 N ME NE 067-51-04.1 W 0004342848 MAINE RSA #1, INC. Limestone 08/03/2010 06595.00000 46-54-48.9 N GA NE 083-22-19.9 W 0004342963 Conterra Ultra Broadband LLC Athens 08/03/2010 11285.00000 33-56-35.8 N GA NE 083-22-19.9 W 0004342963 Conterra Ultra Broadband LLC Athens 08/03/2010 11365.00000 33-56-35.8 N GA NE 083-24-14.5 W 0004342965 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300784A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300784A1.txt  
- 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MA NE 070-03-53.0 W 0004345131 Nantucket Memorial Airport CommissionNantucket 08/05/2010 00122.95000 41-15-39.7 N IA NE 091-08-54.1 W 0004345183 City of Muscatine Mucatine 08/05/2010 00122.70000 41-22-04.1 N MN NE 092-59-19.1 W 0004345405 City of Forest Lake, MN Forest Lake 08/05/2010 00122.70000 45-14-46.5 N SC NE 081-03-40.2 W 0004345634 Rock Hill, City of Rock Hill 08/05/2010 00123.05000 34-59-13.5 N AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD WHY286 111-59-06.0 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300946A7.txt  
- Service................................................................11 3.5 RECOMMENDATIONS FOR IMPLEMENTING REGIONAL PSAPS.............................................................................12 3.5.1 Criteria for Determining Proposed Regional PSAPs in Oklahoma...................................................12 3.5.2 PSAP Regionalization Example: South West Oklahoma Regional 9- 1-1 Association.....................13 3.5.3 Proposed Regi onal PSAPs........................................................................................................ ......16 3.5.4 Regional PSAPs Map............................................................................................................. .........20 3.5.5 Oklahoma E9-1-1 Implement ation/Upgrade Summary....................................................................21 3.5.6 High-Level Tasks for Regionalizing and Im plementing E9-1-1........................................................29 4. OTHER E9-1-1 ISSUES AND RECOMMENDATIONS........................................................................................ 31 4.1 E9-1-1 AND THE AMERICANS WITH DISABILITIES ACT (ADA)..............................................................................31 4.2 E9-1-1 AND MULTI-LINE TELEPHONE SYSTEMS (MLTS)....................................................................................31 4.3 E9-1-1 AND THE OKLAHOMA HIGHWAY PATROL FIELD TROOP COMMUNICATION CENTERS.................................33 4.4 E9-1-1 IN RELATION TO DEPARTMENT OF HOMELAND SECURITY PROGRAMS .....................................................34 4.4.1 Radio Intero perability......................................................................................................... ..............34 4.4.2 Next Generation 9-1-1 (NG9-1-1)....................................................................................................34 4.4.3 Evolution to a Next Generation 9-1-1 Syst em.................................................................................35 4.4.4 Next Generation 9-1-1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300962A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-300962A1.txt  
- 06345.49000 43-14-44.4 N ID AM 114-40-46.3 W 0004275673 ID Holding, LLC GOODING 08/12/2010 06585.00000 43-14-44.4 N CA AM WMQ711 118-08-23.2 W 0004286449 LOS ANGELES SMSA LIMITED PARTNEDOWNEY 08/13/2010 10617.50000 33-56-35.1 N CA AM WMQ711 118-08-23.2 W 0004286449 LOS ANGELES SMSA LIMITED PARTNEDOWNEY 08/13/2010 11565.00000 33-56-35.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 08/13/2010 05974.85000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 08/13/2010 06034.15000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 08/13/2010 06063.80000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 08/13/2010 06093.45000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301113A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301113A1.txt  
- MD KNKN727 100-36-06.4 W 0004354085 New Cingular Wireless PCS, LLC ROCKSPRINGS 08/16/2010 30-07-40.9 N TX MD KNKN727 100-37-18.3 W 0004354085 New Cingular Wireless PCS, LLC SONORA 08/16/2010 30-33-22.3 N OR MD KNKA722 122-35-56.8 W 0004354806 Medford Cellular Telephone Company, IncASHLAND 08/16/2010 42-03-05.3 N OR MD KNKA722 122-28-43.9 W 0004354806 Medford Cellular Telephone Company, IncASHLAND 08/16/2010 42-03-53.0 N OR MD KNKA722 123--04.1 W 0004354806 Medford Cellular Telephone Company, IncBLACKWELL 08/16/2010 42-25-40.4 N OR MD KNKA722 122-50-01.3 W 0004354806 Medford Cellular Telephone Company, IncEagle Point 08/16/2010 42-29-38.2 N OR MD KNKA722 123-00-25.2 W 0004354806 Medford Cellular Telephone Company, IncJacksonville 08/16/2010 42-17-09.4 N OR MD KNKA722 122-22-54.1 W 0004354806 Medford Cellular Telephone Company, IncMedford 08/16/2010 42-21-51.5 N OR MD KNKA722 123-00-19.5 W 0004354806 Medford 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301116A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301116A1.txt  
- IIIEnfield 08/20/2010 11095.00000 41-57-57.3 N CT NE 072-33-09.7 W 0004359631 CLEARWIRE SPECTRUM HOLDINGS IIIEnfield 08/20/2010 11135.00000 41-57-57.3 N CT NE 072-33-09.7 W 0004359631 CLEARWIRE SPECTRUM HOLDINGS IIIEnfield 08/20/2010 11175.00000 41-57-57.3 N PA NE 078-32-00.7 W 0004359925 Open Range Communications SAINT MARYS 08/20/2010 19330.00000 41-26-19.0 N PA NE 076-00-58.9 W 0004359928 Open Range Communications Nanticoke 08/20/2010 10875.00000 41-12-27.7 N PA NE 078-41-04.1 W 0004359932 Open Range Communications Ridgeway 08/20/2010 10715.00000 41-22-46.0 N PA NE 076-36-42.9 W 0004359937 Open Range Communications Elizabethtown 08/20/2010 11245.00000 40-09-02.2 N PA NE 078-57-25.3 W 0004359941 Open Range Communications JOHNSTOWN 08/20/2010 21830.00000 40-19-15.7 N PA NE 075-43-54.1 W 0004359946 Open Range Communications Taylor 08/20/2010 19330.00000 41-23-27.1 N PA NE 075-42-03.6 W 0004359947 Open Range Communications Scranton 08/20/2010 21830.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301228A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301228A1.txt  
- PCS, LLCRagley 08/23/2010 30-31-38.7 N LA MD KNKN803 093-00-37.4 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCSugartown 08/23/2010 30-46-06.6 N LA MD KNKN803 093-39-35.4 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCVinton 08/23/2010 30-08-36.3 N LA MD KNKN803 092-47-58.5 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCWELSH 08/23/2010 30-14-18.7 N CA MD KNKA692 121-27-47.2 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 08/24/2010 39-39-04.1 N CA MD KNKA692 121-27-46.9 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCBLOOMER MOUNT 08/24/2010 39-39-03.0 N CA MD KNKA692 121-51-23.7 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCChico 08/24/2010 39-38-30.1 N CA MD KNKA692 121-40-43.9 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 08/24/2010 39-47-01.6 N CA MD KNKA692 121-57-09.4 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 08/24/2010 39-51-09.0 N CA MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301229A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301229A1.txt  
- VA AM KNKN662 077-27-24.9 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCFREDERICKSBURG 08/27/2010 38-18-01.5 N VA AM KNKN662 078-10-37.4 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCGordonsville 08/27/2010 38-08-06.3 N VA AM KNKN662 077-54-49.6 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCJEFFERSONTON 08/27/2010 38-40-51.0 N VA AM KNKN662 077-47-07.0 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCLOCUST GROVE 08/27/2010 38-18-04.5 N VA AM KNKN662 078-28-04.1 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCLURAY 08/27/2010 38-41-09.8 N VA AM KNKN662 078-17-48.6 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCMadison 08/27/2010 38-23-42.9 N VA AM KNKN662 077-55-26.5 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCMineral 08/27/2010 38-02-13.8 N VA AM KNKN662 078-07-14.0 W 0004298532 NEW CINGULAR WIRELESS PCS, LLCORANGE 08/27/2010 38-13-52.0 N VA AM KNKN662 077-39-32.3 W 0004298532 NEW CINGULAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301230A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301230A1.txt  
- W 0004363977 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 11385.00000 25-57-00.3 N FL NE 080-11-24.3 W 0004363977 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 17815.00000 25-57-00.3 N FL NE 080-21-09.3 W 0004363979 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 17765.00000 25-46-26.5 N FL NE 080-21-09.3 W 0004363979 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 17865.00000 25-46-26.5 N FL NE 080-25-03.5 W 0004363980 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 19325.00000 25-46-04.1 N FL NE 080-08-31.2 W 0004363982 CLEARWIRE SPECTRUM HOLDINGS IIIAventura 08/25/2010 19475.00000 25-58-10.3 N FL NE 080-08-31.2 W 0004363982 CLEARWIRE SPECTRUM HOLDINGS IIIAventura 08/25/2010 21225.00000 25-58-10.3 N FL NE 080-21-59.0 W 0004363984 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 10815.00000 25-41-11.4 N FL NE 080-21-59.0 W 0004363984 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 08/25/2010 10935.00000 25-41-11.4 N FL NE 080-21-59.0 W 0004363984 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301233A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301233A1.txt  
- NE 084-14-05.6 W 0004368568 CLEARWIRE SPECTRUM HOLDINGS IIIStockbridge 08/27/2010 18065.00000 33-32-36.5 N Page 2 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City GA NE 084-14-05.6 W 0004368568 CLEARWIRE SPECTRUM HOLDINGS IIIStockbridge 08/27/2010 18115.00000 33-32-36.5 N GA NE 084-02-35.8 W 0004368571 CLEARWIRE SPECTRUM HOLDINGS IIICeterville 08/27/2010 11305.00000 33-48-04.1 N GA NE 084-02-35.8 W 0004368571 CLEARWIRE SPECTRUM HOLDINGS IIICeterville 08/27/2010 11385.00000 33-48-04.1 N NV NE 115-16-11.1 W 0004368573 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 08/27/2010 19575.00000 36-09-39.3 N NV NE 115-16-11.1 W 0004368573 CLEARWIRE SPECTRUM HOLDINGS IIILAS VEGAS 08/27/2010 19675.00000 36-09-39.3 N GA NE 084-05-42.0 W 0004368580 CLEARWIRE SPECTRUM HOLDINGS IIILawrenceville 08/27/2010 11305.00000 33-55-01.0 N GA NE 084-05-42.0 W 0004368580 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301294A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301294A1.txt  
- 4,810 4,949 3,564 2,915 572 1,085 1,373 844 U.S. Federal Communications Commission Internet Access Services: Status as of June 30, 2009 10 6 Chart 11 Distribution of Connections by Downstream Speed Selected Technologies as of June 30, 2009 (In thousands) * Includes sDSL, Other Wireline, Satellite, Fixed Wireless, Power Line and Other. aDSL Cable Modem FTTP Mobile Wireless All Other* 4.1 77.7 16.5 2.5 55.8 8.1 33.5 4.1 33.7 11.3 50.4 3.6 34.0 60.0 95.4 4.3 21.5 76.7 11.8 21.3 66.8 Per cen t 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% (a) Greater than 200 kbps and less than 768 kbps (b) At least 768 kbps and less than 1.5 mbps (c) At least 1.5 mbps and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301310A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301310A1.txt  
- U.S. Federal Communications Commission Local Telephone Competition: Status as of June 30, 2009 28 Zero 17.4%18.4%17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 10.1 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 7.9 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 6.1 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 5.4 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 4.6 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 4.0 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 3.4 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 3.1 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 2.6 Ten or More 36.9 35.0 35.3 34.0 33.5 33.1 33.6 44.7 44.0 Zero 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301340A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301340A1.txt  
- PCS, LLCRagley 08/30/2010 30-31-38.7 N LA AM KNKN803 093-00-37.4 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCSugartown 08/30/2010 30-46-06.6 N LA AM KNKN803 093-39-35.4 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCVinton 08/30/2010 30-08-36.3 N LA AM KNKN803 092-47-58.5 W 0004362450 NEW CINGULAR WIRELESS PCS, LLCWELSH 08/30/2010 30-14-18.7 N CA AM KNKA692 121-27-47.2 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 08/31/2010 39-39-04.1 N CA AM KNKA692 121-27-46.9 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCBLOOMER MOUNT 08/31/2010 39-39-03.0 N CA AM KNKA692 121-51-23.7 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCChico 08/31/2010 39-38-30.1 N CA AM KNKA692 121-40-43.9 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 08/31/2010 39-47-01.6 N CA AM KNKA692 121-57-09.4 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 08/31/2010 39-51-09.0 N CA AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301456A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301456A1.txt  
- Spectrum Resources Inc CHAMPAIGN 09/07/2010 00136.97500 40-02-24.1 N UT MD WQDU854 111-53-25.4 W 0004379371 Aviation Spectrum Resources Inc Salt Lake City 09/07/2010 00136.57500 40-48-28.7 N UT MD WQDU854 111-53-25.4 W 0004379371 Aviation Spectrum Resources Inc Salt Lake City 09/07/2010 00136.97500 40-48-28.7 N CA MD WAG8 118-08-41.2 W 0004380413 LOS ANGELES, COUNTY OF LONG BEACH 09/08/2010 00122.97500 33-49-01.1 N GM NE 089-06-04.1 W 0004378341 Aviation Spectrum Resources, Inc Gulf of Mexico 09/07/2010 00131.35000 28-02-02.9 N NJ NE 074-03-39.0 W 0004378343 Aviation Spectrum Resources, Inc Teterboro 09/07/2010 00131.17500 40-51-00.4 N NY NE 075-58-47.0 W 0004378346 Aviation Spectrum Resources, Inc Binghamton 09/07/2010 00129.65000 42-12-30.0 N CA NE 119-43-05.3 W 0004378347 Aviation Spectrum Resources, Inc Fresno 09/07/2010 00130.07500 36-46-34.3 N MS NE 089-04-12.4 W 0004378350 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301505A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301505A1.txt  
- . . . . 201 207 Table 3.3 -U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . 202 208 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2008. . . . . . . . . . . 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301621A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301621A1.txt  
- W 0004392448 New Cingular Wireless PCS, LLC South Royalton 09/17/2010 43-50-08.9 N VT MD KNKN749 072-24-58.3 W 0004392448 New Cingular Wireless PCS, LLC Springfield 09/17/2010 43-18-31.3 N VT MD KNKN749 072-27-45.8 W 0004392448 New Cingular Wireless PCS, LLC SPRINGFIELD 09/17/2010 43-18-54.9 N VT MD KNKN749 072-27-35.3 W 0004392448 New Cingular Wireless PCS, LLC SPRINGFIELD 09/17/2010 43-18-55.3 N VT MD KNKN749 073-15-04.1 W 0004392448 New Cingular Wireless PCS, LLC VERGENNES 09/17/2010 44-10-07.6 N VT MD KNKN749 073-05-05.8 W 0004392448 New Cingular Wireless PCS, LLC W Rutland 09/17/2010 43-37-24.7 N VT MD KNKN749 072-55-20.7 W 0004392448 New Cingular Wireless PCS, LLC West Dover 09/17/2010 42-57-34.3 N VT MD KNKN749 072-45-38.7 W 0004392448 New Cingular Wireless PCS, LLC West Townshend 09/17/2010 43-11-20.3 N Page 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301622A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301622A1.txt  
- PARTNChico 09/14/2010 39-51-08.9 N CA MD KNKA463 121-47-13.9 W 0004389092 SACRAMENTO VALLEY LIMITED PARTNCHICO 09/14/2010 39-43-59.6 N CA MD KNKA463 121-46-57.9 W 0004389092 SACRAMENTO VALLEY LIMITED PARTNNELSON 09/14/2010 39-33-03.6 N WY MD KNKN226 110-58-10.5 W 0004389362 Cellular, Inc. Financial Corporation Millis Quad 09/15/2010 41-14-12.6 N TX MD KNKA258 106-28-14.0 W 0004389620 Dallas MTA, LP 09/15/2010 31-48-57.4 N TX MD KNKA258 106-16-04.1 W 0004389620 Dallas MTA, LP El Paso 09/15/2010 31-42-43.9 N TX MD KNKA258 106-28-18.0 W 0004389620 Dallas MTA, LP EL PASO 09/15/2010 31-45-29.4 N TX MD KNKA258 106-22-12.9 W 0004389620 Dallas MTA, LP EL PASO 09/15/2010 31-46-24.4 N TX MD KNKA258 106-09-47.9 W 0004389620 Dallas MTA, LP FABENS 09/15/2010 31-30-42.4 N FL MD KNKN628 082-53-24.9 W 0004391255 New Cingular Wireless 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301766A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301766A1.txt  
- SPECTRUM HOLDINGS IIIWickliffe 09/21/2010 23025.00000 41-36-44.6 N OH NE 081-28-31.2 W 0004395841 CLEARWIRE SPECTRUM HOLDINGS IIIWickliffe 09/21/2010 23175.00000 41-36-44.6 N CA NE 118-15-52.6 W 0004395947 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 09/21/2010 23025.00000 34-00-33.4 N CA NE 118-15-52.6 W 0004395947 CLEARWIRE SPECTRUM HOLDINGS IIILos Angeles 09/21/2010 23275.00000 34-00-33.4 N OH NE 081-33-22.7 W 0004395960 CLEARWIRE SPECTRUM HOLDINGS IIICleveland Heights 09/21/2010 23275.00000 41-30-04.1 N OH NE 081-38-14.1 W 0004395963 CLEARWIRE SPECTRUM HOLDINGS IIICleveland 09/21/2010 19375.00000 41-30-55.2 N OH NE 081-38-14.1 W 0004395963 CLEARWIRE SPECTRUM HOLDINGS IIICleveland 09/21/2010 19475.00000 41-30-55.2 N OH NE 081-48-31.3 W 0004395965 CLEARWIRE SPECTRUM HOLDINGS IIIMiddleburg Hts 09/21/2010 23125.00000 41-21-08.6 N OH NE 081-43-59.5 W 0004395969 CLEARWIRE SPECTRUM HOLDINGS IIICleveland 09/21/2010 19525.00000 41-27-47.5 N OH NE 081-43-59.5 W 0004395969 CLEARWIRE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301769A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301769A1.txt  
- 40-08-37.7 N OH NE 083-00-02.0 W 0004399860 CLEARWIRE SPECTRUM HOLDINGS IIILewis Center 09/24/2010 17815.00000 40-08-37.7 N OH NE 083-00-02.0 W 0004399860 CLEARWIRE SPECTRUM HOLDINGS IIILewis Center 09/24/2010 17915.00000 40-08-37.7 N OH NE 083-00-02.0 W 0004399860 CLEARWIRE SPECTRUM HOLDINGS IIILewis Center 09/24/2010 18015.00000 40-08-37.7 N OH NE 083-00-02.0 W 0004399860 CLEARWIRE SPECTRUM HOLDINGS IIILewis Center 09/24/2010 18115.00000 40-08-37.7 N OH NE 082-55-04.1 W 0004399861 CLEARWIRE SPECTRUM HOLDINGS IIIWesterville 09/24/2010 10855.00000 40-08-51.0 N OH NE 082-55-04.1 W 0004399861 CLEARWIRE SPECTRUM HOLDINGS IIIWesterville 09/24/2010 10935.00000 40-08-51.0 N OH NE 082-55-04.1 W 0004399861 CLEARWIRE SPECTRUM HOLDINGS IIIWesterville 09/24/2010 10975.00000 40-08-51.0 N OH NE 082-55-04.1 W 0004399861 CLEARWIRE SPECTRUM HOLDINGS IIIWesterville 09/24/2010 11095.00000 40-08-51.0 N OH NE 082-55-04.1 W 0004399861 CLEARWIRE SPECTRUM HOLDINGS IIIWesterville 09/24/2010 23075.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301823A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301823A1.txt  
- Consumer Expenditures.......................................................................................3-1 Table 3.1Household Expenditures for Telephone Service................................................3-3 Table 3.2Average Monthly Household Telecommunications Expenditures by Type of Provider.............................................................................................3-4 Table 3.3Personal Consumption Expenditures.............................................................3-5 Table 3.4Personal Consumption Expenditures Per Household Per Month..............................3-6 Chart 3.1Personal Consumption Expenditures for Telephone Service and Internet Access.........3-7 Chart 3.2Monthly Personal Consumption Expenditures for Telephone Service per Household......3-7 Introduction.................................................................................................... Access Charges................................................................................................ Advanced Telecommunications.............................................................................. i Earnings ....................................................................................................... 4-1 Table 4.1Interstate Rate of Return Summary: Years 2000 through 2008 ..............................4-3 Employment and Labor Productivity ................................................................... 5-1 Table 5.1Average Number of Employees in the Telecommunications Industry ..................... 5-3 Chart 5.1Average Number of Employees in the Telecommunications Industry ........................5-3 Table 5.2Labor Productivity Index for the Wired and Wireless Telecommunications Industry .....................................................................5-4 Chart 5.2Wired and Wireless Telecommunications Carriers (NAICS 5171 and 5172) Labor Productivity 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301884A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301884A2.pdf  
- of Sprout: TWC, DIRECTV, DISH, Cox, Charter, Cablevision, Bright House, Mediacom, CableOne, Wide Open West, RCN, Verizon and AT&T. Describe in detail any plans the Company's has to deploy broadband service to unserved and/or underserved areas. . Also provide the number of visitors to that website that were redirected to the Company's website during the dispute. With regard to Exhibits 4.1(a)-4.7(g) submitted in response to the May 21, 2010 Information and Discovery Request, provide all available data from June 2005 through the most recent date for which data is available. Also, provide this data at the zip code, sub region, entity and DMA level of specificity, as available. In addition, with regard to Exhibit 3.2, provide the Comcast entity identification number 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301909A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301909A1.txt  
- W 0004302337 New Cingular Wireless PCS, LLC BROCKPORT 09/29/2010 41-15-42.9 N PA AM KNKQ442 078-14-19.0 W 0004302337 New Cingular Wireless PCS, LLC Emporium 09/29/2010 41-31-03.7 N PA AM KNKQ442 078-47-46.6 W 0004302337 New Cingular Wireless PCS, LLC KANE 09/29/2010 41-39-30.5 N PA AM KNKQ442 078-42-28.2 W 0004302337 New Cingular Wireless PCS, LLC Lewis Run 09/29/2010 41-48-47.8 N PA AM KNKQ442 078-41-04.1 W 0004302337 New Cingular Wireless PCS, LLC Ridgway 09/29/2010 41-22-46.0 N PA AM KNKQ442 078-33-12.0 W 0004302337 New Cingular Wireless PCS, LLC Saint Mary's 09/29/2010 41-23-37.6 N PA AM KNKQ442 078-32-30.1 W 0004302337 New Cingular Wireless PCS, LLC SAINT MARY'S 09/29/2010 41-21-19.2 N PA AM KNKQ442 078-26-19.9 W 0004302337 New Cingular Wireless PCS, LLC Smethport 09/29/2010 41-48-51.2 N PA AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301910A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301910A1.txt  
- 0004286983 LOS ANGELES SMSA LIMITED PARTNESANTA FE SPRING 09/29/2010 19600.00000 33-54-16.0 N CA AM WLT431 118-02-27.0 W 0004286983 LOS ANGELES SMSA LIMITED PARTNESANTA FE SPRING 09/29/2010 19640.00000 33-54-16.0 N CA AM WLT431 118-02-27.0 W 0004286983 LOS ANGELES SMSA LIMITED PARTNESANTA FE SPRING 09/29/2010 19690.00000 33-54-16.0 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 09/29/2010 05974.85000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 09/29/2010 06034.15000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 09/29/2010 06063.80000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership COMPTON 09/29/2010 06093.45000 33-53-04.1 N CA AM WMQ712 118-11-22.3 W 0004287142 Los Angeles SMSA Limited Partnership 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301912A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301912A1.txt  
- WATER AGENSACRAMENTO 09/30/2010 00941.48125 38-25-21.6 N CA MD WNTY733 121-23-36.8 W 0004407052 SACRAMENTO COUNTY WATER AGENSACRAMENTO 09/30/2010 00952.06875 38-25-21.6 N MD MD WQJK565 076-43-08.2 W 0004407160 Prince George's County, Maryland Office oBowie 09/30/2010 21820.00000 38-57-37.3 N TX NE 098-13-32.7 W 0004402100 Cibolo, Police Department Cibolo 09/27/2010 17765.00000 29-33-41.3 N TX NE 098-14-47.1 W 0004402101 Cibolo, Police Department Cibolo 09/27/2010 19325.00000 29-35-04.1 N VA NE 077-33-13.1 W 0004402401 Loudoun County, Virginia Leesburg 09/27/2010 17765.00000 39-05-00.0 N VA NE 077-33-13.1 W 0004402401 Loudoun County, Virginia Leesburg 09/27/2010 17865.00000 39-05-00.0 N VA NE 077-33-13.1 W 0004402401 Loudoun County, Virginia Leesburg 09/27/2010 17965.00000 39-05-00.0 N VA NE 077-33-13.1 W 0004402401 Loudoun County, Virginia Leesburg 09/27/2010 18065.00000 39-05-00.0 N VA NE 077-34-14.4 W 0004402429 Loudoun County, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301937A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-301937A1.txt  
- 5925.0000 - 6425.0000 MHz 36M0G7W 72.10 dBW Digital Data 5925.0000 - 6425.0000 MHz 800KG7W Digital TT&C 3700.0000 - 4200.0000 MHz 36M0G7W Digital Data 3700.0000 - 4200.0000 MHz 800KG7W Points of Communication: WBES-IS1R - ALSAT - (ALSAT) E950212 SES-MOD-20100930-01238 E Class of Station: Fixed Earth Stations Application for Modification ABS-CBN International, Inc. Nature of Service: Fixed Satellite Service "MOD" to remove 4.1 Meter Andrew antenna. 37 ° 54 ' 17.00 " N LAT. SITE ID: 1 2301 COLUMBIA BLVD., CONTRA COSTA, RICHMOND, CA 122 ° 18 ' 56.00 " W LONG. LOCATION: VERTEX 6.1M 6.1 meters ANTENNA ID: 6.1M KPK 54.65 dBW QPSK, 8PSK, DIGITAL DATA 14000.0000 - 14500.0000 MHz 54K6G7W 76.82 dBW SINGLE CHAN/CARRIER DIGITAL VIDEO/AUDIO 14000.0000 - 14500.0000 MHz 9M00G1F 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302270A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302270A1.txt  
- 41-04-20.5 N VA NE 077-31-13.8 W 0004418482 Telecom Transport Management, Inc. Richmond 10/12/2010 22680.00000 37-37-05.5 N NE NE 102-57-36.3 W 0004418949 NE Colorado Cellular, Inc. Sidney 10/13/2010 11285.00000 41-07-36.3 N NC NE 082-41-48.8 W 0004419303 NORTH CAROLINA RSA 1 PARTNERSHBrevard 10/13/2010 11245.00000 35-16-33.3 N VA NE 077-26-30.5 W 0004419439 Telecom Transport Management, Inc. Richmond 10/13/2010 22760.00000 37-32-35.2 N VA NE 077-25-04.1 W 0004419728 Telecom Transport Management, Inc. Richmond 10/13/2010 23430.00000 37-31-54.1 N LA NE 092-09-22.5 W 0004419917 DETEL Wireless LLC Effie 10/13/2010 10775.00000 31-12-56.6 N LA NE 092-08-45.4 W 0004419950 DETEL Wireless LLC Bunkie 10/13/2010 19475.00000 31-00-23.9 N MN NE 093-15-29.0 W 0004423572 Telecom Transport Management, Inc. Burnsville 10/15/2010 21475.00000 44-45-34.0 N RO WPQW574 0004417774 T-Mobile License LLC 10/12/2010 RO WPQW575 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302271A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302271A1.txt  
- HOLDINGS IIIOakland 10/13/2010 23175.00000 37-45-08.3 N CA MD WQLY422 122-11-21.6 W 0004419238 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 23275.00000 37-45-08.3 N CA MD WQLY338 121-57-32.9 W 0004419240 CLEARWIRE SPECTRUM HOLDINGS IIIDanville 10/13/2010 18015.00000 37-49-52.8 N CA MD WQLY338 121-57-32.9 W 0004419240 CLEARWIRE SPECTRUM HOLDINGS IIIDanville 10/13/2010 18115.00000 37-49-52.8 N CA MD WQLY417 122-13-19.6 W 0004419241 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 19375.00000 37-47-04.1 N CA MD WQLY417 122-13-19.6 W 0004419241 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 19475.00000 37-47-04.1 N CA MD WQLY417 122-13-19.6 W 0004419241 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 19525.00000 37-47-04.1 N CA MD WQLY417 122-13-19.6 W 0004419241 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 19625.00000 37-47-04.1 N CA MD WQLY417 122-13-19.6 W 0004419241 CLEARWIRE SPECTRUM HOLDINGS IIIOakland 10/13/2010 21875.00000 37-47-04.1 N CA MD WQLY417 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302272A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302272A1.txt  
- Inc. YIGO 10/15/2010 11525.00000 13-32-19.0 N PA MD WQLI833 076-47-01.2 W 0004423476 CLEARWIRE SPECTRUM HOLDINGS IIIHarrisburg 10/15/2010 17865.00000 40-17-27.2 N PA MD WQLI833 076-47-01.2 W 0004423476 CLEARWIRE SPECTRUM HOLDINGS IIIHarrisburg 10/15/2010 21875.00000 40-17-27.2 N PA MD WQLI833 076-47-01.2 W 0004423476 CLEARWIRE SPECTRUM HOLDINGS IIIHarrisburg 10/15/2010 21925.00000 40-17-27.2 N PA MD WQLJ567 076-45-54.6 W 0004423477 CLEARWIRE SPECTRUM HOLDINGS IIIHarrisburg 10/15/2010 23125.00000 40-18-04.1 N CA NE 121-55-07.3 W 0004421886 CLEARWIRE SPECTRUM HOLDINGS IIIMilpitas 10/15/2010 23075.00000 37-26-33.4 N Page 22 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 121-55-07.3 W 0004421886 CLEARWIRE SPECTRUM HOLDINGS IIIMilpitas 10/15/2010 23175.00000 37-26-33.4 N CA NE 121-55-07.3 W 0004421886 CLEARWIRE SPECTRUM HOLDINGS IIIMilpitas 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302397A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302397A1.txt  
- (MHz) Applicant Name Latitude City AZ MD WQHU816 109-57-16.3 W 0004424669 COX COMMUNICATIONS INC. BISBEE 10/18/2010 06093.45000 31-28-21.8 N AZ MD WQHU816 109-57-16.3 W 0004424669 COX COMMUNICATIONS INC. BISBEE 10/18/2010 06152.75000 31-28-21.8 N AZ MD WQHU816 109-57-16.3 W 0004424669 COX COMMUNICATIONS INC. BISBEE 10/18/2010 06695.00000 31-28-21.8 N CA MD WQMM778 121-51-00.9 W 0004424710 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/18/2010 17815.00000 37-19-04.1 N CA MD WQMM778 121-51-00.9 W 0004424710 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/18/2010 17915.00000 37-19-04.1 N CA MD WQMM775 121-50-30.9 W 0004424711 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/18/2010 17765.00000 37-20-19.7 N CA MD WQMM775 121-50-30.9 W 0004424711 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 10/18/2010 17865.00000 37-20-19.7 N CA MD WQLX793 118-21-42.1 W 0004424817 Fireline Network Solutions Inc. Universal City 10/18/2010 21825.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302398A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302398A1.txt  
- Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD WQLH958 094-41-08.9 W 0004427651 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 23075.00000 39-02-56.0 N KS MD WQLH958 094-41-08.9 W 0004427651 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 23175.00000 39-02-56.0 N KS MD WQLH958 094-41-08.9 W 0004427651 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 23225.00000 39-02-56.0 N MO MD WQLH640 094-31-04.1 W 0004427652 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 10775.00000 39-12-48.3 N MO MD WQLH640 094-31-04.1 W 0004427652 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 10895.00000 39-12-48.3 N MO MD WQLH640 094-31-04.1 W 0004427652 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 23025.00000 39-12-48.3 N MO MD WQLH640 094-31-04.1 W 0004427652 CLEARWIRE SPECTRUM HOLDINGS IIIKansas City 10/20/2010 23075.00000 39-12-48.3 N MO MD WQLH640 094-31-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302400A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302400A1.txt  
- WQIQ363 093-16-48.8 W 0004429076 Telecom Transport Management, Inc. BLOOMINGTON 10/21/2010 23335.00000 44-51-29.9 N MN MD WQIQ369 093-17-00.1 W 0004429078 Telecom Transport Management, Inc. Bloomington 10/21/2010 22135.00000 44-50-35.5 N CA MD WMQ372 118-28-56.3 W 0004429396 LOS ANGELES SMSA LIMITED PARTNESAUGAS 10/22/2010 19675.00000 34-23-24.0 N CA NE 118-22-31.5 W 0004428033 Bel Air Internet San Fernando Valley 10/20/2010 23175.00000 34-09-59.3 N CA NE 117-41-04.1 W 0004428257 New Cingular Wireless PCS, LLC Ridgecrest 10/21/2010 10795.00000 35-32-25.9 N VA NE 077-29-23.1 W 0004428710 Telecom Transport Management, Inc. Chesterfield 10/21/2010 21510.00000 37-23-07.7 N VA NE 077-25-48.0 W 0004428815 Telecom Transport Management, Inc. Richmond 10/21/2010 21480.00000 37-26-12.8 N OH NE 081-34-16.3 W 0004428869 FiberTower Network Services Corp. Massillon 10/21/2010 11345.00000 40-46-16.3 N VA NE 076-22-21.0 W 0004429029 Telecom 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302402A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302402A1.txt  
- Houston Houston 10/20/2010 11405.00000 29-44-53.4 N TX NE 095-12-50.9 W 0004427244 City of Houston Houston 10/20/2010 11565.00000 29-44-53.4 N TX NE 095-16-49.1 W 0004427245 City of Houston Houston 10/20/2010 05974.85000 29-56-38.9 N TX NE 095-16-49.1 W 0004427245 City of Houston Houston 10/20/2010 06004.50000 29-56-38.9 N TX NE 095-16-49.1 W 0004427245 City of Houston Houston 10/20/2010 11325.00000 29-56-38.9 N TX NE 095-29-04.1 W 0004427246 City of Houston Houston 10/20/2010 10755.00000 29-42-11.9 N TX NE 095-29-04.1 W 0004427246 City of Houston Houston 10/20/2010 11185.00000 29-42-11.9 N TX NE 095-11-29.2 W 0004427247 City of Houston Kingwood 10/20/2010 11132.50000 30-04-43.4 N TX NE 095-22-10.2 W 0004427249 City of Houston Houston 10/20/2010 10715.00000 29-45-02.3 N TX NE 095-22-10.2 W 0004427249 City of Houston Houston 10/20/2010 10955.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302417A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302417A1.txt  
- W 2 1 09/23/2010 WQKB829 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23175.00000000 HENDERSON 36-1-49.8 N NV 115-5-20.6 W 2 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. YO - Other Indust/Land Transp. 806-821/851-866 MHz, Trunked Mobility Division 08/02/2010 WQAS978 FB2C Duke Energy Carolinas, LLC 856.38750000 Markleville 39-59-53.5 N IN 85-38-4.1 W 1 1 08/02/2010 WQAS978 MO Duke Energy Carolinas, LLC 811.38750000 Markleville 39-59-53.5 N IN 85-38-4.1 W 2 1 Page 3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302569A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302569A1.txt  
- CINGULAR WIRELESS PCS, LLCLAMASCO 10/27/2010 36-59-17.3 N Page 26 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY AM KNKN674 088-26-49.1 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCLEDBETTER 10/27/2010 37-03-22.7 N KY AM KNKN674 088-04-31.8 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCMarion 10/27/2010 37-19-03.2 N KY AM KNKN674 087-54-04.1 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCMORGANFIELD 10/27/2010 37-38-50.2 N KY AM KNKN674 087-55-17.8 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCMORGANFIELD 10/27/2010 37-39-06.2 N KY AM KNKN674 087-48-08.8 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCPrinceton 10/27/2010 37-09-17.3 N KY AM KNKN674 087-38-10.0 W 0004308345 NEW CINGULAR WIRELESS PCS, LLCSebree 10/27/2010 37-38-13.3 N KY AM KNKN674 087-31-16.3 W 0004308345 NEW CINGULAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302588A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302588A1.txt  
- MHz 36M0F3F 80.43 dBW DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 5925.0000 - 6425.0000 MHz 36M0G7W 51.96 dBW DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 3700.0000 - 4200.0000 MHz 36M0G7W DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 3700.0000 - 4200.0000 MHz 51K2G7W COMTECH 2 4.1 meters ANTENNA ID: OFFSAT 69.60 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 11M2G7W 46.20 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 11M2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E070218 SES-MOD-20101026-01342 E Class 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302728A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302728A1.txt  
- Effective: 11/08/2010 Class of Station: Fixed Earth Stations Grant of Authority 12/14/2010 - 12/14/2025 Renewal South Carolina ETV Comm Page 18 of 20 Nature of Service: Domestic Fixed Satellite Service 33 ° 58 ' 30.00 " N LAT. SITE ID: 1 1103 GEORGE ROGERS BLVD., RICHLAND, COLUMBIA, SC 81 ° 0 ' 58.00 " W LONG. LOCATION: COMTECH "OFFSAT" 1 4.1 meters ANTENNA ID: 54.90 dBW 5925.0000 - 6425.0000 MHz 180KF3E 3700.0000 - 4200.0000 MHz 180KF3E Points of Communication: 1 - ALSAT - (ALSAT) E030131 SES-STA-20091019-01338 E Date Effective: 11/08/2010 Class of Station: Grant of Authority Special Temporary Authority KVH Industries, Inc. Special Temporary Authority is GRANTED with Conditions for a period of 60 days beginning November 9, 2010 and ending 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302817A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-302817A1.txt  
- 42-11-59.5 N TS - TV Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR MD KPT27 122-54-40.1 W 0004451356 FREEDOM BROADCASTING OF OREGOMEDFORD 11/12/2010 02042.00000 - 02059.00000 42-20-29.4 N OR MD KPT27 122-54-40.1 W 0004451356 FREEDOM BROADCASTING OF OREGOMEDFORD 11/12/2010 02061.50000 - 02073.50000 42-20-29.4 N OR MD KHU95 122-45-04.1 W 0004451378 FREEDOM BROADCASTING OF OREGOMEDFORD 11/12/2010 02061.50000 - 02073.50000 42-17-42.4 N OR MD KHU95 122-45-04.1 W 0004451378 FREEDOM BROADCASTING OF OREGOMEDFORD 11/12/2010 02093.00000 - 02110.00000 42-17-42.4 N YK - Industrial/Business Pool - Commercial, Trunked State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MD WPMJ898 A 0004448622 Communication Specialists Co., INc. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303069A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303069A1.txt  
- MD WQDM982 106-21-25.0 W 0004507960 STATE OF WYOMING, DEPARTMENT OCasper 11/23/2010 10567.50000 42-52-05.1 N WY MD WQDM982 106-21-25.0 W 0004507960 STATE OF WYOMING, DEPARTMENT OCasper 11/23/2010 19640.00000 42-52-05.1 N TX MD WQMS261 095-27-11.2 W 0004508288 City of Houston Houston 11/24/2010 11215.00000 29-43-24.8 N TX MD WQMS261 095-27-11.2 W 0004508288 City of Houston Houston 11/24/2010 11685.00000 29-43-24.8 N TX MD WQMX901 095-29-04.1 W 0004508289 City of Houston Houston 11/24/2010 10755.00000 29-42-11.9 N TX MD WQMX901 095-29-04.1 W 0004508289 City of Houston Houston 11/24/2010 11185.00000 29-42-11.9 N TX MD WQMX862 095-23-58.6 W 0004508290 City of Houston Houston 11/24/2010 10715.00000 29-42-45.7 N TX MD WQMX862 095-23-58.6 W 0004508290 City of Houston Houston 11/24/2010 10915.00000 29-42-45.7 N GA NE 081-39-31.7 W 0004505094 Glynn-Brunswick 911 Center 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303390A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303390A1.txt  
- 36-55-15.1 N CA NE 122-14-00.3 W 0004512683 WiLine Networks Inc. Redwood City 11/29/2010 17785.00000 37-32-43.0 N CA NE 122-12-11.7 W 0004512687 WiLine Networks Inc Redwood City 11/29/2010 19345.00000 37-30-48.4 N CA NE 122-25-05.8 W 0004512695 WiLine Networks Inc. San Francisco 11/29/2010 22725.00000 37-45-18.6 N CA NE 122-24-39.2 W 0004512700 WiLine Networks Inc. San Francisco 11/29/2010 21525.00000 37-45-45.0 N CA NE 122-23-04.1 W 0004512703 WiLine Networks Inc. Burlingame 11/29/2010 21375.00000 37-35-46.4 N CA NE 122-12-11.9 W 0004512736 WiLine Networks Inc. Redwood City 11/29/2010 21475.00000 37-29-05.4 N AZ NE 112-18-12.4 W 0004513171 Gutierrez-Palmenberg, Inc. Cashion 11/30/2010 17965.00000 33-26-10.4 N MO RM WMS478 090-09-41.0 W 0004513627 USCOC OF GREATER MISSOURI, LLCZELL 11/30/2010 06034.15000 37-55-09.0 N Page 7 CF - Common Carrier Fixed Point to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303393A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303393A1.txt  
- IIIOakmont 12/02/2010 23075.00000 40-31-16.8 N PA NE 079-50-48.2 W 0004519556 CLEARWIRE SPECTRUM HOLDINGS IIIOakmont 12/02/2010 23275.00000 40-31-16.8 N PA NE 079-59-19.9 W 0004519559 CLEARWIRE SPECTRUM HOLDINGS IIIMount Oliver 12/02/2010 21975.00000 40-24-46.6 N CO NE 104-31-22.8 W 0004519569 ROGGEN TELEPHONE ENTERPRISES, KEENESBURG 12/02/2010 11305.00000 40-06-54.0 N CO NE 104-22-08.4 W 0004519570 ROGGEN TELEPHONE ENTERPRISES, ROGGEN 12/02/2010 10815.00000 40-10-04.8 N PA NE 080-00-04.1 W 0004519572 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 12/02/2010 21925.00000 40-27-22.5 N PA NE 080-00-04.1 W 0004519572 CLEARWIRE SPECTRUM HOLDINGS IIIPittsburgh 12/02/2010 21975.00000 40-27-22.5 N NE NE 096-18-44.0 W 0004519756 Nebraska Public Power District CRAIG 12/02/2010 06034.15000 41-51-16.0 N TN NE 088-14-19.0 W 0004519844 NTCH-West Tenn, Inc. Savannah 12/02/2010 17815.00000 35-13-09.0 N TN NE 088-19-36.0 W 0004519858 NTCH-West Tenn, Inc. Adamsville 12/02/2010 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303395A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303395A1.txt  
- Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NY NE 075-54-57.5 W 0004519022 Madison County Commissioners Fabius 12/02/2010 06345.49000 42-49-23.5 N NY NE 075-54-57.5 W 0004519022 Madison County Commissioners Fabius 12/02/2010 06404.79000 42-49-23.5 N NY NE 076-11-30.1 W 0004519023 Madison County Commissioners Syracuse 12/02/2010 06375.14000 43-00-22.9 N NY NE 075-43-52.5 W 0004519025 Madison County Commissioners Fenner 12/02/2010 06197.24000 42-57-04.1 N NY NE 075-43-52.5 W 0004519025 Madison County Commissioners Fenner 12/02/2010 06226.89000 42-57-04.1 N NY NE 075-43-52.5 W 0004519025 Madison County Commissioners Fenner 12/02/2010 06286.19000 42-57-04.1 N NY NE 075-43-52.5 W 0004519025 Madison County Commissioners Fenner 12/02/2010 06315.84000 42-57-04.1 N NY NE 075-42-10.8 W 0004519027 Madison County Commissioners Wampsville 12/02/2010 06063.80000 43-04-48.8 N NY NE 075-42-10.8 W 0004519027 Madison County 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303405A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303405A1.txt  
- 135 144 75 10 7 1 466 525 Mobile Wireless 7,362 5,168 12,530 10,432 23,804 2,728 949 * 0 * 39,956 52,486 Power Line and Other 0 0 0 * * * * 0 * * 5 5 Total 9,289 7,900 17,190 13,131 31,826 14,498 16,131 23,591 16,472 308 115,959 133,148 Percentages aDSL 3.5 4.8 8.3 6.7 19.6 29.2 30.9 4.1 1.2 0.0 91.7 100.0 sDSL 0.0 0.0 0.0 41.9 32.2 17.5 7.5 * * * 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.7 10.4 60.0 10.8 3.7 2.9 3.4 100.0 100.0 Cable Modem 0.7 1.8 2.5 0.8 3.7 4.4 11.7 46.8 29.8 0.5 97.5 100.0 FTTP 0.1 0.0 0.2 0.5 1.2 2.6 10.2 1.6 81.7 2.1 99.8 100.0 Satellite 45.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303419A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303419A1.txt  
- MHz 36M0F3F 80.43 dBW DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 5925.0000 - 6425.0000 MHz 36M0G7W 51.96 dBW DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 3700.0000 - 4200.0000 MHz 36M0G7W DIGITAL TRAFFIC WITH VARIOUS FEC, MODULATION, DATA RATES 3700.0000 - 4200.0000 MHz 51K2G7W COMTECH 2 4.1 meters ANTENNA ID: OFFSAT 69.60 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 11M2G7W 46.20 dBW DIGITAL VIDEO AND AUDIO CARRIERS 5925.0000 - 6425.0000 MHz 51K2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 11M2G7W DIGITAL VIDEO AND AUDIO CARRIERS 3700.0000 - 4200.0000 MHz 51K2G7W Points of Communication: 1 - ALSAT - (ALSAT) E070218 SES-MOD-20101026-01342 E Date 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303633A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303633A1.txt  
- 085-41-43.2 W 0004349741 NEW CINGULAR WIRELESS PCS, LLCWilkinson 12/10/2010 39-50-47.7 N IN AM KNKA208 085-36-43.3 W 0004349741 NEW CINGULAR WIRELESS PCS, LLCWilkinson 12/10/2010 39-53-01.6 N Page 18 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA AM KNKA692 121-27-47.2 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 12/07/2010 39-39-04.1 N CA AM KNKA692 121-51-23.7 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCChico 12/07/2010 39-38-30.1 N CA AM KNKA692 121-40-43.9 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 12/07/2010 39-47-01.6 N CA AM KNKA692 121-57-09.4 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCCHICO 12/07/2010 39-51-09.0 N CA AM KNKA692 121-10-39.4 W 0004363578 NEW CINGULAR WIRELESS PCS, LLCDobbins 12/07/2010 39-23-19.0 N CA AM KNKA692 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303634A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303634A1.txt  
- 111-50-47.1 W 0004528501 T-MOBILE LICENSE LLC Salt Lake City 12/09/2010 19400.00000 40-45-41.5 N KY NE 082-51-17.4 W 0004528676 New Cingular Wireless PCS, LLC ARGILLITE 12/09/2010 06063.80000 38-29-48.7 N KY NE 082-51-17.4 W 0004528676 New Cingular Wireless PCS, LLC ARGILLITE 12/09/2010 06755.00000 38-29-48.7 N KY NE 082-51-40.6 W 0004528735 New Cingular Wireless PCS, LLC GRAYSON 12/09/2010 11225.00000 38-21-40.3 N WA NE 117-22-04.1 W 0004528823 Pocketinet Communications, Inc Spangle 12/09/2010 11135.00000 47-24-48.5 N WA NE 117-17-54.7 W 0004528838 Pocketinet Communications, Inc. Spokane 12/09/2010 11625.00000 47-34-44.6 N WA NE 117-17-54.7 W 0004528838 Pocketinet Communications, Inc. Spokane 12/09/2010 11665.00000 47-34-44.6 N WA NE 117-11-36.1 W 0004528847 Pocketinet Communications, Inc Spokane 12/09/2010 11175.00000 47-41-06.1 N WA NE 119-21-27.5 W 0004528886 Pocketinet Communications, Inc Richland 12/09/2010 11645.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303726A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303726A1.txt  
- LLC Columbia 12/15/2010 19520.00000 33-58-04.2 N TN NE 086-39-32.8 W 0004534070 T-MOBILE LICENSE LLC Nashville 12/15/2010 22425.00000 36-05-58.7 N TN NE 086-37-56.6 W 0004534084 T-MOBILE LICENSE LLC Nashville 12/15/2010 19440.00000 36-08-04.3 N SC NE 080-58-28.4 W 0004534087 T-MOBILE LICENSE LLC COLUMBIA 12/15/2010 19640.00000 33-59-19.2 N NC NE 081-09-05.0 W 0004534156 T-MOBILE LICENSE LLC GASTONIA 12/15/2010 18040.00000 35-14-05.0 N SC NE 082-05-04.1 W 0004534169 T-MOBILE LICENSE LLC Woodruff 12/15/2010 19520.00000 34-52-02.4 N OK NE 097-21-52.1 W 0004534176 T-MOBILE LICENSE LLC SPENCER 12/15/2010 18040.00000 35-28-40.0 N SC NE 080-12-01.9 W 0004534208 T-MOBILE LICENSE LLC Summerville 12/15/2010 19440.00000 32-57-59.8 N Page 6 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303727A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303727A1.txt  
- WQMM299 121-58-44.4 W 0004533715 CLEARWIRE SPECTRUM HOLDINGS IIIFremont 12/15/2010 23425.00000 37-33-30.2 N CA MD WQMM299 121-58-44.4 W 0004533715 CLEARWIRE SPECTRUM HOLDINGS IIIFremont 12/15/2010 23475.00000 37-33-30.2 N CA MD WPNI622 118-27-21.0 W 0004535037 FOX TELEVISION STATIONS INC. LOS ANGELES 12/15/2010 22185.00000 34-02-02.9 N CA MD WPNI623 118-23-44.3 W 0004535050 FOX TELEVISION STATIONS INC. LOS ANGELES 12/15/2010 23385.00000 33-56-44.7 N NY NE 073-59-04.1 W 0004531666 CLEARWIRE SPECTRUM HOLDINGS IIINew York 12/13/2010 19575.00000 40-45-54.1 N NY NE 073-59-04.1 W 0004531666 CLEARWIRE SPECTRUM HOLDINGS IIINew York 12/13/2010 19675.00000 40-45-54.1 N NY NE 073-55-26.9 W 0004531670 CLEARWIRE SPECTRUM HOLDINGS IIIBronx 12/13/2010 17815.00000 40-49-01.6 N NY NE 073-55-26.9 W 0004531670 CLEARWIRE SPECTRUM HOLDINGS IIIBronx 12/13/2010 17915.00000 40-49-01.6 N NY NE 073-54-56.5 W 0004531672 CLEARWIRE SPECTRUM HOLDINGS IIIAstoria 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303822A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303822A1.txt  
- City GA NE 085-08-53.9 W 0004538412 Conterra Ultra Broadband LLC RINGGOLD 12/17/2010 11445.00000 34-55-27.1 N GA NE 085-08-53.9 W 0004538412 Conterra Ultra Broadband LLC RINGGOLD 12/17/2010 11525.00000 34-55-27.1 N MS NE 088-41-18.7 W 0004538435 ALLTEL Communications of Mississippi RTupelo 12/17/2010 06152.75000 34-19-45.9 N TN NE 083-07-32.2 W 0004539043 Conterra Ultra Broadband LLC BULLS GAP 12/20/2010 11365.00000 36-11-58.9 N TN NE 083-40-04.1 W 0004539044 Conterra Ultra Broadband LLC SEVIERVILLE 12/20/2010 11525.00000 35-48-41.0 N TN NE 084-14-15.0 W 0004539046 Conterra Ultra Broadband LLC SOLWAY 12/20/2010 10715.00000 35-59-53.0 N TN NE 083-47-59.6 W 0004539047 Conterra Ultra Broadband LLC SEYMOUR 12/20/2010 11035.00000 35-53-03.0 N TN NE 085-21-51.1 W 0004539049 Conterra Ultra Broadband LLC JASPER 12/20/2010 10715.00000 35-05-16.1 N TN NE 084-18-45.7 W 0004539051 Conterra Ultra 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A1.txt  
- by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ..................................... Table 3.8 Safety Valve Support Payments by Study Area .......................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type . Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ............................................ Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A11.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A11.txt  
- Frontier pointTelecomTelecom Rico Alltel ValorOther ACCESS SERVICES PROVIDED TO CARRIERS -- SWITCHED ACCESS Percent Installation Commitments Met 91.9 92.4 99.9 93.3 85.8 22.8 85.8 64.6 0.1 99.0 100.0 93.1 Average Installation Interval (days) 10.7 23.8 30.0 27.2 23.4 31.5 23.4 20.0 84.1 4.8 10.0 8.7 Average Repair Interval (hours) 2.2 140.7 NA 33.5 17.2 61.0 17.2 20.1 508.7 3.4 5.5 4.1 ACCESS SERVICES PROVIDED TO CARRIERS -- SPECIAL ACCESS Percent Installation Commitments Met 90.9 93.6 95.0 83.4 94.4 47.7 94.4 72.2 15.3 96.2 96.3 96.1 Average Installation Interval (days) 10.6 17.7 32.0 15.7 16.6 26.4 16.6 14.3 53.3 7.0 7.2 7.6 Average Repair Interval (hours) 3.8 106.3 6.2 23.3 56.2 21.3 56.2 15.5 16.3 4.3 4.1 4.1 LOCAL SERVICES PROVIDED TO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A2.txt  
- by Funding Year .............................. Table 5.1 Safety Net Additive Support Payments by State or Jurisdiction .........................Table 3.7 Safety Net Additive Support Payments by Study Area ...................................Table 3.23 Safety Valve Support Payments by State or Jurisdiction ..................................... Table 3.8 Safety Valve Support Payments by Study Area .......................................... Table 3.24 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type . Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .... Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ............................................ Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A6.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A6.txt  
- had also committed more than $2.51 billion, and disbursed nearly $1.66 billion of funding year 2008 funds. As of the same date, USAC had committed more than $2.74 billion, and disbursed nearly $855 million of funding year 2009 funds.4 3 The posted forms can be viewed on USAC's website at http://www.usac.org/sl/tools/search tools/form470-search-posted.aspx (last viewed Dec. 15, 2010). 4 See Table 4.1. 4 - 3 USAC supplies the FCC with funding commitments and disbursements information for the E-rate program for all active funding years. USAC provided the FCC with data as of June 30, 2010. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A8.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A8.txt  
- of Occupied Housing Units with Telephone Service) Telephone Penetration by State 6 - 15 Table 6.5 Telephone Penetration by State (Annual Average Percentage of Households with Telephone Service) State 1984 2009 Change Alabama 88.4% 95.2% 6.7% * Alaska 86.5 96.2 9.7 * Arizona 86.9 93.7 6.8 * Arkansas 86.6 93.0 6.5 * California 92.5 96.7 4.3 * Colorado 93.2 97.4 4.1 * Connecticut 95.5 97.7 2.2 Delaware 94.3 95.9 1.6 District of Columbia 94.9 92.2 -2.7 Florida 88.7 93.0 4.3 * Georgia 86.2 94.1 7.9 * Hawaii 93.5 97.7 4.2 * Idaho 90.7 97.0 6.2 * Illinois 94.2 95.1 0.9 Indiana 91.6 93.1 1.5 Iowa 96.2 98.1 1.9 Kansas 94.3 96.8 2.5 Kentucky 88.1 93.7 5.5 * Louisiana 89.7 95.9 6.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A9.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303886A9.txt  
- in long distance prices. 4 Access Charge Reform, CC Docket No. 96-262, Sixth Report and Order, 15 Rcd. 12962 (CALLS Order). 5 Telecommunications Act of 1996, Pub. L. No. 104-104, 110 Stat. 56 (1996) (1996 Act). The 1996 Act amended the Communications Act of 1934. 47 U.S.C. §§ 151 et seq. 1959 - 2009 1999 - 2009 CPI All Items 4.1 % 2.5 % CPI All Services 4.9 3.1 CPI Telephone Services 1 1.7 0.3 CPI Major Categories: - Food & Beverages * 2.8 - Housing * 2.7 - Apparel 1.9 -0.9 - Transportation 4.6 2.9 - Medical Care 5.9 4.1 - Recreation * 1.0 - Other Goods & Services * 3.7 CPI Public Transportation 5.0 2.0 CPI Utility (Piped) Gas 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303907A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303907A1.txt  
- SkyTel Spectrum LLC San Diego 12/30/2010 00454.70000 33-01-28.2 N CA MD KUD227 117-05-19.1 W 0004552344 SkyTel Spectrum LLC San Diego 12/30/2010 00454.75000 33-01-28.2 N Page 37 CG - General Aviation Air-ground Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NM MD WPON853 106-46-48.1 W 0004552349 Stratophone, LLC Albuquerque 12/30/2010 00454.70000 35-04-04.1 N NM MD WPON853 106-46-48.1 W 0004552349 Stratophone, LLC Albuquerque 12/30/2010 00454.82500 35-04-04.1 N MD MD KGC405 076-53-05.9 W 0004552375 Stratophone, LLC LANDOVER HILLS 12/30/2010 00454.77500 38-57-02.3 N MD MD KGC405 076-53-05.9 W 0004552375 Stratophone, LLC LANDOVER HILLS 12/30/2010 00454.82500 38-57-02.3 N CA MD KWU510 118-35-12.3 W 0004552376 SkyTel Spectrum LLC CHATSWORTH 12/30/2010 00454.70000 34-19-35.0 N CA MD KWU510 121-52-19.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303908A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-303908A1.txt  
- 21875.00000 43-35-56.9 N ID MD WQKC389 116-23-42.0 W 0004552284 CLEARWIRE SPECTRUM HOLDINGS IIIMeridian 12/30/2010 21925.00000 43-35-56.9 N ID MD WQLY985 116-19-00.2 W 0004552288 CLEARWIRE SPECTRUM HOLDINGS IIIBoise City 12/30/2010 19425.00000 43-38-07.3 N ID MD WQLY985 116-19-00.2 W 0004552288 CLEARWIRE SPECTRUM HOLDINGS IIIBoise City 12/30/2010 22025.00000 43-38-07.3 N ID MD WQKJ697 116-28-24.3 W 0004552290 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 12/30/2010 11345.00000 43-31-04.1 N ID MD WQKJ697 116-28-24.3 W 0004552290 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 12/30/2010 17815.00000 43-31-04.1 N ID MD WQKJ697 116-28-24.3 W 0004552290 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 12/30/2010 17865.00000 43-31-04.1 N ID MD WQKJ697 116-28-24.3 W 0004552290 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 12/30/2010 17915.00000 43-31-04.1 N ID MD WQKJ697 116-28-24.3 W 0004552290 CLEARWIRE SPECTRUM HOLDINGS IIIBOISE CITY 12/30/2010 17965.00000 43-31-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304028A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304028A1.txt  
- Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY MD KZK92 086-47-22.0 W 0004558883 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 06705.62500 37-57-29.0 N KY MD KZK92 086-47-22.0 W 0004558883 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 10553.12500 37-57-29.0 N KY MD WLR62 086-46-42.8 W 0004558884 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 06865.62500 37-56-04.1 N TX MD WQKQ710 098-36-36.8 W 0004559119 CLEARWIRE SPECTRUM HOLDINGS IIILeon Valley 01/04/2011 21925.00000 29-29-55.5 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19375.00000 29-30-26.9 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19475.00000 29-30-26.9 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19525.00000 29-30-26.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304034A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304034A1.txt  
- 39-43-44.4 N Page 5 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO MD WQBG812 105-10-13.4 W 0004564570 JEFFERSON, COUNTY OF West Pleasant View 01/07/2011 23125.00000 39-43-22.3 N CO MD WQDL325 105-14-30.7 W 0004564572 JEFFERSON, COUNTY OF GOLDEN 01/07/2011 23075.00000 39-46-37.8 N CO MD WQBG813 105-12-04.1 W 0004564573 JEFFERSON, COUNTY OF Golden 01/07/2011 21925.00000 39-43-42.1 N NY MD WQLW888 073-56-34.5 W 0004564576 New York City Police Department New York 01/07/2011 22620.00000 40-49-53.4 N NY MD WQLW888 073-56-34.5 W 0004564576 New York City Police Department New York 01/07/2011 22670.00000 40-49-53.4 N NY MD WQLW888 073-56-34.5 W 0004564576 New York City Police Department New York 01/07/2011 22720.00000 40-49-53.4 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304054A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304054A1.txt  
- Telephone Competition: Status as of December 31, 2009 29 Zero 17.4%18.4%17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% One 10.5 11.4 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 Two 7.6 7.6 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 Three 6.0 6.2 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 Four 4.8 4.7 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 Five 4.2 4.1 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 Six 3.4 3.6 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 Seven 3.1 3.3 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 Eight 3.1 2.9 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 Nine 2.8 2.7 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 Ten or More 36.9 35.0 35.3 34.0 33.5 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304056A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304056A1.txt  
- Voice 14000.0000 - 14500.0000 MHz 32M3G7W Digital Data and Video 11700.0000 - 12200.0000 MHz 32M3G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 1M54G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 32M3G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 1M54G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 32M3G7W RSI Satcom Technologies 5.5m Hub 4.1 meters ANTENNA ID: 551KS 65.70 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 1M77G7W 56.60 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 22K0G7W 47.40 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 30K0G7W 69.50 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 4M33G7W 62.60 dBW Digital QPSK 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304135A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304135A1.txt  
- MD WQMP952 104-45-14.5 W 0004565905 CLEARWIRE SPECTRUM HOLDINGS IIIAurora 01/10/2011 11385.00000 39-40-03.4 N CO MD WQND612 105-09-22.3 W 0004566012 CLEARWIRE SPECTRUM HOLDINGS IIIArvada 01/10/2011 21925.00000 39-48-43.2 N CO MD WQND612 105-09-22.3 W 0004566012 CLEARWIRE SPECTRUM HOLDINGS IIIArvada 01/10/2011 22075.00000 39-48-43.2 N NM MD WQDW654 106-23-39.2 W 0004566047 Tri State Generation & Transmission AssnAbiquiu 01/10/2011 00953.95000 36-07-28.4 N PA MD WQMP932 078-41-04.1 W 0004566134 Open Range Communications Ridgeway 01/10/2011 10715.00000 41-22-46.0 N Page 36 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WQMP931 078-32-00.7 W 0004566139 Open Range Communications St. Marys 01/10/2011 19330.00000 41-26-19.0 N NJ MD WQMD432 074-25-51.0 W 0004566247 CLEARWIRE SPECTRUM HOLDINGS IIIPISCATAWAY 01/10/2011 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304136A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304136A1.txt  
- W 0004531511 WECOM, INC KINGMAN 01/11/2011 10815.00000 35-04-52.0 N AZ AM WNTN373 113-54-17.8 W 0004531511 WECOM, INC KINGMAN 01/11/2011 10855.00000 35-04-52.0 N AZ AM WNTN373 113-54-17.8 W 0004531511 WECOM, INC KINGMAN 01/11/2011 10895.00000 35-04-52.0 N AZ AM WNTN373 113-54-17.8 W 0004531511 WECOM, INC KINGMAN 01/11/2011 19620.00000 35-04-52.0 N CA AM 121-54-59.4 W 0004533700 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/11/2011 23025.00000 37-19-04.1 N CA AM 121-54-59.4 W 0004533700 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/11/2011 23125.00000 37-19-04.1 N CA AM 121-54-59.4 W 0004533700 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/11/2011 23175.00000 37-19-04.1 N CA AM 121-54-59.4 W 0004533700 CLEARWIRE SPECTRUM HOLDINGS IIISan Jose 01/11/2011 23275.00000 37-19-04.1 N CA AM WQLY657 122-05-58.9 W 0004533711 CLEARWIRE SPECTRUM HOLDINGS IIIMountain View 01/11/2011 19325.00000 37-23-37.7 N CA AM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304247A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304247A1.txt  
- N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06315.84000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06345.49000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06375.14000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06404.79000 29-29-59.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05945.20000 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05960.02500 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05974.85000 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05989.67500 29-18-48.8 N TX RM KLR38 099-16-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304248A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304248A1.txt  
- 01/18/2011 17915.00000 32-57-15.1 N Page 39 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WQLE409 096-56-30.7 W 0004576067 CLEARWIRE SPECTRUM HOLDINGS IIICoppell 01/18/2011 18115.00000 32-57-15.1 N ID MD WQAV213 116-54-56.0 W 0004576350 First Step Internet, LLC Moscow 01/18/2011 17980.00000 46-48-40.0 N WA MD WQDR537 117-09-04.1 W 0004576352 First Step Internet LLC Pullman 01/18/2011 19540.00000 46-44-48.5 N MA MD WQKL228 071-03-00.9 W 0004577106 GREATER BOSTON RADIO, INC. BOSTON 01/18/2011 17785.00000 42-19-02.9 N MA MD WQKL230 071-04-57.0 W 0004577107 GREATER BOSTON RADIO, INC. BOSTON 01/18/2011 19345.00000 42-20-50.0 N CA MD WQGZ839 118-35-05.1 W 0004577198 SKYRIVER COMMUNICATIONS INC. CHATSWORTH 01/18/2011 17880.00000 34-19-26.6 N RI MD WQMB645 071-26-22.4 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304251A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304251A1.txt  
- 0004581900 Madison, County of WEST EXETER 01/21/2011 06004.50000 42-48-40.0 N NY NE 076-11-30.1 W 0004581901 Madison, County of Syracuse 01/21/2011 06375.14000 43-00-22.9 N NY NE 075-44-08.4 W 0004581902 Madison, County of Cazenovia 01/21/2011 05945.20000 42-51-40.7 N NY NE 075-44-08.4 W 0004581902 Madison, County of Cazenovia 01/21/2011 06093.45000 42-51-40.7 N NY NE 075-43-52.5 W 0004581903 Madison, County of Fenner 01/21/2011 06197.24000 42-57-04.1 N NY NE 075-43-52.5 W 0004581903 Madison, County of Fenner 01/21/2011 06226.89000 42-57-04.1 N NY NE 075-43-52.5 W 0004581903 Madison, County of Fenner 01/21/2011 06286.19000 42-57-04.1 N NY NE 075-43-52.5 W 0004581903 Madison, County of Fenner 01/21/2011 06315.84000 42-57-04.1 N NY NE 075-49-20.9 W 0004581904 Madison, County of Cazenovia 01/21/2011 06034.15000 42-58-51.5 N NY NE 075-37-25.5 W 0004581905 Madison, County 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304388A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304388A1.txt  
- listing of applications, subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ME NE 069-55-52.8 W 0004583682 Midcoast Regional Redevelopment AuthorBrunswick 01/24/2011 00122.72500 43-54-04.1 N LA NE 090-49-54.9 W 0004585033 Golden Ranch Aviation Thibodaux 01/24/2011 00122.80000 29-44-52.2 N NJ NE 074-06-52.9 W 0004585173 Aviation Spectrum Resources, Inc South Kearny 01/24/2011 00131.97500 40-43-40.9 N NY NE 073-52-21.4 W 0004585183 Aviation Spectrum Resources, Inc New York 01/24/2011 00130.55000 40-46-38.1 N SC NE 080-02-25.9 W 0004585194 Aviation Spectrum Resources, Inc Charleston 01/24/2011 00130.12500 32-53-55.1 N NJ NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304516A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304516A1.txt  
- WIRELESS PCS, LLCROMNEY 12/07/2010 39-18-37.9 N Page 17 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WV MD KNKN567 077-48-02.9 W 0004525096 NEW CINGULAR WIRELESS PCS, LLCSHEPARDSTOWN 12/07/2010 39-25-31.0 N VA MD KNKN567 078-56-53.0 W 0004525096 NEW CINGULAR WIRELESS PCS, LLCSINGER'S GLEN 12/07/2010 38-33-41.0 N WV MD KNKN567 079-16-04.1 W 0004525096 NEW CINGULAR WIRELESS PCS, LLCUPPER TRACT 12/07/2010 38-47-27.0 N RO WQLC364 0004598236 Copper Valley Wireless, Inc. 02/01/2011 CT - Local Television Transmission State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City RO WPNJ427 0004598342 STEINERT, CHRISTINE 02/01/2011 IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304658A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304658A1.txt  
- 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19440.00000 34-04-17.5 N CA MD WPXF902 118-03-56.9 W 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19570.00000 34-04-17.5 N CA MD WPXF902 118-03-56.9 W 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19690.00000 34-04-17.5 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 05974.85000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 06063.80000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304690A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304690A1.txt  
- Voice 14000.0000 - 14500.0000 MHz 32M3G7W Digital Data and Video 11700.0000 - 12200.0000 MHz 32M3G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 1M54G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 32M3G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 1M54G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 32M3G7W RSI Satcom Technologies 5.5m Hub 4.1 meters ANTENNA ID: 551KS 65.70 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 1M77G7W 56.60 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 22K0G7W Page 4 of 7 47.40 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 30K0G7W 69.50 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 4M33G7W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304774A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304774A1.txt  
- 123-38-35.1 W 0004615904 USCOC OF OREGON RSA #5, INC. CAVE JUNCTION 02/15/2011 11215.00000 42-09-23.4 N Page 8 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WQHP255 122-01-57.7 W 0004616037 WiLine Networks Inc. Cupertino 02/15/2011 22925.00000 37-19-23.7 N CA MD WQGG371 122-24-04.1 W 0004616046 Wiline Networks Inc San Francisco 02/15/2011 19625.00000 37-47-24.0 N CA MD WPUP638 117-41-11.0 W 0004617140 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 02/16/2011 10735.00000 35-37-25.0 N CA MD WPUP638 117-41-11.0 W 0004617140 NEW CINGULAR WIRELESS PCS, LLCRIDGECREST 02/16/2011 10915.00000 35-37-25.0 N OR MD WMS209 121-03-19.0 W 0004617199 OREGON RSA #2, INC. DUFUR 02/16/2011 06555.00000 45-18-34.0 N OR MD WMS209 121-03-19.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304791A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304791A1.txt  
- - 6425.0000 MHz 9M00G1W 80.00 dBW DIGITAL 5925.0000 - 6425.0000 MHz 26M0G7W 80.00 dBW QPSK DIGITAL VIDEO AND DATA 5925.0000 - 6425.0000 MHz 36M0G7W ANALOG 3700.0000 - 4200.0000 MHz 36M0F3F DIGITAL 3700.0000 - 4200.0000 MHz 4M50G1W DIGITAL 3700.0000 - 4200.0000 MHz 9M00G1W DIGITAL 3700.0000 - 4200.0000 MHz 26M0G7W QPSK DIGITAL VIDEO AND DATA 3700.0000 - 4200.0000 MHz 36M0G7W COMTECH 3 4.1 meters ANTENNA ID: "18FT OFFSAT"-847130 72.40 dBW ANALOG 5925.0000 - 6425.0000 MHz 36M0F3F 75.70 dBW DIGITAL 5925.0000 - 6425.0000 MHz 4M50G1W 75.70 dBW DIGITAL 5925.0000 - 6425.0000 MHz 9M00G1W 75.70 dBW DIGITAL 5925.0000 - 6425.0000 MHz 26M0G7W 75.70 dBW QPSK DIGITAL VIDEO AND DATA 5925.0000 - 6425.0000 MHz 36M0G7W ANALOG 3700.0000 - 4200.0000 MHz 36M0F3F DIGITAL 3700.0000 - 4200.0000 MHz 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304910A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304910A1.txt  
- N WA MD WQHG252 122-04-16.2 W 0004627982 Oregon State (OWIN) WASHINGTON 02/23/2011 05945.20000 45-41-01.3 N WA MD WQHG252 122-04-16.2 W 0004627982 Oregon State (OWIN) WASHINGTON 02/23/2011 06034.15000 45-41-01.3 N WA MD WQHG252 122-04-16.2 W 0004627982 Oregon State (OWIN) WASHINGTON 02/23/2011 06063.80000 45-41-01.3 N WA MD WQHG252 122-04-16.2 W 0004627982 Oregon State (OWIN) WASHINGTON 02/23/2011 06093.45000 45-41-01.3 N OR MD WQHF919 122-33-04.1 W 0004627987 Oregon State (OWIN) Happy Valley 02/23/2011 06286.19000 45-27-16.0 N OR MD WQHF919 122-33-04.1 W 0004627987 Oregon State (OWIN) Happy Valley 02/23/2011 06315.84000 45-27-16.0 N OR MD WQHF919 122-33-04.1 W 0004627987 Oregon State (OWIN) Happy Valley 02/23/2011 06345.49000 45-27-16.0 N OR MD WQHF919 122-33-04.1 W 0004627987 Oregon State (OWIN) Happy Valley 02/23/2011 10755.00000 45-27-16.0 N OR MD WQJN990 121-05-28.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304911A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-304911A1.txt  
- LLC Avondale 02/22/2011 10935.00000 32-58-11.0 N TX NE 097-56-30.7 W 0004623841 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11425.00000 32-42-13.2 N TX NE 097-47-00.7 W 0004623842 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10775.00000 32-43-08.6 N TX NE 097-47-00.7 W 0004623842 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10935.00000 32-43-08.6 N TX NE 097-42-27.6 W 0004623843 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11385.00000 32-38-04.1 N TX NE 097-37-19.3 W 0004623844 Wireless Infrastructure Partners, LLC Aledo 02/22/2011 10895.00000 32-41-59.8 N TX NE 097-48-34.3 W 0004623845 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11265.00000 32-39-16.6 N TX NE 097-48-12.3 W 0004623846 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11225.00000 32-47-58.0 N TX NE 097-45-47.0 W 0004623847 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10735.00000 32-51-03.1 N TX NE 097-30-15.2 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305046A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305046A1.txt  
- Fones West Digital Systems Inc 03/04/2011 RO WPSH600 0004640125 Fones West Digital Systems Inc 03/04/2011 RO WPSH796 0004640126 Fones West Digital Systems Inc 03/04/2011 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD KNKN815 099-18-36.2 W 0004639932 Alltel Communications, LLC Coldwater 03/03/2011 37-15-57.0 N KS MD KNKN815 098-56-04.1 W 0004639932 Alltel Communications, LLC Sun City 03/03/2011 37-16-45.6 N NV MD KNKN224 117-41-59.4 W 0004640246 WWC License LLC McDermitt 03/04/2011 41-59-34.1 N KS MD KNKN801 099-18-36.2 W 0004640378 Alltel Communications, LLC Coldwater 03/04/2011 37-15-57.0 N IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305196A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305196A1.txt  
- NJ AM KNKN836 074-08-34.2 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCHARVEY CEDARS 03/09/2011 39-41-34.8 N NJ AM KNKN836 074-20-19.5 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCJackson 03/09/2011 40-09-07.4 N NJ AM KNKN836 074-21-26.5 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCLAKEHURST 03/09/2011 40-04-15.4 N NJ AM KNKN836 074-13-58.5 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCLakewood 03/09/2011 40-04-15.4 N NJ AM KNKN836 074-22-04.1 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCLittle Egg Harbor 03/09/2011 39-34-28.0 N Page 23 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NJ AM KNKN836 074-12-37.1 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCLONG BEACH 03/09/2011 39-36-14.8 N NJ AM KNKN836 074-15-09.4 W 0004401887 NEW CINGULAR WIRELESS PCS, LLCMANAHAWKIN 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305296A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305296A1.txt  
- Fixed Wireless 37 20 57 79 137 163 90 16 3 1 489 546 Mobile Wireless * * 14,948 15,894 24,982 9,859 1,601 3,891 * * 56,228 71,177 Power Line and Other 0 0 0 * * * * 0 * * 6 6 Total 9,083 10,164 19,247 18,241 31,821 23,218 13,599 17,185 28,861 749 133,673 152,920 Percentages aDSL 3.4 4.1 7.5 6.4 18.9 30.6 29.2 5.7 1.6 0.0 92.5 100.0 sDSL 0.0 0.0 0.0 36.3 37.6 * 5.3 0.9 * 0.1 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.3 10.3 58.0 11.6 3.9 3.4 4.6 100.0 100.0 Cable Modem 0.3 1.9 2.2 0.3 1.6 6.9 5.9 26.0 56.3 0.8 97.8 100.0 FTTP 0.1 0.0 0.1 0.4 1.2 2.3 5.1 2.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305297A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305297A1.txt  
- Telephone Competition: Status as of June 30, 2010 28 Zero 17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% 7.1% One 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 8.7 Two 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 7.4 Three 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 6.2 Four 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 5.2 Five 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 4.7 Six 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 4.2 Seven 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 3.6 Eight 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 3.4 Nine 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 2.8 Ten or More 35.3 34.0 33.5 33.1 33.6 44.7 44.0 44.0 46.6 Zero 2.3% 2.4% 2.4% 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305324A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305324A1.txt  
- 03/14/2011 00952.21875 33-48-07.5 N CA NE 115-51-58.0 W 0004651224 IMPERIAL IRRIGATION DISTRICT NORTH SHORE 03/14/2011 00928.00625 33-29-05.0 N CA NE 115-51-58.0 W 0004651224 IMPERIAL IRRIGATION DISTRICT NORTH SHORE 03/14/2011 00952.00625 33-29-05.0 N CA NE 115-23-17.5 W 0004651231 IMPERIAL IRRIGATION DISTRICT HOLTVILLE 03/14/2011 00928.26875 32-48-45.4 N CA NE 115-23-17.5 W 0004651231 IMPERIAL IRRIGATION DISTRICT HOLTVILLE 03/14/2011 00952.26875 32-48-45.4 N CA NE 115-26-04.1 W 0004651372 IMPERIAL IRRIGATION DISTRICT NILAND 03/14/2011 00928.11875 33-11-30.5 N CA NE 115-26-04.1 W 0004651372 IMPERIAL IRRIGATION DISTRICT NILAND 03/14/2011 00952.11875 33-11-30.5 N CA NE 114-31-03.0 W 0004651379 IMPERIAL IRRIGATION DISTRICT BARD 03/14/2011 00928.01875 32-49-59.6 N CA NE 114-31-03.0 W 0004651379 IMPERIAL IRRIGATION DISTRICT BARD 03/14/2011 00952.01875 32-49-59.6 N MT NE 109-08-16.6 W 0004651713 Interoperability Montana Columbus 03/15/2011 06404.79000 45-30-43.3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305453A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305453A1.txt  
- N VA MD KNKN662 077-21-15.4 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCFREDERICKSBURG 03/21/2011 38-17-52.7 N VA MD KNKN662 078-10-37.4 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCGordonsville 03/21/2011 38-08-06.3 N VA MD KNKN662 077-54-49.6 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCJEFFERSONTON 03/21/2011 38-40-51.0 N VA MD KNKN662 078-03-15.7 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCLouisa 03/21/2011 37-58-22.4 N VA MD KNKN662 078-28-04.1 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCLURAY 03/21/2011 38-41-09.8 N VA MD KNKN662 078-17-48.6 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMadison 03/21/2011 38-23-42.9 N VA MD KNKN662 077-54-58.3 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMineral 03/21/2011 37-56-01.9 N VA MD KNKN662 077-55-26.5 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMineral 03/21/2011 38-02-13.8 N VA MD KNKN662 078-07-14.0 W 0004659730 NEW CINGULAR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305465A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305465A1.txt  
- of Service: Fixed Satellite Service "MOD" to change emission designator and related service. 38 ° 57 ' 55.00 " N LAT. SITE ID: 1 1120 WEST 11TH STREET, DOUGLAS, LAWRENCE, KS 95 ° 15 ' 0.00 " W LONG. LOCATION: Page 6 of 7 For more information concerning this Notice, contact the Satellite Division at 418-0719; TTY 202-418-2555. COMTECH 1 4.1 meters ANTENNA ID: 847130-G2 52.50 dBW 5925.0000 - 6425.0000 MHz 100KF1D 52.51 dBW 5925.0000 - 6425.0000 MHz 200KF1D 55.50 dBW 5925.0000 - 6423.0000 MHz 200KF1D 3700.0000 - 4200.0000 MHz 100KF1D 3700.0000 - 4200.0000 MHz 200KF1D 3700.0000 - 4200.0000 MHz 200KF1D Points of Communication: 1 - ALSAT - (ALSAT) Page 7 of 7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305779A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305779A1.pdf  
- Will we make it today, I don't know, but I think we have to recognize that the choice that gets made today could have some long lasting consequences that we just need to be clear about. MS. MILLER: Anna Miller with T-Mobile. Just a couple of comments and a request. First of all in the Sprint/T-Mobile sponsored report in section 4.1.3.1, it talks about the number portability orders that stated that information should be limited to that necessary to route telephone calls to the appropriate service providers. And it points out that -- I guess it gives a better context of that statement because it points out that they were really concerned about having too much information in there associated with 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305942A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-305942A1.txt  
- 03/16/2011 WQDT881 FXO Clearwire Hawaii Partners Spectrum LLC 10915.00000000 Honolulu 21-23-55.1 N HI 157-58-45.7 W5 1 Page 3 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 03/16/2011 WQDT908 FXO Clearwire Hawaii Partners Spectrum LLC 11225.00000000 Ewa Beach 21-19-47.6 N HI 158-2-4.1 W 3 1 03/16/2011 WQDT908 FXO Clearwire Hawaii Partners Spectrum LLC 11305.00000000 Ewa Beach 21-19-47.6 N HI 158-2-4.1 W 3 1 03/11/2011 WQDT913 FXO Clearwire Hawaii Partners Spectrum LLC 19425.00000000 Honolulu 21-18-21.4 N HI 157-52-38.2 W2 1 03/15/2011 WQDT914 FXO Clearwire Hawaii Partners Spectrum LLC 11015.00000000 Kihei 20-44-53.9 N HI 156-26-17.3 W5 1 03/15/2011 WQDT914 FXO Clearwire Hawaii Partners Spectrum 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306296A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306296A1.txt  
- 0004705178 Clearwire Hawaii Partners Spectrum LLCHonolulu 04/26/2011 19480.00000 21-20-09.8 N HI MD WQDT680 157-48-45.3 W 0004705178 Clearwire Hawaii Partners Spectrum LLCHonolulu 04/26/2011 21825.00000 21-20-09.8 N CO MD WQNF332 104-43-07.9 W 0004706342 San Isabel Electric Association, Inc. Segundo 04/27/2011 00957.55000 37-06-28.1 N CO MD WQNF334 104-30-57.0 W 0004706348 San Isabel Electric Association, Inc. Trinidad 04/27/2011 00953.95000 37-14-17.5 N OH MD WPNL700 081-41-04.1 W 0004707081 WKYC-TV, Inc. CLEVELAND 04/27/2011 23420.00000 41-30-12.6 N CO MD WNEG893 108-24-55.3 W 0004707282 Xcel Energy Services Inc. GRAND JUNCTION 04/27/2011 06615.62500 39-02-48.9 N CO MD WNEW397 108-13-40.3 W 0004707299 Xcel Energy Services Inc. PALISADE 04/27/2011 06423.75000 39-05-18.9 N CO MD WNEW397 108-13-40.3 W 0004707299 Xcel Energy Services Inc. PALISADE 04/27/2011 06775.62500 39-05-18.9 N TX NE 094-04-38.3 W 0004701746 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306318A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306318A1.txt  
- of Station: Fixed Earth Stations Grant of Authority 08/12/2004 - 08/12/2019 Application for Modification University of Kansas Nature of Service: Fixed Satellite Service "MOD" to change emission designator and related service. 38 ° 57 ' 55.00 " N LAT. SITE ID: 1 1120 WEST 11TH STREET, DOUGLAS, LAWRENCE, KS 95 ° 15 ' 0.00 " W LONG. LOCATION: COMTECH 1 4.1 meters ANTENNA ID: 847130-G2 52.50 dBW 5925.0000 - 6425.0000 MHz 100KF1D 52.51 dBW 5925.0000 - 6425.0000 MHz 200KF1D 55.50 dBW 5925.0000 - 6423.0000 MHz 200KF1D 3700.0000 - 4200.0000 MHz 100KF1D 3700.0000 - 4200.0000 MHz 200KF1D 3700.0000 - 4200.0000 MHz 200KF1D Points of Communication: 1 - ALSAT - (ALSAT) E110037 SES-REG-20110321-00324 E Date Effective: 05/02/2011 Class of Station: Fixed Earth Stations 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306419A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306419A1.txt  
- United Wireless Communications, Inc. Fowler 05/04/2011 10715.00000 37-22-40.3 N KS NE 100-11-47.6 W 0004715956 United Wireless Communications, Inc. Fowler 05/04/2011 10915.00000 37-22-40.3 N TX NE 096-16-33.4 W 0004716000 Heath Internet /Wi-Five TERRELL 05/04/2011 10735.00000 32-47-48.8 N TX NE 096-16-33.4 W 0004716000 Heath Internet /Wi-Five TERRELL 05/04/2011 10815.00000 32-47-48.8 N TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 10935.00000 32-45-04.1 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 11015.00000 32-45-04.1 N TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 11225.00000 32-45-04.1 N TX NE 096-28-13.8 W 0004716001 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306654A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306654A1.txt  
- 05/12/2011 17750.00000 13-26-33.0 N GU NE 144-52-26.8 E 0004725603 PTI Pacifica Inc. Yigo 05/12/2011 11115.00000 13-32-58.2 N GU NE 144-45-47.2 E 0004725605 PTI Pacifica Inc. Yona 05/12/2011 11225.00000 13-22-54.8 N GU NE 144-44-37.0 E 0004725606 PTI Pacifica Inc. Agana Hts 05/12/2011 17770.00000 13-28-16.3 N GU NE 144-42-23.8 E 0004725609 PTI Pacifica Inc. Santa Rita 05/12/2011 11355.00000 13-24-01.1 N GU NE 144-52-04.1 E 0004725610 PTI Pacifica Inc. Dededo 05/12/2011 11075.00000 13-34-47.3 N GU NE 144-44-26.9 E 0004725611 PTI Pacifica Inc. Talofofo 05/12/2011 10865.00000 13-21-42.5 N GU NE 144-44-26.9 E 0004725611 PTI Pacifica Inc. Talofofo 05/12/2011 11055.00000 13-21-42.5 N GU NE 144-39-56.1 E 0004725612 PTI Pacifica Inc. Umatac 05/12/2011 11245.00000 13-17-34.4 N GU NE 144-52-02.3 E 0004725614 PTI Pacifica Inc. Yigo 05/12/2011 10895.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306818A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306818A1.txt  
- WV DHHR BPH, Office of EMS, CommunWelch 05/20/2011 06063.80000 37-21-55.2 N WV MD WQKM333 081-41-07.8 W 0004736789 WV DHHR BPH, Office of EMS, CommunWelch 05/20/2011 06093.45000 37-21-55.2 N WV MD WQKM333 081-41-07.8 W 0004736789 WV DHHR BPH, Office of EMS, CommunWelch 05/20/2011 06152.75000 37-21-55.2 N WV MD WQFC437 080-13-30.8 W 0004736790 WV DHHR BPH, Office of EMS, CommunFairview 05/20/2011 05945.20000 39-38-04.1 N WV MD WQFC437 080-13-30.8 W 0004736790 WV DHHR BPH, Office of EMS, CommunFairview 05/20/2011 05974.85000 39-38-04.1 N WV MD WQFC437 080-13-30.8 W 0004736790 WV DHHR BPH, Office of EMS, CommunFairview 05/20/2011 06034.15000 39-38-04.1 N WV MD WQFC437 080-13-30.8 W 0004736790 WV DHHR BPH, Office of EMS, CommunFairview 05/20/2011 06093.45000 39-38-04.1 N WV MD WQFC437 080-13-30.8 W 0004736790 WV DHHR 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306919A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-306919A1.txt  
- MULTICOMM, INC. 05/27/2011 00465.75000 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00465.85000 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00465.87500 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00466.27500 PA MD WPKR443 078-07-51.0 W 0004745234 MULTICOMM, INC. HUNTINGDON 05/27/2011 00460.85000 40-29-50.3 N PA MD WPKR443 078-07-51.0 W 0004745234 MULTICOMM, INC. HUNTINGDON 05/27/2011 00461.27500 40-29-50.3 N PA MD WPKR443 078-54-04.1 W 0004745234 MULTICOMM, INC. JOHNSTOWN 05/27/2011 00460.72500 40-26-25.3 N PA MD WPKR443 078-54-04.1 W 0004745234 MULTICOMM, INC. JOHNSTOWN 05/27/2011 00460.87500 40-26-25.3 N PA MD WPKR443 077-53-22.0 W 0004745234 MULTICOMM, INC. PINE GROVE MILLS 05/27/2011 00460.75000 40-42-56.2 N MD WPDN412 A 0004745236 MULTICOMM, INC. 05/27/2011 00460.65000 MD WPDN412 A 0004745236 MULTICOMM, INC. 05/27/2011 00465.65000 PA MD WPDN412 X 0004745236 MULTICOMM, INC. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307209A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307209A1.txt  
- 23030.00000 42-11-14.1 N IA NE 093-27-37.0 W 0004747562 airBand Communications, Inc. Bondurant 05/31/2011 21975.00000 41-42-08.1 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IA NE 093-36-01.6 W 0004747563 airBand Communications, Inc. Story City 05/31/2011 21830.00000 42-11-16.6 N NV NE 115-03-04.1 W 0004747564 airBand Communications, Inc. Las Vegas 05/31/2011 11035.00000 35-56-49.3 N NV NE 115-05-23.1 W 0004747565 airBand Communications, Inc. Henderson 05/31/2011 11525.00000 36-01-15.9 N CA NE 117-37-06.0 W 0004747640 New Cingular Wireless PCS, LLC Red Mountain 05/31/2011 19645.00000 35-19-27.2 N PR NE 065-58-02.5 W 0004747658 PR Wireless, Inc. Trujillo Alto 05/31/2011 11165.00000 18-19-36.9 N CA NE 122-09-43.3 W 0004747796 WiLine 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307210A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307210A1.txt  
- 0004749102 Cricket License Company, LLC Radar Base, TX 06/01/2011 11305.00000 28-51-57.2 N TX MD WQHR620 100-32-53.9 W 0004749102 Cricket License Company, LLC Radar Base, TX 06/01/2011 11505.00000 28-51-57.2 N TX MD WQHR620 100-32-53.9 W 0004749102 Cricket License Company, LLC Radar Base, TX 06/01/2011 11585.00000 28-51-57.2 N TX MD WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/01/2011 10735.00000 29-02-04.1 N TX MD WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/01/2011 10775.00000 29-02-04.1 N Page 17 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/01/2011 10815.00000 29-02-04.1 N TX MD WQHR618 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307406A1.pdf  
- citing Campaign Media Analysis Group/Television Bureau of Advertising POLITICAL SPENDING ON LOCAL TV Non-election Year Election Year RETRANSMISSION FEES FOR LOCAL TELEVISION SIGNALS Source: Pew State of the News Media 201133 *Projected for 20102012 $2,000 $1,500 $1,000 $500 $0 2006 2007 2008 2009 2010* 2011* 2012* Spending (in millions) There Is More Local TV News 2005 2003 3.7 3.6 3.8 4.1 4.1 4.6 5.0 2006 2004 2007 2008 2009 2 3 4 5 Source: Radio Television Digital News Association (RTDNA)/Hofstra Surveys based on survey responses of news directors37 All News Stations, Big 4 A liates and Other Stations Big Four A liates: Other Commercial Changes ABC, CBS, NBC, Fox Broadcast TV Stations Added a Newscast 28.2% 42.9% Cut a Newscast 12.5% 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307527A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307527A1.txt  
- 0004749102 Cricket License Company, LLC Radar Base, TX 06/07/2011 11305.00000 28-51-57.2 N TX AM WQHR620 100-32-53.9 W 0004749102 Cricket License Company, LLC Radar Base, TX 06/07/2011 11505.00000 28-51-57.2 N TX AM WQHR620 100-32-53.9 W 0004749102 Cricket License Company, LLC Radar Base, TX 06/07/2011 11585.00000 28-51-57.2 N TX AM WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/07/2011 10735.00000 29-02-04.1 N TX AM WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/07/2011 10775.00000 29-02-04.1 N TX AM WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/07/2011 10815.00000 29-02-04.1 N TX AM WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, TX 06/07/2011 10855.00000 29-02-04.1 N TX AM WQHR618 100-38-19.0 W 0004749104 Cricket License Company, LLC Quemado, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307528A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307528A1.txt  
- WMN299 071-16-02.1 W 0004760123 New Cingular Wireless PCS, LLC CANDIA 06/10/2011 11622.50000 43-03-11.8 N CA MD WPXH205 118-06-22.4 W 0004760136 Los Angeles SMSA Limited Partnership Cerritos 06/10/2011 10657.50000 33-52-29.0 N CA MD WPXH205 118-06-22.4 W 0004760136 Los Angeles SMSA Limited Partnership Cerritos 06/10/2011 11525.00000 33-52-29.0 N CA MD WMQ712 118-11-22.3 W 0004760147 Los Angeles SMSA Limited Partnership Compton 06/10/2011 05974.85000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004760147 Los Angeles SMSA Limited Partnership Compton 06/10/2011 06063.80000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004760147 Los Angeles SMSA Limited Partnership Compton 06/10/2011 10552.50000 33-53-04.1 N Page 5 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307529A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307529A1.txt  
- 06/08/2011 10775.00000 30-26-07.4 N WA NE 122-18-45.1 W 0004757125 EASTSIDE PUBLIC SAFETY COMMUNICRONALD 06/08/2011 11285.00000 47-45-32.3 N WA NE 122-18-45.1 W 0004757125 EASTSIDE PUBLIC SAFETY COMMUNICRONALD 06/08/2011 11325.00000 47-45-32.3 N CA NE 117-40-22.9 W 0004758295 Inland Empire Utilities Agency Chino 06/09/2011 17765.00000 33-57-58.5 N CA NE 117-40-22.9 W 0004758295 Inland Empire Utilities Agency Chino 06/09/2011 19625.00000 33-57-58.5 N CA NE 117-36-04.1 W 0004758296 Inland Empire Utilities Agency Ontario 06/09/2011 19325.00000 34-01-47.2 N CA NE 117-34-29.9 W 0004758297 Inland Empire Utilities Agency Rancho Cucamonga 06/09/2011 19325.00000 34-10-01.5 N CA NE 117-34-29.9 W 0004758297 Inland Empire Utilities Agency Rancho Cucamonga 06/09/2011 19525.00000 34-10-01.5 N CA NE 117-34-29.9 W 0004758297 Inland Empire Utilities Agency Rancho Cucamonga 06/09/2011 19625.00000 34-10-01.5 N CA NE 117-41-37.3 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307787A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307787A1.txt  
- 088-47-36.0 W 0004761965 NTCH-West Tenn, Inc. Greenfield 06/13/2011 11505.00000 36-08-48.0 N VA NE 076-57-51.3 W 0004762039 RAPPAHANNOCK ELECTRIC COOPERATAPPAHANNOCK 06/13/2011 06197.24000 37-53-31.6 N TN NE 088-50-56.0 W 0004762077 NTCH-West Tenn, Inc. Martin 06/13/2011 10815.00000 36-20-32.7 N TN NE 088-50-56.0 W 0004762077 NTCH-West Tenn, Inc. Martin 06/13/2011 10895.00000 36-20-32.7 N TX NE 095-30-27.8 W 0004762079 Franklin Group Inc. Houston 06/13/2011 11585.00000 29-51-04.1 N TX NE 095-30-27.8 W 0004762079 Franklin Group Inc. Houston 06/13/2011 11625.00000 29-51-04.1 N Page 45 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN NE 088-42-40.0 W 0004762112 NTCH-West Tenn, Inc. Dresden 06/13/2011 11305.00000 36-18-07.0 N TN NE 088-42-40.0 W 0004762112 NTCH-West Tenn, Inc. Dresden 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307788A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307788A1.txt  
- 31-52-07.0 N TX NE 102-19-25.8 W 0004764534 Conterra Ultra Broadband LLC Odessa 06/14/2011 10755.00000 31-53-50.0 N TX NE 102-24-11.1 W 0004764535 Conterra Ultra Broadband LLC Odessa 06/14/2011 11445.00000 31-50-51.9 N WY NE 109-55-32.0 W 0004765315 Cellular, Inc. Financial Corporation Pinedale 06/15/2011 06034.15000 42-50-39.0 N WY NE 110-13-50.8 W 0004765316 Cellular, Inc. Financial Corporation Daniel 06/15/2011 06286.19000 43-06-21.0 N TN NE 084-33-04.1 W 0004765331 Verizon Wireless Tennessee PartnershipDelano 06/15/2011 06555.00000 35-15-59.6 N TX NE 095-07-40.0 W 0004765478 GTE Mobilnet of South Texas Limited PartPasadena 06/15/2011 06286.19000 29-39-21.0 N TX NE 095-12-09.1 W 0004765483 GTE Mobilnet of South Texas Limited PartHouston 06/15/2011 06034.15000 29-36-50.9 N TX NE 097-00-41.0 W 0004765487 Nortex Communications Company Whitesboro 06/15/2011 10915.00000 33-44-43.1 N TX NE 097-01-19.9 W 0004765492 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307797A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-307797A1.txt  
- N NE 97-22-23.0 W 2 1 05/17/2011 WQIY753 MO Nucor Steel 452.76250000 NORFOLK 42-4-36.0 N NE 97-22-23.0 W 2 1 05/17/2011 WQIY753 MO Nucor Steel 452.81250000 NORFOLK 42-4-36.0 N NE 97-22-23.0 W 2 1 05/17/2011 WQIY753 MO Nucor Steel 452.88750000 NORFOLK 42-4-36.0 N NE 97-22-23.0 W 2 1 05/19/2011 WQLX560 MO Norfolk Southern Railway Company 160.95000000 AUGUSTA 33-27-43.8 N GA 81-58-4.1 W 2 1 Page 3 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 05/18/2011 WQDH762 FXO Fixed Wireless Holdings, LLC 11015.00000000 Harker Heights 31-4-38.0 N TX 97-39-24.0 W 3 1 05/16/2011 WQDU374 FXO Clearwire Hawaii Partners Spectrum LLC 17915.00000000 Honolulu 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308077A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308077A1.txt  
- Glendale 06/23/2011 10915.00000 34-08-50.1 N CA MD WEH405 118-14-53.0 W 0004777915 GLENDALE, CITY OF Glendale 06/23/2011 19375.00000 34-08-50.1 N CA MD WQAY543 118-11-02.3 W 0004777917 GLENDALE, CITY OF Glendale 06/23/2011 10995.00000 34-09-35.4 N CA MD WQAY543 118-11-02.3 W 0004777917 GLENDALE, CITY OF Glendale 06/23/2011 17825.00000 34-09-35.4 N CA MD WQAY541 118-19-17.5 W 0004777920 GLENDALE, CITY OF Los Angeles 06/23/2011 11525.00000 34-08-04.1 N CA MD WQAY541 118-19-17.5 W 0004777920 GLENDALE, CITY OF Los Angeles 06/23/2011 19585.00000 34-08-04.1 N CA MD WQAZ480 118-15-23.0 W 0004777923 GLENDALE, CITY OF Glendale 06/23/2011 06715.00000 34-11-14.0 N CA MD WQAZ480 118-15-23.0 W 0004777923 GLENDALE, CITY OF Glendale 06/23/2011 06755.00000 34-11-14.0 N CA MD WQAZ480 118-15-23.0 W 0004777923 GLENDALE, CITY OF Glendale 06/23/2011 06865.00000 34-11-14.0 N CA MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308243A3.doc  
- of Contents Executive Summary 1 Section 1.0 Background 2 Section 2.0 Issues 5 Section 3.0 NANC Dispute Process 5 3.1 The Formal Dispute Process 5 3.2 Initial Scheduling and Comment Round 5 3.2.1 Initial Scheduling 5 3.2.2 Comments Received - August 2009 6 3.3 FCC Docket 09-109 8 3.4 Interim Report and Second Comment Round 9 Section 4.0 Analysis 11 4.1 The Adoption of the Change Orders Was Not Substantively Defective 11 4.1.1 Telcordia's Argument 11 4.1.2 IP Voice, SMS, and MMS Constitute ``Telephone Calls'' 11 4.1.3 The URIs Are ``Necessary to Route Telephone Calls'' 13 4.2 Telcordia's Procedural Arguments Are Moot 17 Section 5.0 Conclusion and Recommendation 18 Executive Summary The North American Numbering Council ("NANC") herein addresses a request 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308247A1.doc  
- training opportunities Initiated with NANPA website training and also used for NRUF training. Surveys of NANPA website training participants and NRUF training participants indicated a high level of satisfaction with the training sessions. Use of WebEx on monthly NANPA/NOWG monthly calls Began in September, 2010 See Appendix B for the final 2010 PIP Report. Section 4.0 2010 Performance Survey Results 4.1 Survey Ratings - Quantitative Analysis The NANPA 2010 Performance Surveys were completed by a total of 74 respondents. The respondents were comprised of 29 state regulators and 45 service providers. The results are as follows: CO (NXX) Administration (Section A) There were four questions in this section to which respondents provided the following aggregated response ratings: 74 as Exceeded 57 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308346A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308346A1.txt  
- LLC Livonia 07/07/2011 11365.00000 30-42-18.4 N ME NE 069-00-27.8 W 0004794432 MAINE RSA #1, INC. Belfast 07/07/2011 06286.19000 44-26-49.5 N MO NE 092-36-16.1 W 0004795463 USCOC OF GREATER MISSOURI, LLCCalifornia 07/08/2011 06595.00000 38-28-56.8 N MO NE 092-27-04.9 W 0004795468 USCOC OF GREATER MISSOURI, LLCRusselville 07/08/2011 06755.00000 38-30-28.2 N ME NE 069-52-08.3 W 0004796159 MAINE RSA #1, INC. Belgrade 07/08/2011 06315.84000 44-29-04.1 N CA NE 117-20-54.0 W 0004796170 Los Angeles SMSA Limited Partnership San Bernardino 07/08/2011 11155.00000 34-07-17.6 N PA RM WPTE339 078-59-00.9 W 0004789627 Cellco Partnership Johnstown 07/05/2011 10715.00000 40-22-15.5 N PA RM WPTE339 078-59-00.9 W 0004789627 Cellco Partnership Johnstown 07/05/2011 10795.00000 40-22-15.5 N PA RM WPTE339 078-59-00.9 W 0004789627 Cellco Partnership Johnstown 07/05/2011 10875.00000 40-22-15.5 N PA RM WPTE339 078-59-00.9 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308467A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308467A1.txt  
- WQLD709 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23375.00000000 Dallas 32-46-16.3 N TX 96-46-43.3 W 3 1 06/15/2011 WQLD709 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23475.00000000 Dallas 32-46-16.3 N TX 96-46-43.3 W 3 1 06/15/2011 WQLD710 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21925.00000000 Dallas 32-56-26.0 N TX 96-49-16.0 W 1 1 06/15/2011 WQLD717 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19575.00000000 GRAPEVINE 32-55-4.1 N TX 97-3-53.4 W 1 1 06/15/2011 WQLD717 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19675.00000000 GRAPEVINE 32-55-4.1 N TX 97-3-53.4 W 1 1 06/15/2011 WQLD717 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19475.00000000 GRAPEVINE 32-55-4.1 N TX 97-3-53.4 W 2 1 06/15/2011 WQLD723 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 Dallas 32-51-42.0 N TX 96-50-58.2 W 1 1 06/15/2011 WQLD726 FXO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308471A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308471A1.txt  
- N WI MD KNKA214 088-19-11.3 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSDELAFIELD 07/13/2011 43-02-14.0 N WI MD KNKA214 088-28-54.2 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSEAGLE 07/13/2011 42-53-09.0 N Page 27 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WI MD KNKA214 088-01-34.3 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSFRANKLIN 07/13/2011 42-54-04.1 N WI MD KNKA214 087-56-26.3 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSGLENDALE 07/13/2011 43-07-47.0 N WI MD KNKA214 087-55-49.0 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSGRAFTON 07/13/2011 43-19-00.0 N WI MD KNKA214 087-57-04.2 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSGRAFTON 07/13/2011 43-20-40.6 N WI MD KNKA214 088-18-30.3 W 0004801353 MILWAUKEE SMSA LIMITED PARTNERSHartford 07/13/2011 43-19-19.0 N WI MD KNKA214 088-23-34.4 W 0004801353 MILWAUKEE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308627A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308627A1.txt  
- EMS, CommunMorgantown 07/22/2011 06345.49000 39-41-43.6 N WV MD WQKM241 079-45-45.6 W 0004812072 WV DHHR BPH, Office of EMS, CommunMorgantown 07/22/2011 06375.14000 39-41-43.6 N WV MD WQKM241 079-45-45.6 W 0004812072 WV DHHR BPH, Office of EMS, CommunMorgantown 07/22/2011 06404.79000 39-41-43.6 N WV MD WQKM241 079-45-45.6 W 0004812072 WV DHHR BPH, Office of EMS, CommunMorgantown 07/22/2011 06555.00000 39-41-43.6 N MD MD WPQX317 079-18-04.1 W 0004812074 WV DHHR BPH, Office of EMS, CommunThayerville 07/22/2011 06034.15000 39-31-11.3 N MD MD WPQX317 079-18-04.1 W 0004812074 WV DHHR BPH, Office of EMS, CommunThayerville 07/22/2011 06063.80000 39-31-11.3 N FL MD WQNY600 083-49-28.7 W 0004812338 North Florida Broadband Authority MONTICELLO 07/22/2011 10735.00000 30-23-30.5 N Page 9 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308628A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308628A1.txt  
- CITY 07/19/2011 10815.00000 38-52-29.7 N AZ NE 111-40-57.0 W 0004808220 T-MOBILE LICENSE LLC QUEEN CREEK 07/19/2011 23070.00000 33-12-42.7 N AZ NE 112-25-57.0 W 0004808222 T-MOBILE LICENSE LLC Goodyear 07/19/2011 19360.00000 33-27-48.0 N AZ NE 112-26-13.3 W 0004808223 T-MOBILE LICENSE LLC Surprise 07/19/2011 17920.00000 33-38-27.1 N AZ NE 112-27-40.9 W 0004808224 T-MOBILE LICENSE LLC Surprise 07/19/2011 19480.00000 33-34-53.5 N HI NE 158-02-04.1 W 0004808225 T-MOBILE LICENSE LLC Ewa Beach 07/19/2011 23270.00000 21-19-47.6 N HI NE 158-00-52.7 W 0004808226 T-MOBILE LICENSE LLC Ewa Beach 07/19/2011 22070.00000 21-19-00.9 N AZ NE 112-13-11.1 W 0004808227 T-MOBILE LICENSE LLC Peoria 07/19/2011 23220.00000 33-33-35.2 N AZ NE 112-14-24.6 W 0004808228 T-MOBILE LICENSE LLC PHOENIX 07/19/2011 22020.00000 33-33-12.0 N TX NE 096-51-14.8 W 0004808229 airBand Communications, Inc. Addison 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308828A2.txt  
- request, and shall not provide such data in any form to the FCC. The Participant further consents to transmission of information from this Program Internationally, including the information provided by the Participant's ISP, specifically the transfer of this information to SamKnows in the United Kingdom, SamKnows' processing of it there and return to the United States. 4. Intellectual Property Rights 4.1 All Intellectual Property Rights relating to the Whitebox are the property of its manufacturer. The Participant shall use the Whitebox only to allow SamKnows to provide the Services. 4.2 As between SamKnows and the Participant, SamKnows owns all Intellectual Property Rights in the Software. The Participant shall not translate, copy, adapt, vary or alter the Software. The Participant shall use 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308856A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308856A1.txt  
- 1 1 06/30/2011 WQLE841 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21975.00000000 LANCASTER 32-36-15.0 N TX 96-46-11.0 W 2 1 Page 10 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 06/30/2011 WQLE872 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21825.00000000 Fort Worth 32-42-4.1 N TX 97-16-39.1 W 1 1 06/30/2011 WQLE872 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11225.00000000 Fort Worth 32-42-4.1 N TX 97-16-39.1 W 3 1 06/30/2011 WQLE872 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11425.00000000 Fort Worth 32-42-4.1 N TX 97-16-39.1 W 3 1 06/30/2011 WQLE872 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21975.00000000 Fort Worth 32-42-4.1 N TX 97-16-39.1 W 5 1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308978A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-308978A1.txt  
- 107-07-01.0 W 0004827716 SkyWerx Industries, LLC Pagosa Springs, CO 08/04/2011 11365.00000 37-11-48.0 N CO MD WQJA757 107-07-01.0 W 0004827716 SkyWerx Industries, LLC Pagosa Springs, CO 08/04/2011 11445.00000 37-11-48.0 N LA MD WQCZ351 092-40-39.0 W 0004828586 CLECO Power LLC OAKDALE 08/04/2011 06063.80000 30-47-56.0 N LA MD WQCZ351 092-40-39.0 W 0004828586 CLECO Power LLC OAKDALE 08/04/2011 06123.10000 30-47-56.0 N NC MD KMX97 079-41-04.1 W 0004829340 Duke Energy Carolinas, LLC REIDSVILLE 08/05/2011 06315.84000 36-25-29.4 N IN NE 085-59-52.3 W 0004821302 Commercial Broadband Solutions, Inc. Elkhart 07/29/2011 21285.00000 41-39-27.5 N PA NE 075-14-34.6 W 0004823179 Northampton Hospital Corporation, d/b/a EWilson 08/01/2011 10616.25000 40-41-14.3 N Page 46 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309249A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309249A1.txt  
- COMMONWEALTH OFGARLAND 08/15/2011 06585.00000 41-47-53.0 N Page 4 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PA MD WPTD231 079-26-22.0 W 0004839459 PENNSYLVANIA, COMMONWEALTH OFGARLAND 08/15/2011 06625.00000 41-47-53.0 N PA MD WPTD231 079-26-22.0 W 0004839459 PENNSYLVANIA, COMMONWEALTH OFGARLAND 08/15/2011 06681.25000 41-47-53.0 N PA MD WPTG652 079-00-04.1 W 0004839460 Commonwealth of Pennsylvania WARREN 08/15/2011 06226.89000 41-49-59.2 N PA MD WPTG652 079-00-04.1 W 0004839460 Commonwealth of Pennsylvania WARREN 08/15/2011 06286.19000 41-49-59.2 N PA MD WPTG652 079-00-04.1 W 0004839460 Commonwealth of Pennsylvania WARREN 08/15/2011 06404.79000 41-49-59.2 N PA MD WPTG652 079-00-04.1 W 0004839460 Commonwealth of Pennsylvania WARREN 08/15/2011 06705.00000 41-49-59.2 N PA MD WPTG652 079-00-04.1 W 0004839460 Commonwealth of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309250A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309250A1.txt  
- WQKW470 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23075.00000000 Parkville 39-23-31.3 N MD 76-31-9.7 W 8 1 07/15/2011 WQKW483 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23225.00000000 HANOVER 39-10-36.1 N MD 76-43-39.9 W 3 1 07/21/2011 WQKW485 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23075.00000000 Baltimore 39-22-54.8 N MD 76-45-54.0 W 7 1 07/15/2011 WQKW496 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23125.00000000 Baltimore 39-19-4.1 N MD 76-36-39.0 W 4 1 07/15/2011 WQKW527 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21825.00000000 JESSUP 39-10-20.6 N MD 76-46-35.1 W 5 1 07/20/2011 WQKW890 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23175.00000000 BALTIMORE 39-20-58.8 N MD 76-27-50.4 W 2 1 07/21/2011 WQKW892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 BALTIMORE 39-21-42.8 N MD 76-43-11.3 W 2 1 07/21/2011 WQKW892 FXO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309336A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309336A1.txt  
- 101-14-58.1 W 0004848510 NORTHWEST DAKOTA CELLULAR OF NMinot 08/22/2011 48-13-33.9 N AL MD KNKR324 087-37-30.6 W 0004848791 Cellco Partnership Haleyville 08/22/2011 34-05-19.2 N AL MD KNKR324 087-33-22.9 W 0004848791 Cellco Partnership Haleyville 08/22/2011 34-07-21.5 N SD MD KNKN304 099-59-19.3 W 0004850590 Cellular Inc. Network Corporation Blunt 08/24/2011 44-31-34.0 N MN MD KNKN422 096-15-18.9 W 0004851089 Midwest Wireless Communications, L.L.CIvanhoe 08/24/2011 44-28-04.1 N AR MD KNKN580 093-31-03.8 W 0004851386 Northwest Arkansas RSA Limited PartnersKingston 08/24/2011 36-03-08.4 N Page 26 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AR MD KNKN580 093-46-00.0 W 0004851386 Northwest Arkansas RSA Limited PartnersST. PAUL 08/24/2011 35-49-24.0 N AK MD KNKQ401 142-47-42.3 W 0004852709 Copper Valley 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309442A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309442A1.txt  
- III, LLC 21825.00000000 Camp Hill 40-13-48.7 N PA 76-56-3.8 W 3 1 08/03/2011 WQLI870 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21975.00000000 Camp Hill 40-13-48.7 N PA 76-56-3.8 W 4 1 08/03/2011 WQLI871 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17765.00000000 Swatara 40-14-59.5 N PA 76-48-22.2 W 1 1 08/03/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19325.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 1 1 08/03/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11225.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 2 1 08/03/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11305.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 2 1 08/03/2011 WQLI894 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17765.00000000 HAMPDEN TOW 40-16-2.6 N PA 76-58-27.9 W 1 1 08/03/2011 WQLI894 FXO CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309459A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309459A1.txt  
- N NH MD WPQN966 071-41-54.3 W 0004863375 NH DEPT OF SAFETY/STATE POLICE FRANCONIA 09/02/2011 06845.62500 44-09-25.2 N NH MD WPSS667 071-08-14.5 W 0004863376 NEW HAMPSHIRE, STATE OF, DIVISIONOSSIPPEE 09/02/2011 11245.00000 43-41-03.6 N NH MD WPSS667 071-08-14.5 W 0004863376 NEW HAMPSHIRE, STATE OF, DIVISIONOSSIPPEE 09/02/2011 11628.12500 43-41-03.6 N NH MD WPSS671 072-16-48.5 W 0004863377 NEW HAMPSHIRE, STATE OF, DIVISIONKeene 09/02/2011 10835.00000 42-56-04.1 N NH MD WPSS671 072-16-48.5 W 0004863377 NEW HAMPSHIRE, STATE OF, DIVISIONKeene 09/02/2011 11153.12500 42-56-04.1 N NH MD WPSS669 072-20-12.7 W 0004863378 NEW HAMPSHIRE, STATE OF, DIVISIONClaremont 09/02/2011 10915.00000 43-22-21.3 N NH MD WPSS669 072-20-12.7 W 0004863378 NEW HAMPSHIRE, STATE OF, DIVISIONClaremont 09/02/2011 11163.12500 43-22-21.3 N NH MD WPSR559 072-02-32.7 W 0004863379 NEW HAMPSHIRE, STATE OF, DIVISIONNORTH HAVERHIL 09/02/2011 11285.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309559A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309559A1.txt  
- Date File Number Frequency (MHz) Applicant Name Latitude City IA MD WMV976 093-20-49.0 W 0004868287 USCOC OF GREATER IOWA, LLC MITCHELLVILLE 09/08/2011 06775.00000 41-41-40.0 N IA MD WMV976 093-20-49.0 W 0004868287 USCOC OF GREATER IOWA, LLC MITCHELLVILLE 09/08/2011 06805.00000 41-41-40.0 N IA MD WMV976 093-20-49.0 W 0004868287 USCOC OF GREATER IOWA, LLC MITCHELLVILLE 09/08/2011 06820.00000 41-41-40.0 N IA MD WPWX236 091-43-04.1 W 0004868289 USCOC OF GREATER IOWA, LLC KALONA 09/08/2011 05974.85000 41-27-27.1 N IA MD WPWX236 091-43-04.1 W 0004868289 USCOC OF GREATER IOWA, LLC KALONA 09/08/2011 06152.75000 41-27-27.1 N IA MD WPWX236 091-43-04.1 W 0004868289 USCOC OF GREATER IOWA, LLC KALONA 09/08/2011 06785.00000 41-27-27.1 N IA MD WPWX236 091-43-04.1 W 0004868289 USCOC OF GREATER IOWA, LLC KALONA 09/08/2011 06805.00000 41-27-27.1 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309561A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309561A1.txt  
- N CO MD WPVY395 105-37-09.8 W 0004867446 COLORADO SPRINGS UTILITIES Hartsel 09/07/2011 06595.00000 38-58-43.9 N CO MD WPVY395 105-37-09.8 W 0004867446 COLORADO SPRINGS UTILITIES Hartsel 09/07/2011 06615.00000 38-58-43.9 N AZ MD WNEY703 111-49-40.1 W 0004867876 MESA, CITY OF MESA 09/08/2011 05945.20000 33-25-37.9 N AZ MD WPQW572 111-35-02.5 W 0004867878 Mesa, City of MESA 09/08/2011 05974.85000 33-17-06.2 N IL MD WQLU600 090-39-04.1 W 0004868576 UNITED CUSD 304 Monmouth 09/08/2011 11245.00000 40-55-17.6 N IL MD WQLU600 090-39-04.1 W 0004868576 UNITED CUSD 304 Monmouth 09/08/2011 11265.00000 40-55-17.6 N IL MD WQLU600 090-39-04.1 W 0004868576 UNITED CUSD 304 Monmouth 09/08/2011 11325.00000 40-55-17.6 N CO MD WPOQ610 104-49-03.9 W 0004869608 Colorado Springs utilities COLORADO SPRIN 09/09/2011 05945.20000 38-52-54.9 N CO MD WPVY393 104-49-55.9 W 0004869651 Colorado 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309689A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309689A1.txt  
- HOLDINGS IIIMiami 09/16/2011 11505.00000 25-48-32.2 N FL MD WQMY304 080-12-25.1 W 0004877626 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 09/16/2011 11625.00000 25-48-32.2 N FL MD WQMY304 080-12-25.1 W 0004877626 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 09/16/2011 17815.00000 25-48-32.2 N FL MD WQMY304 080-12-25.1 W 0004877626 CLEARWIRE SPECTRUM HOLDINGS IIIMiami 09/16/2011 17915.00000 25-48-32.2 N TX MD WQOB961 095-30-27.8 W 0004877718 Franklin Group Inc. Houston 09/16/2011 11245.00000 29-51-04.1 N TX MD WQOB961 095-30-27.8 W 0004877718 Franklin Group Inc. Houston 09/16/2011 11265.00000 29-51-04.1 N TX MD WQOB961 095-30-27.8 W 0004877718 Franklin Group Inc. Houston 09/16/2011 11345.00000 29-51-04.1 N TX MD WQOB961 095-30-27.8 W 0004877718 Franklin Group Inc. Houston 09/16/2011 11365.00000 29-51-04.1 N WY MD WNTA926 107-55-50.2 W 0004877880 PACIFICORP JEFFERY CITY 09/16/2011 06286.19000 42-12-18.8 N MT NE 109-25-11.6 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309858A1.pdf  
- 331 193 54 44 796 36 % 63.6 21.7 41.8 24.2 6.8 5.4 100.0 N 179 382 142 55 29 787 43 % 71.5 22.6 48.9 18.0 7.0 3.6 100.0 N 132 385 165 92 42 816 12 % 64.1 16.2 47.9 20.4 10.7 4.8 100.0 N 130 344 204 70 34 782 47 % 61.9 16.7 45.2 25.4 8.6 4.1 100.0 N 131 361 174 93 53 812 18 % 61.5 16.3 45.2 21.4 11.0 6.1 100.0 N 155 369 163 69 50 806 23 % 66.2 19.2 47.0 19.8 8.1 5.9 100.0 48.My supervisor/team leader listens to what I have to say. 49.My supervisor/team leader treats me with respect. 50.In the last six months, my supervisor/team leader has talked 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309884A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309884A1.txt  
- WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 05974.85000 41-21-59.5 N OH MD WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 06073.68000 41-21-59.5 N OH MD WPUG346 083-46-04.2 W 0004885524 LINK Investments, LTD. BOWLING GREEN 09/23/2011 06103.33000 41-21-59.5 N OH MD WPUG348 083-43-47.4 W 0004885528 LINK Investments, LTD. TOLEDO 09/23/2011 06226.89000 41-41-11.9 N WA MD WPJB542 119-53-04.1 W 0004885560 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 09/23/2011 06286.19000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0004885560 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 09/23/2011 06345.49000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0004885560 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 09/23/2011 06855.00000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0004885560 WESTERN SUB-RSA LIMITED PARTNERBEVERLY 09/23/2011 10563.75000 46-48-55.4 N WA MD WQEI750 119-50-34.4 W 0004885587 WESTERN SUB-RSA 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309885A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309885A1.txt  
- SPECTRUM HOLDINGS III, LLC 11345.00000000 Plainfield 41-37-32.2 N IL 88-9-52.0 W 1 1 08/22/2011 WQLK395 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23175.00000000 Plainfield 41-37-32.2 N IL 88-9-52.0 W 2 1 08/22/2011 WQLK395 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23275.00000000 Plainfield 41-37-32.2 N IL 88-9-52.0 W 2 1 08/22/2011 WQLK407 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11095.00000000 Willowbrook 41-45-9.8 N IL 87-56-4.1 W 1 1 08/22/2011 WQLK407 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23375.00000000 Willowbrook 41-45-9.8 N IL 87-56-4.1 W 2 1 Page 4 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 08/22/2011 WQLK407 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23475.00000000 Willowbrook 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309887A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309887A1.txt  
- WORTH, CITY OF FORT WORTH 09/22/2011 06625.00000 32-44-39.5 N TX MD WNEW206 097-20-41.1 W 0004883576 FORT WORTH, CITY OF FORT WORTH 09/22/2011 11215.00000 32-44-39.5 N TX MD WNEW206 097-20-41.1 W 0004883576 FORT WORTH, CITY OF FORT WORTH 09/22/2011 11365.00000 32-44-39.5 N TX MD WNEW206 097-20-41.1 W 0004883576 FORT WORTH, CITY OF FORT WORTH 09/22/2011 11485.00000 32-44-39.5 N TX MD WNTN412 097-20-04.1 W 0004883583 FORT WORTH, CITY OF FORT WORTH 09/22/2011 06256.54000 32-45-01.5 N TX MD WNTN412 097-20-04.1 W 0004883583 FORT WORTH, CITY OF FORT WORTH 09/22/2011 10755.00000 32-45-01.5 N TX MD WNTN412 097-20-04.1 W 0004883583 FORT WORTH, CITY OF FORT WORTH 09/22/2011 10835.00000 32-45-01.5 N TX MD WNTN412 097-20-04.1 W 0004883583 FORT WORTH, CITY OF FORT WORTH 09/22/2011 11215.00000 32-45-01.5 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309961A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-309961A1.txt  
- LONG. LOCATION: E-SYSTEMS 1 15.5 meters ANTENNA ID: (50.9 FT.) 83.00 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0F8W HARRIS CORPORATION 2 13 meters ANTENNA ID: 5270 (42.7 FT.) 83.00 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0F8W COMTECH 3 4.1 meters ANTENNA ID: "18FT" OFFSAT 83.00 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 36M0F8W Points of Communication: 1 - ALSAT - (ALSAT) E920028 SES-RWL-20110921-01116 E Date Effective: 09/21/2011 Class of Station: Fixed Earth Stations Grant of Authority 12/20/2011 - 12/20/2026 Renewal Westar Satellite Services LP Nature of Service: Domestic Fixed 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310160A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310160A1.txt  
- Name Latitude City KS MD KNKN801 100-00-26.8 W 0004887466 Alltel Communications, LLC DODGE CITY 09/26/2011 37-46-51.4 N ND MD KNKN782 099-23-55.5 W 0004888867 New Cingular Wireless PCS, LLC Ashley 09/27/2011 46-01-58.1 N ND MD KNKN782 099-17-40.0 W 0004888867 New Cingular Wireless PCS, LLC Carrington 09/27/2011 47-20-45.0 N ND MD KNKN782 099-07-47.1 W 0004888867 New Cingular Wireless PCS, LLC Carrington 09/27/2011 47-27-04.1 N ND MD KNKN782 099-37-03.4 W 0004888867 New Cingular Wireless PCS, LLC Fessenden 09/27/2011 47-39-12.7 N ND MD KNKN782 101-05-30.9 W 0004888867 New Cingular Wireless PCS, LLC Flasher 09/27/2011 46-27-52.5 N ND MD KNKN782 099-07-58.7 W 0004888867 New Cingular Wireless PCS, LLC Gackle 09/27/2011 46-37-46.8 N ND MD KNKN782 100-07-13.3 W 0004888867 New Cingular Wireless PCS, LLC Goodrich 09/27/2011 47-27-26.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310205A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310205A1.txt  
- ID: 5260 78.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 78.40 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F9W SCIENTIFIC ATLANTA 2 7 meters ANTENNA ID: 8010 75.90 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 75.90 dBW 5925.0000 - 6425.0000 MHz 9M00G7W 3700.0000 - 4200.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 9M00G7W COMTECH 3 4.1 meters ANTENNA ID: 72.90 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 72.90 dBW 5925.0000 - 6425.0000 MHz 9M00G7W 72.90 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.90 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 9M00G7W Page 4 of 11 3700.0000 - 4200.0000 MHz 36M0F9W 3700.0000 - 4200.0000 MHz 36M0F3F Points of Communication: 1 - 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310242A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310242A1.txt  
- (CSR) requests Date Logged 4/12/2011 Date Modified 9/13/2011 Related Regulation / Document Ref FCC 09-41, FCC 10-85 Related Issue With the implementation of one-day porting for Simple Ports in accordance with FCC Orders 09-41 and 10-85, the FCC adopted the following requirements pertaining to Customer Service Records (CSRs) by virtue of adopting the attached NANC LNP Provisioning Flows: NANC_OPS_Flows_N arratives v4.1 (04-16 The Old SP shall not require the New SP to have previously obtained a CSR before they will accept an LSR from the New SP. For those New SPs that choose not to obtain a CSR, they understand that there is heightened risk that their LSR may not be complete and accurate. This is not intended to preclude those 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310264A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310264A1.txt  
- December 31, 2010 28 Zero 17.7%17.7%17.7%19.4%18.3% 7.7% 8.7% 9.3% 7.1% 6.9% One 11.3 11.1 11.1 11.7 11.6 9.2 10.1 10.1 8.7 8.6 Two 7.8 8.2 8.3 8.3 8.6 7.8 7.9 7.6 7.4 7.6 Three 6.2 6.7 6.7 6.2 6.3 6.4 6.1 6.2 6.2 6.3 Four 5.0 5.2 5.4 5.0 5.0 5.4 5.4 5.2 5.2 5.5 Five 4.2 4.4 4.4 3.9 4.1 4.8 4.6 4.5 4.7 5.0 Six 3.5 3.8 3.8 3.5 3.5 4.2 4.0 3.8 4.2 4.2 Seven 3.2 3.2 3.4 3.3 3.2 3.6 3.4 3.5 3.6 3.7 Eight 2.9 3.0 2.8 2.9 3.0 3.2 3.1 3.0 3.4 3.5 Nine 2.8 2.7 2.9 2.6 2.7 2.8 2.6 2.7 2.8 3.0 Ten or More 35.3 34.0 33.5 33.1 33.6 44.7 44.0 44.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310301A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310301A1.txt  
- WQGT520 FXO Clearwire Spectrum Holdings II, LLC 23275.00000000 YAKIMA 46-35-37.7 N WA 120-32-50.4 W1 1 09/05/2011 WQGT520 FXO Clearwire Spectrum Holdings II, LLC 19375.00000000 YAKIMA 46-35-37.7 N WA 120-32-50.4 W3 1 09/05/2011 WQGT520 FXO Clearwire Spectrum Holdings II, LLC 19475.00000000 YAKIMA 46-35-37.7 N WA 120-32-50.4 W3 1 09/05/2011 WQGT522 FXO Clearwire Spectrum Holdings II, LLC 19475.00000000 YAKIMA 46-30-56.1 N WA 120-24-4.1 W 1 1 09/05/2011 WQGT522 FXO Clearwire Spectrum Holdings II, LLC 19675.00000000 YAKIMA 46-30-56.1 N WA 120-24-4.1 W 2 1 09/05/2011 WQGT522 FXO Clearwire Spectrum Holdings II, LLC 19475.00000000 YAKIMA 46-30-56.1 N WA 120-24-4.1 W 3 1 09/05/2011 WQGT522 FXO Clearwire Spectrum Holdings II, LLC 10815.00000000 YAKIMA 46-30-56.1 N WA 120-24-4.1 W 4 1 09/05/2011 WQGT522 FXO Clearwire Spectrum Holdings 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310456A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310456A1.txt  
- PORTE 10/12/2011 41-35-35.0 N IN MD KNKQ373 087-26-37.7 W 0004909503 New Cingular Wireless PCS, LLC Lake VIllage 10/12/2011 41-06-57.5 N Page 28 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IN MD KNKQ373 086-43-30.0 W 0004909503 New Cingular Wireless PCS, LLC LaPorte 10/12/2011 41-36-35.0 N IN MD KNKQ373 086-43-04.1 W 0004909503 New Cingular Wireless PCS, LLC LAPORTE 10/12/2011 41-39-27.2 N IN MD KNKQ373 086-54-02.0 W 0004909503 New Cingular Wireless PCS, LLC Medaryville 10/12/2011 41-05-57.0 N IN MD KNKQ373 086-48-21.1 W 0004909503 New Cingular Wireless PCS, LLC Michigan City 10/12/2011 41-40-07.1 N IN MD KNKQ373 086-53-52.0 W 0004909503 New Cingular Wireless PCS, LLC Michigan City 10/12/2011 41-40-54.0 N IN MD 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310457A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310457A1.txt  
- N AZ MD WQNR581 111-49-52.7 W 0004910750 Desert iNET Scottsdale 10/13/2011 11425.00000 33-45-05.3 N TX MD WNTG573 101-15-31.4 W 0004911093 ConocoPhillips Communications Inc. FORSAN 10/13/2011 00928.29375 32-06-45.4 N TX MD WNTG573 101-15-31.4 W 0004911093 ConocoPhillips Communications Inc. FORSAN 10/13/2011 00952.29375 32-06-45.4 N IL MD WQKS331 089-39-33.9 W 0004911298 llinois Rural Electric Cooperative SPRINGFIELD 10/13/2011 10735.00000 39-47-58.0 N CA MD KMM27 117-07-04.1 W 0004912175 San Diego Gas & Electric Company ESCONDIDO 10/14/2011 11185.00000 33-07-32.1 N MS MD WQOG436 090-38-45.0 W 0004912293 South Mississippi Electric Power AssociatClarksdale 10/14/2011 06093.45000 34-01-02.9 N Page 11 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MS MD WQOG438 090-43-52.6 W 0004912306 South Mississippi 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310633A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310633A1.txt  
- W 0004903888 SW Networks Wayne 10/20/2011 06123.00000 40-56-27.1 N NJ AM 074-03-43.2 W 0004907980 SW Networks Secaucus 10/20/2011 10715.00000 40-48-42.5 N NJ AM 074-03-43.2 W 0004907980 SW Networks Secaucus 10/20/2011 10795.00000 40-48-42.5 N NJ AM 074-23-32.3 W 0004907982 SW Networks EDISON 10/18/2011 11215.00000 40-31-45.5 N NJ AM 074-23-32.3 W 0004907982 SW Networks EDISON 10/18/2011 11245.00000 40-31-45.5 N CA AM KMM27 117-07-04.1 W 0004912175 San Diego Gas & Electric Company ESCONDIDO 10/20/2011 11185.00000 33-07-32.1 N Page 38 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NJ AM 074-41-45.3 W 0004915606 SW Networks BEDMINSTER 10/20/2011 06123.10000 40-38-37.8 N NJ AM 074-41-45.3 W 0004915606 SW Networks BEDMINSTER 10/20/2011 06152.75000 40-38-37.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310635A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310635A1.txt  
- N KS MD WPUK287 099-53-34.4 W 0004913818 KANSAS, STATE OF Norton 10/17/2011 06645.00000 39-49-35.0 N ID MD WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 10/17/2011 06615.00000 42-42-58.6 N ID MD WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 10/17/2011 06645.00000 42-42-58.6 N ID MD WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 10/17/2011 06705.00000 42-42-58.6 N ID MD WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 10/17/2011 06745.00000 42-33-30.6 N ID MD WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 10/17/2011 06775.00000 42-33-30.6 N ID MD WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 10/17/2011 06805.00000 42-33-30.6 N ID MD WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 10/17/2011 06865.00000 42-33-30.6 N ID MD WPJE817 114-12-52.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310781A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310781A1.txt  
- Internet Santa Monica 10/24/2011 19575.00000 34-00-32.2 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CO NE 105-09-54.4 W 0004925398 LP Broadband, Inc. Superior 10/24/2011 11345.00000 39-56-44.5 N CA NE 122-35-36.8 W 0004925908 CALIFORNIA RURAL SERVICE AREA #1MIDDLETOWN 10/25/2011 10915.00000 38-51-04.1 N NE NE 101-31-45.2 W 0004927126 USCOC NEBRASKA/KANSAS, LLC BENKELMAN 10/25/2011 06197.24000 40-11-36.1 N WI NE 091-06-01.9 W 0004927254 UNITED STATES CELLULAR OPERATINBagley 10/25/2011 06404.79000 42-54-47.9 N AK NE 145-14-06.0 W 0004927878 GCI Communication Corp Deltana 10/25/2011 11565.00000 63-54-05.0 N KS NE 097-40-54.9 W 0004927957 Nex-Tech, Inc. Mcpherson 10/25/2011 21925.00000 38-22-40.3 N KS NE 097-41-00.9 W 0004927959 Nex-Tech, Inc. Mcpherson 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310892A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-310892A1.txt  
- Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ID AM WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 11/01/2011 06615.00000 42-42-58.6 N ID AM WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 11/01/2011 06645.00000 42-42-58.6 N ID AM WPJE815 114-30-12.1 W 0004914047 Southern Idaho Regional CommunicationsJEROME 11/01/2011 06705.00000 42-42-58.6 N ID AM WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 11/01/2011 06745.00000 42-33-30.6 N ID AM WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 11/01/2011 06775.00000 42-33-30.6 N ID AM WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 11/01/2011 06805.00000 42-33-30.6 N ID AM WPJE816 114-28-04.1 W 0004914048 Southern Idaho Regional CommunicationsTWIN FALLS 11/01/2011 06865.00000 42-33-30.6 N ID AM WPJE817 114-12-52.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311026A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311026A1.txt  
- W 0004948310 T-MOBILE LICENSE LLC Immokalee 11/09/2011 06197.24000 26-26-55.4 N FL NE 081-16-16.4 W 0004948310 T-MOBILE LICENSE LLC Immokalee 11/09/2011 06226.89000 26-26-55.4 N FL NE 081-16-16.4 W 0004948310 T-MOBILE LICENSE LLC Immokalee 11/09/2011 06315.84000 26-26-55.4 N FL NE 081-16-16.4 W 0004948310 T-MOBILE LICENSE LLC Immokalee 11/09/2011 06345.49000 26-26-55.4 N FL NE 081-34-10.3 W 0004948311 T-MOBILE LICENSE LLC Immokalee 11/09/2011 11225.00000 26-22-04.1 N FL NE 081-34-10.3 W 0004948311 T-MOBILE LICENSE LLC Immokalee 11/09/2011 11345.00000 26-22-04.1 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City FL NE 081-24-01.8 W 0004948312 T-MOBILE LICENSE LLC SUNNILAND 11/09/2011 05945.20000 26-18-36.8 N FL NE 081-24-01.8 W 0004948312 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311044A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311044A1.txt  
- Voice 14000.0000 - 14500.0000 MHz 32M3G7W Digital Data and Video 11700.0000 - 12200.0000 MHz 32M3G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 1M54G7W Digital Data, Video, and Voice 11450.0000 - 11700.0000 MHz 32M3G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 1M54G7W Digital Data, Video, and Voice 10950.0000 - 11200.0000 MHz 32M3G7W RSI Satcom Technologies 5.5m Hub 4.1 meters ANTENNA ID: 551KS 65.70 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 1M77G7W 56.60 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 22K0G7W Page 14 of 18 47.40 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 30K0G7W 69.50 dBW Digital QPSK (SCPC compressed digital data/video) 14000.0000 - 14500.0000 MHz 4M33G7W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311141A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311141A1.txt  
- N WY MD KNKR258 105-52-05.1 W 0004952576 New Cingular Wireless PCS, LLC GLENROCK 11/14/2011 42-53-46.2 N WY MD KNKR258 105-02-12.3 W 0004952576 New Cingular Wireless PCS, LLC Shawnee 11/14/2011 42-35-40.2 N UT MD KNKN218 109-42-27.5 W 0004952587 New Cingular Wireless PCS, LLC Dry Fork 11/14/2011 40-31-14.8 N UT MD KNKN218 110-44-39.8 W 0004952587 New Cingular Wireless PCS, LLC Duchesne 11/14/2011 39-53-04.1 N UT MD KNKN218 110-43-48.8 W 0004952587 New Cingular Wireless PCS, LLC Duchesne 11/14/2011 40-09-36.8 N UT MD KNKN218 110-13-46.6 W 0004952587 New Cingular Wireless PCS, LLC Duchesne 11/14/2011 40-10-19.9 N UT MD KNKN218 110-19-44.0 W 0004952587 New Cingular Wireless PCS, LLC DUCHESNE 11/14/2011 40-16-55.0 N UT MD KNKN218 109-25-05.5 W 0004952587 New Cingular Wireless PCS, LLC Dutch John 11/14/2011 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311143A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311143A1.txt  
- N NC MD WQKZ756 078-57-31.4 W 0004960703 CLEARWIRE SPECTRUM HOLDINGS IIIDurham 11/18/2011 11225.00000 35-58-54.1 N NC MD WQKZ756 078-57-31.4 W 0004960703 CLEARWIRE SPECTRUM HOLDINGS IIIDurham 11/18/2011 11305.00000 35-58-54.1 N NC MD WQKZ756 078-57-31.4 W 0004960703 CLEARWIRE SPECTRUM HOLDINGS IIIDurham 11/18/2011 23075.00000 35-58-54.1 N NC MD WQKZ756 078-57-31.4 W 0004960703 CLEARWIRE SPECTRUM HOLDINGS IIIDurham 11/18/2011 23175.00000 35-58-54.1 N PA MD WQLI892 077-00-04.1 W 0004960709 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 11/18/2011 11225.00000 40-14-41.1 N PA MD WQLI892 077-00-04.1 W 0004960709 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 11/18/2011 11305.00000 40-14-41.1 N PA MD WQLI892 077-00-04.1 W 0004960709 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 11/18/2011 11345.00000 40-14-41.1 N PA MD WQLI892 077-00-04.1 W 0004960709 CLEARWIRE SPECTRUM HOLDINGS IIIMechanicsburg 11/18/2011 11425.00000 40-14-41.1 N PA MD WQLI892 077-00-04.1 W 0004960709 CLEARWIRE SPECTRUM 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311144A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311144A1.txt  
- 11425.00000 36-45-52.8 N CA NE 119-05-49.4 W 0004956463 Kings Canyon Unified School District Dunlap 11/16/2011 23125.00000 36-45-52.8 N Page 8 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA NE 119-05-49.4 W 0004956463 Kings Canyon Unified School District Dunlap 11/16/2011 23175.00000 36-45-52.8 N CA NE 119-07-04.1 W 0004956464 Kings Canyon Unified School District Dunlap 11/16/2011 21925.00000 36-44-03.7 N CA NE 119-07-04.1 W 0004956464 Kings Canyon Unified School District Dunlap 11/16/2011 21975.00000 36-44-03.7 N CA NE 119-25-30.5 W 0004956667 Kings Canyon Unified School District Reedley 11/16/2011 23075.00000 36-36-00.2 N CA NE 119-25-30.5 W 0004956667 Kings Canyon Unified School District Reedley 11/16/2011 23475.00000 36-36-00.2 N FL NE 080-52-33.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311377A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311377A1.txt  
- Axton 11/28/2011 36-38-41.6 N VA MD KNKA655 079-34-42.0 W 0004968257 New Cingular Wireless PCS, LLC Brosville 11/28/2011 36-36-59.0 N Page 18 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VA MD KNKA655 079-22-10.4 W 0004968257 New Cingular Wireless PCS, LLC Callanda District 11/28/2011 37-03-56.4 N VA MD KNKA655 079-27-04.1 W 0004968257 New Cingular Wireless PCS, LLC Danville 11/28/2011 36-32-49.5 N VA MD KNKA655 079-25-52.9 W 0004968257 New Cingular Wireless PCS, LLC Danville 11/28/2011 36-32-56.8 N VA MD KNKA655 079-15-43.8 W 0004968257 New Cingular Wireless PCS, LLC DANVILLE 11/28/2011 36-34-56.7 N VA MD KNKA655 079-25-41.1 W 0004968257 New Cingular Wireless PCS, LLC DANVILLE 11/28/2011 36-35-59.5 N VA MD KNKA655 079-23-01.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311482A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311482A1.txt  
- HILL 12/05/2011 11245.00000 35-54-38.0 N TN NE 085-01-03.8 W 0004980170 Conterra Ultra Broadband LLC Clarkrange 12/05/2011 05974.85000 36-10-33.1 N TN NE 084-51-33.0 W 0004980171 Conterra Ultra Broadband LLC CRAB ORCHARD 12/05/2011 11325.00000 35-53-42.0 N TN NE 087-23-05.6 W 0004980173 Conterra Ultra Broadband LLC Clarksville 12/05/2011 05974.85000 36-23-13.1 N TN NE 083-23-45.7 W 0004980174 Conterra Ultra Broadband LLC DANDRIDGE 12/05/2011 10755.00000 36-00-04.1 N TN NE 087-41-29.8 W 0004980175 Conterra Ultra Broadband LLC ERIN 12/05/2011 06226.89000 36-19-33.5 N SC NE 080-20-54.9 W 0004980177 Conterra Ultra Broadband LLC Eutawville 12/05/2011 11285.00000 33-23-35.8 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN NE 084-53-11.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311602A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311602A1.txt  
- 112-19-22.0 W 0004991289 QUESTAR INFOCOMM INC Fillmore 12/14/2011 06583.75000 38-58-59.0 N CA MD WQKB951 121-55-09.5 W 0004991527 WiLine Networks Inc. Milpitas 12/14/2011 21475.00000 37-25-21.6 N WA MD WQOP449 122-33-57.0 W 0004991604 New Cingular Wireless PCS, LLC Suquamish 12/14/2011 10835.00000 47-43-34.9 N WA MD WQOP449 122-33-57.0 W 0004991604 New Cingular Wireless PCS, LLC Suquamish 12/14/2011 11405.00000 47-43-34.9 N CA MD WQGG371 122-24-04.1 W 0004991624 Wiline Networks Inc San Francisco 12/14/2011 21375.00000 37-47-24.0 N AK MD WQKK556 149-52-34.1 W 0004991676 GCI Communication Corp. Anchorage 12/14/2011 19585.00000 61-13-01.6 N AK MD WQKK556 149-52-34.1 W 0004991676 GCI Communication Corp. Anchorage 12/14/2011 19615.00000 61-13-01.6 N AK MD WQKK556 149-52-34.1 W 0004991676 GCI Communication Corp. Anchorage 12/14/2011 19675.00000 61-13-01.6 N AK MD WQKT534 149-44-52.4 W 0004991814 GCI 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311603A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311603A1.txt  
- File Number Frequency (MHz) Applicant Name Latitude City GA NE 084-23-05.9 W 0004995048 airBand Communications, Inc. Atlanta 12/16/2011 23025.00000 33-45-41.4 N CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX MD KNKN494 093-43-29.2 W 0004993839 GTE MOBILNET OF TEXAS RSA #17 LIMNewton 12/15/2011 30-55-37.1 N IA MD KNKN536 091-34-04.1 W 0004995229 IOWA RSA NO. 4 LIMITED PARTNERSHMOUNT PLEASANT 12/16/2011 40-59-07.1 N IA MD KNKN536 091-30-52.6 W 0004995229 IOWA RSA NO. 4 LIMITED PARTNERSHPILOT GROVE 12/16/2011 40-47-41.1 N IA MD KNKN536 091-39-48.9 W 0004995229 IOWA RSA NO. 4 LIMITED PARTNERSHWayland 12/16/2011 41-08-57.9 N RO WPUH619 0004993998 Excomm, LLC 12/16/2011 RO WPUH805 0004994000 Excomm, LLC 12/16/2011 MG - Microwave Industrial/Business Pool 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311727A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311727A1.txt  
- Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MS NE 089-57-34.0 W 0004997630 NEW CINGULAR WIRELESS PCS, LLCSOUTHAVEN 12/20/2011 11285.00000 34-56-35.0 N MS NE 089-57-34.0 W 0004997630 NEW CINGULAR WIRELESS PCS, LLCSOUTHAVEN 12/20/2011 11405.00000 34-56-35.0 N GA NE 084-27-44.8 W 0004997803 NEW CINGULAR WIRELESS PCS, LLCWOODSTOCK 12/20/2011 11325.00000 34-09-06.9 N GA NE 084-26-04.1 W 0004997841 NEW CINGULAR WIRELESS PCS, LLCWOODSTOCK 12/20/2011 10835.00000 34-07-01.0 N IL NE 088-12-07.3 W 0004997924 Broadband Heaven Inc Naperville 12/20/2011 11305.00000 41-48-38.9 N IL NE 088-05-48.0 W 0004997952 Broadband Heaven Inc GLENDALE HEIGHT 12/20/2011 10815.00000 41-54-22.0 N TX NE 094-42-14.0 W 0004998097 T-MOBILE LICENSE LLC Wallisville 12/20/2011 06725.00000 29-50-39.9 N TX NE 095-09-59.4 W 0004998115 T-MOBILE LICENSE LLC Pointblank 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311775A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311775A1.txt  
- State: 2010 Table 3.1 Report Table 2.10 High-Cost Support Fund Disbursement History Chart 3.1 Report Chart 2.3 Total High-Cost Support Fund Disbursements and Reserve Table 3.2 Report Table 2.11 High-Cost Support Fund Disbursement History - ILECs and CETCs Chart 3.2 Report Chart 2.4 Total High-Cost Support Fund Disbursements (ILECs and CETCs) and CETC Reserve Tables 3.3 - 3.37 Website Table 4.1 Report Table 2.19 Schools and Libraries Funding Commitments and Disbursements Table 4.2 Report Table 2.20 Schools and Libraries Funding Commitments and Disbursements by State and by Type of Applicant Tables 4.3 - 4.5 Website Tables 4.6 - 4.7 Deleted Chart 4.1 Deleted Table 5.1 Report Table 2.21 Rural Health Care Funding Disbursements by Funding Year Table 5.2 Report Table 2.22 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311917A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311917A1.txt  
- 01/04/2012 05974.85000 39-05-25.0 N KY NE 084-49-07.5 W 0005015185 Verizon Wireless (VAW) LLC BURLINGTON 01/04/2012 06226.89000 39-05-42.5 N MI NE 084-49-55.6 W 0005015190 Verizon Wireless (VAW) LLC SAINT IGNACE 01/04/2012 11265.00000 45-53-13.8 N MI NE 084-43-58.5 W 0005015195 Verizon Wireless (VAW) LLC SAINT IGNACE 01/04/2012 10775.00000 45-51-39.1 N AL NE 087-05-04.8 W 0005016328 Verizon Wireless (VAW) LLC Bessemer 01/04/2012 06034.15000 33-21-04.1 N AL NE 087-00-49.8 W 0005016329 Verizon Wireless (VAW) LLC Bessemer 01/04/2012 06286.19000 33-25-26.2 N SC NE 081-31-13.0 W 0005016475 Verizon Wireless (VAW) LLC BATESBURG 01/05/2012 10875.00000 33-44-21.9 N WV NE 079-55-21.4 W 0005017065 NEW CINGULAR WIRELESS PCS, LLCVALLEY BEND 01/05/2012 10755.00000 38-44-57.6 N UT NE 112-25-32.8 W 0005017072 Xpressweb Internet Services, Inc. Kanab 01/05/2012 11325.00000 37-02-03.3 N UT NE 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311923A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311923A1.txt  
- LLC 23275.00000000 Golden Valley 45-0-1.0 N MN 93-21-14.0 W 5 1 12/08/2011 WQLZ815 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 17965.00000000 St. Louis Park 44-58-6.0 N MN 93-21-3.6 W 4 1 12/08/2011 WQLZ820 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23275.00000000 COON RAPIDS 45-7-54.0 N MN 93-16-11.0 W 1 1 12/08/2011 WQLZ822 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19425.00000000 Spring Lake Pa 45-7-4.1 N MN 93-13-56.5 W 3 1 12/08/2011 WQLZ825 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23075.00000000 Maplewood 45-0-0.4 N MN 93-2-57.1 W 2 1 12/08/2011 WQLZ825 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23225.00000000 Maplewood 45-0-0.4 N MN 93-2-57.1 W 2 1 12/08/2011 WQLZ835 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23175.00000000 Bloomington 44-48-36.5 N MN 93-21-57.5 W 2 1 12/08/2011 WQLZ837 FXO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311988A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311988A1.txt  
- 41-41-58.6 N IL NE 088-06-27.6 W 0005029433 Valley View School District Bolingbrook 01/13/2012 19525.00000 41-41-17.4 N IL NE 088-02-46.4 W 0005029434 Valley View School District Bolingbrook 01/13/2012 19475.00000 41-42-12.7 N IL NE 088-02-50.4 W 0005029435 Valley View School District Bolingbrook 01/13/2012 19525.00000 41-42-42.2 N IL NE 088-05-49.5 W 0005029436 Valley View School District Romeoville 01/13/2012 19375.00000 41-39-11.1 N IL NE 088-08-04.1 W 0005029437 Valley View School District Romeoville 01/13/2012 19625.00000 41-37-11.9 N IL NE 088-04-20.1 W 0005029438 Valley View School District Romeoville 01/13/2012 19325.00000 41-39-04.0 N IL NE 088-05-12.1 W 0005029439 Valley View School District Bolingbrook 01/13/2012 19475.00000 41-41-59.9 N IL NE 088-08-09.2 W 0005029440 Valley View School District Bolingbrook 01/13/2012 19325.00000 41-41-12.8 N IL NE 088-05-08.3 W 0005029441 Valley View 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311989A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-311989A1.txt  
- 46 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NV MD WQGL943 115-29-44.2 W 0005026292 Nevada Power Co. dba NV Energy Goodsprings 01/11/2012 06835.62500 35-53-35.7 N NV MD WQGL943 115-29-44.2 W 0005026292 Nevada Power Co. dba NV Energy Goodsprings 01/11/2012 10623.12500 35-53-35.7 N HI MD WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 01/11/2012 11265.00000 21-19-47.6 N HI MD WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 01/11/2012 11425.00000 21-19-47.6 N HI MD WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 01/11/2012 11465.00000 21-19-47.6 N HI MD WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 01/11/2012 11545.00000 21-19-47.6 N 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312140A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312140A1.txt  
- LA MD WMG7 093-38-53.6 W 0005033970 Aviation Spectrum Resources Inc Cameron 01/18/2012 00130.20000 29-45-32.8 N OR MD WQOH522 124-14-49.3 W 0005034020 Aviation Spectrum Resources, Inc North Bend 01/18/2012 00130.65000 43-25-01.0 N CA MD WPD6 121-35-26.8 W 0005034060 Aviation Spectrum Resources Inc SACRAMENTO 01/18/2012 00132.00000 38-41-43.6 N MS NE 089-27-16.6 W 0005033725 Aviation Spectrum Resources, Inc Bay St Louis 01/18/2012 00130.17500 30-22-04.1 N AZ NE 112-00-41.7 W 0005033739 Aviation Spectrum Resources, Inc Phoenix 01/18/2012 00130.12500 33-26-03.4 N OH NE 081-29-10.9 W 0005033759 Aviation Spectrum Resources, Inc Cleveland 01/18/2012 00130.55000 41-33-54.4 N IL NE 087-37-17.2 W 0005033790 Aviation Spectrum Resources, Inc Chicago 01/18/2012 00130.00000 41-53-46.1 N Page 1 AS - Aural Studio Transmitter Link State Purpose Call Sign Longitude Area Op. Receipt Date 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312206A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312206A1.txt  
- N CO NE P 104-59-22.4 W 0005044450 DIRECTV Sports Net Rocky Mountain, LLDenver 01/24/2012 06505.00000 39-45-29.5 N CO NE P 104-59-22.4 W 0005044450 DIRECTV Sports Net Rocky Mountain, LLDenver 01/24/2012 06513.00000 39-45-29.5 N CO NE P 104-59-22.4 W 0005044450 DIRECTV Sports Net Rocky Mountain, LLDenver 01/24/2012 06521.00000 39-45-29.5 N AZ NE 110-56-05.3 W 0005044455 Simply Bits LLC Tucson 01/24/2012 17980.00000 32-17-04.1 N MN NE P 094-18-28.4 W 0005045172 CITY OF PEQUOT LAKES PEQUOT LAKES 01/25/2012 00956.31875 46-36-19.4 N TX NE 096-00-03.2 W 0005045266 Rayburn Country Electric Cooperative IncWindom 01/25/2012 00942.57500 33-35-19.3 N TX NE 096-09-32.9 W 0005045443 Rayburn Country Electric Cooperative IncBonham 01/25/2012 00942.77500 33-38-00.6 N MN NE P 092-57-16.8 W 0005045541 CITY OF MAHTOMEDI MAHTOMEDI 01/25/2012 00956.30625 45-03-25.8 N TX 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312218A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312218A1.txt  
- SPECTRUM HOLDINGS III, LLC 10935.00000000 Anne Arundel 38-58-47.0 N MD 76-32-47.0 W12 1 12/25/2011 WQLB301 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21875.00000000 Anne Arundel 38-58-47.0 N MD 76-32-47.0 W14 1 12/24/2011 WQLC456 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11585.00000000 Odessa 31-50-40.9 N TX 102-28-8.9 W 1 1 12/28/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 18015.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 3 1 12/28/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 18115.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 3 1 12/28/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 4 1 12/28/2011 WQLI892 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19475.00000000 Mechanicsburg 40-14-41.1 N PA 77-0-4.1 W 4 1 12/28/2011 WQLI894 FXO CLEARWIRE SPECTRUM HOLDINGS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312324A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312324A1.txt  
- 21970.00000 32-16-16.6 N IL NE 088-03-56.7 W 0005051973 Urbancom.net Wireless LLC Bolingbrook 01/30/2012 11464.00000 41-41-02.2 N IL NE 088-03-56.7 W 0005051973 Urbancom.net Wireless LLC Bolingbrook 01/30/2012 11465.00000 41-41-02.2 N TX NE 101-28-19.7 W 0005052069 New Cingular Wireless PCS, LLC BIG SPRING 01/30/2012 23170.00000 32-15-08.0 N IL NE 088-08-52.6 W 0005052077 Urbancom.net Wireless LLC Naperville 01/30/2012 10975.00000 41-48-10.4 N MD NE 076-44-04.1 W 0005052347 airBand Communications, Inc. Hanover 01/30/2012 11365.00000 39-10-28.3 N TX NE 097-49-47.7 W 0005052573 New Cingular Wireless PCS, LLC AUSTIN 01/30/2012 10735.00000 30-27-22.1 N TX NE 097-53-30.1 W 0005052645 New Cingular Wireless PCS, LLC LEANDER 01/30/2012 11225.00000 30-26-26.0 N Page 17 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312417A1.pdf  
- Agenda Tracking System (eCLAS) Consolidated Licensing System (CLS) Universal Licensing System (ULS) Consumer Complaints Management System (CCMS) Electronic Document Management System (EDOCS) Electronic Comment Filing System (ECFS) Fee Filer Desktop/Network Document Development and Data Access Tools Form 655 Hearing Aid Compatibility Reporting System - 22 - PROMOTE INNOVATION, INVESTMENT, AND AMERICA'S GOLBAL COMPETITIVENESS Performance Commitments and Metrics Outcome-oriented Performance Goal 4.1: Foster international engagement and cooperation on communications policy issues, including promoting the broadband innovation initiative and free flow of data across borders. Targets with Subordinate Measures: (1) Help promote global broadband infrastructure deployment and adoption. Work domestically and internationally to identify possible additional spectrum bands for globally harmonized allocations for mobile broadband. Collaborate with U.S. government agencies and international organizations 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312456A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312456A1.txt  
- PR Wireless, Inc. Naguabo 02/06/2012 19445.00000 18-13-34.9 N OK NE 095-03-29.0 W 0005062825 USCOC OF GREATER OKLAHOMA, LLCValliant 02/06/2012 06063.80000 33-59-46.0 N PR NE 066-45-05.9 W 0005062827 PR Wireless, Inc. Arecibo 02/06/2012 19525.00000 18-27-14.6 N PR NE 066-40-24.6 W 0005062830 PR Wireless, Inc. Ponce 02/06/2012 11115.00000 17-58-22.6 N PR NE 066-01-53.2 W 0005063269 PR Wireless, Inc. San Juan 02/06/2012 11325.00000 18-21-04.1 N PR NE 066-39-31.9 W 0005063271 PR Wireless, Inc. Adjuntos 02/06/2012 11325.00000 18-06-53.4 N PR NE 065-54-42.9 W 0005063274 PR Wireless, Inc. Canovanas 02/06/2012 11285.00000 18-16-27.6 N PR NE 066-06-23.6 W 0005063275 PR Wireless, Inc. Cidra 02/06/2012 17765.00000 18-09-41.6 N TX NE 096-45-11.3 W 0005063518 New Cingular Wireless PCS, LLC LANCASTER 02/06/2012 10735.00000 32-35-35.6 N CA NE 121-53-28.2 W 0005065160 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312574A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312574A1.txt  
- SprintCom, Inc. Palmas 02/13/2012 19575.00000 17-59-18.2 N PR MD WPSX354 065-48-54.6 W 0005073123 SprintCom, Inc. HUMACAO 02/13/2012 11625.00000 18-05-20.4 N PR MD WPSX354 065-48-54.6 W 0005073123 SprintCom, Inc. HUMACAO 02/13/2012 11682.50000 18-05-20.4 N NV MD WKS32 117-03-15.1 W 0005073233 AT&T NEVADA AUSTIN 02/13/2012 10795.00000 39-27-11.6 N CA MD WLW676 121-27-47.2 W 0005074764 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 02/14/2012 06402.93700 39-39-04.1 N CA MD WLW676 121-27-47.2 W 0005074764 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 02/14/2012 10558.75000 39-39-04.1 N Page 26 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WLW676 121-27-47.2 W 0005074764 NEW CINGULAR WIRELESS PCS, LLCBERRY CREEK 02/14/2012 11405.00000 39-39-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312575A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312575A1.txt  
- 18-20-56.0 N VI NE 064-54-04.0 W 0005073153 Sprint Spectrum L.P. St. Thomas 02/13/2012 21925.00000 18-20-56.0 N VI NE 064-54-04.0 W 0005073153 Sprint Spectrum L.P. St. Thomas 02/13/2012 22225.00000 18-20-56.0 N VI NE 064-54-04.0 W 0005073153 Sprint Spectrum L.P. St. Thomas 02/13/2012 22325.00000 18-20-56.0 N PR NE 066-03-09.5 W 0005073160 Sprint Spectrum L.P. San Juan 02/13/2012 21975.00000 18-24-32.4 N PR NE 066-00-04.1 W 0005073163 Sprint Spectrum L.P. Carolina 02/13/2012 21825.00000 18-23-37.9 N PR NE 065-53-48.9 W 0005073181 Sprint Spectrum L.P. Canovanas 02/13/2012 10735.00000 18-19-06.3 N VI NE 064-56-15.8 W 0005073659 Sprint Spectrum L.P. Charlotte Amalie 02/14/2012 23225.00000 18-20-30.9 N PR NE 066-56-42.9 W 0005073679 Sprint Spectrum L.P. Quebradillas 02/14/2012 11225.00000 18-28-53.2 N HI NE 157-58-46.4 W 0005073763 T-MOBILE LICENSE LLC Pearl City 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312576A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312576A1.txt  
- St. Thomas 02/17/2012 21825.00000 18-20-56.0 N VI AM 064-54-04.0 W 0005073153 SprintCom, Inc. St. Thomas 02/17/2012 21925.00000 18-20-56.0 N VI AM 064-54-04.0 W 0005073153 SprintCom, Inc. St. Thomas 02/17/2012 22225.00000 18-20-56.0 N VI AM 064-54-04.0 W 0005073153 SprintCom, Inc. St. Thomas 02/17/2012 22325.00000 18-20-56.0 N PR AM 066-03-09.5 W 0005073160 SprintCom, Inc. San Juan 02/17/2012 21975.00000 18-24-32.4 N PR AM 066-00-04.1 W 0005073163 SprintCom, Inc. Carolina 02/17/2012 21825.00000 18-23-37.9 N PR AM 065-53-48.9 W 0005073181 SprintCom, Inc. Canovanas 02/17/2012 10735.00000 18-19-06.3 N Page 2 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City VI AM 064-56-15.8 W 0005073659 SprintCom, Inc. Charlotte Amalie 02/17/2012 23225.00000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312690A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312690A1.txt  
- 11605.00000 32-57-46.9 N TX NE 094-32-04.5 W 0005085902 Verizon Wireless (VAW) LLC Marietta 02/21/2012 10875.00000 33-12-38.3 N TX NE 094-32-54.5 W 0005085911 Verizon Wireless (VAW) LLC Hughes Springs 02/21/2012 11035.00000 32-59-54.9 N TX NE 094-32-54.5 W 0005085911 Verizon Wireless (VAW) LLC Hughes Springs 02/21/2012 11115.00000 32-59-54.9 N TX NE 094-26-34.5 W 0005085915 Verizon Wireless (VAW) LLC New Boston 02/21/2012 06256.54000 33-20-04.1 N TX NE 095-03-14.0 W 0005086165 Verizon Wireless (VAW) LLC Bogata 02/21/2012 06063.80000 33-28-59.0 N TX NE 094-47-59.8 W 0005086166 Verizon Wireless (VAW) LLC Lydia 02/21/2012 06315.84000 33-26-01.5 N TX NE 094-06-52.5 W 0005086168 Verizon Wireless (VAW) LLC Bivins 02/21/2012 05945.20000 32-58-16.8 N TX NE 095-14-35.0 W 0005086169 Verizon Wireless (VAW) LLC Winnsboro 02/21/2012 11285.00000 32-47-51.5 N CA NE 119-52-26.8 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312703A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312703A1.txt  
- FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23275.00000000 Silver Spring 39-2-28.3 N MD 76-59-35.9 W 7 1 01/22/2012 WQMF250 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19375.00000000 Syracuse 43-4-19.0 N NY 76-8-51.7 W 1 1 01/22/2012 WQMF250 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19475.00000000 Syracuse 43-4-19.0 N NY 76-8-51.7 W 1 1 01/22/2012 WQMF264 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23425.00000000 Bethesda 39-1-4.1 N MD 77-6-24.8 W 1 1 Page 11 Frequency Termination Pending Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. MG - Microwave Industrial/Business Pool Broadband Division 01/22/2012 WQMF264 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 23525.00000000 Bethesda 39-1-4.1 N MD 77-6-24.8 W 1 1 01/22/2012 WQMF327 FXO CLEARWIRE SPECTRUM HOLDINGS III, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312789A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312789A1.txt  
- Wireless Broadband Corp Las Piedras 02/29/2012 13050.00000 18-11-28.0 N PR AM WQKA620 065-50-17.5 W 0005007933 Aeronet Wireless Broadband Corp Las Piedras 02/29/2012 13100.00000 18-11-28.0 N PR AM WQKA620 065-50-17.5 W 0005007933 Aeronet Wireless Broadband Corp Las Piedras 02/29/2012 19320.00000 18-11-28.0 N PR AM WQKA620 065-50-17.5 W 0005007933 Aeronet Wireless Broadband Corp Las Piedras 02/29/2012 19680.00000 18-11-28.0 N HI AM WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 03/02/2012 11265.00000 21-19-47.6 N HI AM WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 03/02/2012 11425.00000 21-19-47.6 N HI AM WQDT908 158-02-04.1 W 0005026506 Clearwire Hawaii Partners Spectrum LLCEwa Beach 03/02/2012 11465.00000 21-19-47.6 N Page 38 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312921A1.txt  
- be required to prepare an EA. Response 3.12: Many elements of the Guidelines are incorporated into the alternatives considered and the mitigation measures recommended in Chapter 8. However, because of the language contained in the Guidelines, e.g., ``to the extent possible,'' the guidelines do not lend themselves to adoption as a set of criteria. Chapter 4 - Affected Environment Comment 4.1: A 10-year time frame is selected for impact analysis but the PEA does not provide reasons for that selection. The PEA also does not provide supporting justification for why the time frame is not the life of the program, which should be used for the analysis of cumulative effects. Response 4.1: The temporal scale of analysis for the PEA begins 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312929A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312929A1.txt  
- 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 02/14/2012 11525.00000 17-58-58.4 N PR MD WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 02/14/2012 17825.00000 17-58-58.4 N PR MD WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 02/14/2012 18065.00000 17-58-58.4 N PR MD WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 02/14/2012 21875.00000 17-58-58.4 N PR MD WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 02/14/2012 11215.00000 18-27-04.1 N Page 5 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PR MD WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 02/14/2012 19310.00000 18-27-04.1 N PR MD WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 02/14/2012 19475.00000 18-27-04.1 N PR MD WPTA576 066-08-52.5 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312930A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312930A1.txt  
- W 0005107374 Aviation Spectrum Resources Inc PITTSBURGH 03/07/2012 00129.40000 40-29-30.2 N ID MD WOO6 116-13-17.4 W 0005107384 Aviation Spectrum Resources Inc BOISE 03/07/2012 00131.80000 43-34-05.6 N WY MD WOE7 106-27-26.1 W 0005107393 Aviation Spectrum Resources Inc CASPER 03/07/2012 00131.80000 42-54-44.9 N ID MD KPX8 112-04-02.9 W 0005107429 Aviation Spectrum Resources Inc IDAHO FALLS 03/07/2012 00131.80000 43-30-59.7 N OR MD WON8 122-52-04.1 W 0005107488 Aviation Spectrum Resources Inc MEDFORD 03/07/2012 00131.80000 42-21-59.5 N OR MD WOP3 118-50-04.0 W 0005107494 Aviation Spectrum Resources Inc PENDLETON 03/07/2012 00131.80000 45-40-59.5 N Page 2 AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City OR MD WOO2 122-36-04.3 W 0005107498 Aviation Spectrum Resources Inc 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312931A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312931A1.txt  
- 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 03/09/2012 11525.00000 17-58-58.4 N PR AM WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 03/09/2012 17825.00000 17-58-58.4 N PR AM WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 03/09/2012 18065.00000 17-58-58.4 N PR AM WPST609 066-37-02.5 W 0005073680 SprintCom, Inc. Ponce 03/09/2012 21875.00000 17-58-58.4 N PR AM WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 03/09/2012 11215.00000 18-27-04.1 N PR AM WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 03/09/2012 19310.00000 18-27-04.1 N Page 2 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City PR AM WPTA576 066-08-52.5 W 0005073774 SprintCom, Inc. Catano 03/09/2012 19475.00000 18-27-04.1 N PR AM WPTA576 066-08-52.5 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312932A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-312932A1.txt  
- 089-41-37.0 W 0005109392 Marathon, County of Rib Mountain 03/08/2012 10735.00000 44-55-14.5 N WI MD WNEW982 089-41-37.0 W 0005109392 Marathon, County of Rib Mountain 03/08/2012 10755.00000 44-55-14.5 N WI MD WNEW982 089-41-37.0 W 0005109392 Marathon, County of Rib Mountain 03/08/2012 10795.00000 44-55-14.5 N WI MD WNEW982 089-41-37.0 W 0005109392 Marathon, County of Rib Mountain 03/08/2012 10915.00000 44-55-14.5 N OR MD WQHF919 122-33-04.1 W 0005109431 Oregon State (OWIN) Happy Valley 03/08/2012 06404.79000 45-27-16.0 N WA MD WQNQ751 122-46-17.6 W 0005109448 Oregon State (OWIN) Kalama 03/08/2012 06152.75000 46-00-47.8 N CA MD WPSG598 118-13-57.3 W 0005111772 LOS ANGELES, CITY OF Los Angeles 03/09/2012 06004.50000 34-04-18.0 N CA MD WPSG598 118-13-57.3 W 0005111772 LOS ANGELES, CITY OF Los Angeles 03/09/2012 11075.00000 34-04-18.0 N CA MD WPSG598 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313254A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313254A1.txt  
- Name Latitude City CA MD WMP212 116-58-14.1 W 0005128157 Verizon Wireless (VAW) LLC RAMONA 03/21/2012 11585.00000 33-00-32.2 N CA MD WMP212 116-58-14.1 W 0005128157 Verizon Wireless (VAW) LLC RAMONA 03/21/2012 11595.00000 33-00-32.2 N CA MD WMP212 116-58-14.1 W 0005128157 Verizon Wireless (VAW) LLC RAMONA 03/21/2012 11605.00000 33-00-32.2 N TX MD WQOA538 096-28-13.8 W 0005130017 Heath Internet /Wi-Five FORNEY 03/22/2012 11625.00000 32-45-04.1 N GU NE 144-48-45.2 E 0005122535 DoCoMo Pacific, Inc. Tamuning 03/19/2012 11645.00000 13-30-39.3 N GU NE 144-47-32.2 E 0005122536 DoCoMo Pacific, Inc. Tamuning 03/19/2012 11155.00000 13-29-37.8 N GU NE 144-52-59.9 E 0005122538 DoCoMo Pacific, Inc. Yigo 03/19/2012 17960.00000 13-31-27.9 N CA NE 121-28-36.3 W 0005123311 NEW CINGULAR WIRELESS PCS, LLCELVERTA 03/19/2012 06286.19000 38-42-28.1 N CA NE 121-28-36.3 W 0005123311 NEW 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313277A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313277A1.txt  
- - (ALSAT) E020024 SES-RWL-20120322-00291 E Date Effective: 03/23/2012 Class of Station: Fixed Earth Stations Grant of Authority 04/08/2012 - 04/08/2027 Renewal BFI Licenses, LLC Nature of Service: Fixed Satellite Service 34 ° 6 ' 58.50 " N LAT. SITE ID: 1 3030 ANDRITA STREET, LOS ANGELES, LOS ANGELES, CA 118 ° 14 ' 39.70 " W LONG. LOCATION: Comtech 1 4.1 meters ANTENNA ID: 5 Meter Offsat 72.40 dBW Digital Data 5925.0000 - 6425.0000 MHz 36M0G7D 68.90 dBW Digital Data 5925.0000 - 6425.0000 MHz 4M00G7D 72.40 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 36M0G7W Page 17 of 20 68.90 dBW Digital Video and Data 5925.0000 - 6425.0000 MHz 4M00G7W 72.40 dBW Standard Video 5925.0000 - 6425.0000 MHz 36M0F3F Digital 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313286A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313286A2.txt  
- Table A21 shows that 56.6 billion of these minutes and $3.5 billion of this revenue were for calls that originated in the United States or terminated collect or caller toll-free in the United States. Table A22 shows that 1.7 billion of these minutes and $0.2 billion of this revenue was for country-direct and country-beyond type services. Table A23 shows that 4.1 billion of these minutes and $0.4 billion of this revenue was for reorigination services billed to foreign carriers. Foreign-billed traffic is all traffic billed by a foreign or correspondent carrier and includes most calls that originate at foreign points as well as collect and caller toll free calls placed by U.S. customers to foreign points. Foreign-billed calls do not necessarily 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313399A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313399A1.txt  
- 44-10-35.0 N ID MD WMS802 111-25-54.0 W 0005142227 Idaho 6-Clark Limited Partnership ASHTON 03/30/2012 06404.79000 44-10-35.0 N ID MD WMS802 111-25-54.0 W 0005142227 Idaho 6-Clark Limited Partnership ASHTON 03/30/2012 06585.00000 44-10-35.0 N ID MD WMS802 111-25-54.0 W 0005142227 Idaho 6-Clark Limited Partnership ASHTON 03/30/2012 06635.62500 44-10-35.0 N CA MD WMQ712 118-11-22.3 W 0005142231 LOS ANGELES SMSA LIMITED PARTNECompton 03/30/2012 05974.85000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0005142231 LOS ANGELES SMSA LIMITED PARTNECompton 03/30/2012 06063.80000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0005142231 LOS ANGELES SMSA LIMITED PARTNECompton 03/30/2012 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0005142231 LOS ANGELES SMSA LIMITED PARTNECompton 03/30/2012 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0005142231 LOS ANGELES SMSA LIMITED PARTNECompton 03/30/2012 10577.50000 33-53-04.1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313405A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313405A1.txt  
- WQMA583 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11305.00000000 PITTSBURGH 40-24-42.2 N PA 79-55-52.2 W 8 1 02/25/2012 WQMA583 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11385.00000000 PITTSBURGH 40-24-42.2 N PA 79-55-52.2 W 8 1 02/24/2012 WQMA604 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19425.00000000 Pittsburgh 40-33-50.5 N PA 80-1-21.0 W 2 1 02/25/2012 WQMA654 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19525.00000000 Pittsburgh 40-27-4.1 N PA 80-0-20.2 W 3 1 02/25/2012 WQMA654 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 19625.00000000 Pittsburgh 40-27-4.1 N PA 80-0-20.2 W 3 1 02/25/2012 WQMA654 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 21975.00000000 Pittsburgh 40-27-4.1 N PA 80-0-20.2 W 5 1 02/25/2012 WQMA806 FXO CLEARWIRE SPECTRUM HOLDINGS III, LLC 11505.00000000 Pittsburgh 40-30-6.6 N PA 80-4-12.3 W 3 1 02/25/2012 WQMA806 FXO 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313499A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313499A1.txt  
- N MO 94-36-25.8 W 7 1 Call Sign Termination Date Stn Class Licensee Name Lower/Upper Frequency City Latitude State Longitude Loc./ Path ## Ant. YE - PubSafty/SpecEmer/PubSaftyNtlPlan,806-817/851-862MHz,TrunkedPublic Safety and Homeland Security Bureau 03/02/2012 WQNK350 FB2 MONTGOMERY COUNTY HOSPITAL DISTRICT 854.03750000 CONROE 30-16-18.0 N TX 95-29-45.0 W 1 1 03/02/2012 WQNK350 FB2 MONTGOMERY COUNTY HOSPITAL DISTRICT 854.03750000 MONTGOMERY 30-25-27.8 N TX 95-41-4.1 W 5 1 Page 3 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313506A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313506A1.txt  
- N NY NE 078-41-56.5 W 0005152500 NEW CINGULAR WIRELESS PCS, LLCLOCKPORT 04/05/2012 06375.14000 43-07-29.7 N Page 3 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NM NE 106-38-16.4 W 0005153690 Verizon Wireless (VAW) LLC Las Cruces 04/06/2012 10875.00000 32-24-37.1 N KY NE 084-18-04.1 W 0005153790 New Cingular Wireless PCS, LLC Richmond 04/06/2012 17845.00000 37-44-18.4 N KY NE 084-16-42.8 W 0005153821 New Cingular Wireless PCS, LLC RICHMOND 04/06/2012 19405.00000 37-43-01.2 N WY NE 107-14-38.1 W 0005153950 Verizon Wireless (VAW) LLC RAWLINS 04/06/2012 06004.50000 41-46-11.3 N WY NE 106-50-34.4 W 0005153960 Verizon Wireless (VAW) LLC Hanna 04/06/2012 06256.54000 41-44-17.5 N RO WPUU754 0005152221 T-Mobile Puerto 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313507A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313507A1.txt  
- W 0005146162 ROCKLAND COUNTY WEST HAVERSTRA 04/02/2012 10558.12500 41-12-58.9 N NY NE 073-54-34.6 W 0005146173 ROCKLAND COUNTY PALISADES 04/02/2012 10558.12500 41-00-07.8 N NY NE 074-13-27.4 W 0005146175 ROCKLAND COUNTY SLOATSBURG 04/02/2012 10558.12500 41-08-43.2 N WI NE 088-00-52.3 W 0005146690 BROWN COUNTY PUBLIC SAFETY COMGreen Bay 04/02/2012 10775.00000 44-30-48.9 N AZ NE 110-02-11.3 W 0005146701 NAVAJO COUNTY SHOW LOW 04/02/2012 19540.00000 34-15-04.1 N AZ NE 110-04-55.8 W 0005146702 NAVAJO COUNTY Snowflake 04/02/2012 18060.00000 34-29-34.2 N WI NE 087-55-17.5 W 0005146876 BROWN COUNTY PUBLIC SAFELY COMGreen Bay 04/02/2012 23035.00000 44-31-53.0 N WI NE 087-55-17.5 W 0005146876 BROWN COUNTY PUBLIC SAFELY COMGreen Bay 04/02/2012 23085.00000 44-31-53.0 N WI NE 087-51-40.3 W 0005146877 BROWN COUNTY PUBLIC SAFETY COMDENMARK 04/02/2012 10835.00000 44-20-28.6 N WI NE 087-49-58.7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313615A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313615A1.txt  
- LLC Boyers 04/10/2012 11325.00000 41-05-55.0 N PA NE 078-59-45.1 W 0005159353 TRF Services, LLC Sigel 04/10/2012 06375.14000 41-19-06.1 N PA NE 078-59-45.1 W 0005159353 TRF Services, LLC Sigel 04/10/2012 11565.00000 41-19-06.1 N PA NE 079-33-07.2 W 0005159354 TRF Services, LLC Kossuth 04/10/2012 06123.10000 41-16-34.3 N PA NE 079-33-07.2 W 0005159354 TRF Services, LLC Kossuth 04/10/2012 10835.00000 41-16-34.3 N PA NE 078-41-04.1 W 0005159355 TRF Services, LLC Ridgeway 04/10/2012 06256.54000 41-22-46.0 N PA NE 078-41-04.1 W 0005159355 TRF Services, LLC Ridgeway 04/10/2012 11075.00000 41-22-46.0 N PA NE 078-07-34.2 W 0005159356 TRF Services, LLC Driftwood 04/10/2012 06004.50000 41-23-17.9 N PA NE 078-07-34.2 W 0005159356 TRF Services, LLC Driftwood 04/10/2012 06226.89000 41-23-17.9 N Page 45 MG - Microwave Industrial/Business Pool State Purpose Call Sign 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313700A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313700A1.txt  
- LIMITED PARTNERSHIGREENVILLE 04/18/2012 06345.49000 33-13-11.3 N AZ NE 110-30-50.2 W 0005170122 Smith Bagley Inc DBA Cellular One of NE Hard Rock - MB 04/18/2012 10995.00000 36-04-27.3 N AZ NE 110-30-50.2 W 0005170122 Smith Bagley Inc DBA Cellular One of NE Hard Rock - MB 04/18/2012 11035.00000 36-04-27.3 N MD NE 077-43-52.6 W 0005170167 USCOC OF CUMBERLAND, LLC Hagerstown 04/18/2012 10815.00000 39-41-04.1 N GA NE 084-38-17.9 W 0005170238 Verizon Wireless (VAW) LLC RICHLAND 04/18/2012 06286.19000 32-05-04.2 N Page 20 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WA NE 117-19-50.0 W 0005170477 Ptera Wireless SPOKANE 04/18/2012 11385.00000 47-42-26.0 N WA NE 117-19-50.0 W 0005170477 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313836A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313836A1.txt  
- Nextweb, Inc Fremont 04/27/2012 18025.00000 37-29-20.0 N CA AM WPRS714 121-56-48.0 W 0005130686 Nextweb, Inc Fremont 04/27/2012 23025.00000 37-29-20.0 N CA AM WPRS714 121-56-48.0 W 0005130686 Nextweb, Inc Fremont 04/27/2012 23225.00000 37-29-20.0 N CA AM WPRS714 121-56-48.0 W 0005130686 Nextweb, Inc Fremont 04/27/2012 23275.00000 37-29-20.0 N NC AM 077-58-57.0 W 0005143126 Carolina Power & Light Company d/b/a PrWilmington 04/23/2012 06315.84000 34-17-04.1 N NC AM 077-58-57.0 W 0005143126 Carolina Power & Light Company d/b/a PrWilmington 04/23/2012 06404.79000 34-17-04.1 N TX AM 100-54-12.2 W 0005145848 Transworld Network Corp Clarendon 04/24/2012 11305.00000 35-09-35.2 N TX AM 100-54-12.2 W 0005145848 Transworld Network Corp Clarendon 04/24/2012 11345.00000 35-09-35.2 N TX AM 100-16-32.0 W 0005145849 Transworld Network Corp WHEELER 04/24/2012 10975.00000 35-25-57.0 N TX AM 100-16-32.0 W 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313951A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/DOC-313951A1.txt  
- 10 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City WI MD WQGG854 087-11-32.5 W 0005188684 Wisconsin RSA#10, Limited PartnershipJACKSONPORT 05/01/2012 10875.00000 44-58-04.7 N WI MD WQME846 087-08-15.7 W 0005188692 Wisconsin RSA #10, Limited PartnershipBAILEYS HARBOR 05/01/2012 11365.00000 45-03-50.5 N MD MD WMR415 079-18-04.1 W 0005189361 USCOC OF CUMBERLAND, LLC THAYERVILLE 05/02/2012 06755.00000 39-31-11.3 N MD MD WQJL404 079-21-40.8 W 0005189373 USCOC OF CUMBERLAND, LLC Oakland 05/02/2012 10935.00000 39-24-29.4 N FL MD WQOM379 081-50-23.8 W 0005189388 T-MOBILE LICENSE LLC Bartow 05/02/2012 10975.00000 27-54-21.4 N FL MD WQOM379 081-50-23.8 W 0005189388 T-MOBILE LICENSE LLC Bartow 05/02/2012 11055.00000 27-54-21.4 N FL MD WQOM379 081-50-23.8 W 0005189388 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-104A1.pdf  
- order to 157 Bell Atlantic comments at 12; AT&T comments at 24; CinBell comments at 9; Ohio Commission comments at 14; Wisconsin Commission comments at 4. 158 The POI is the carrier's physical point of interconnection to the public switched telephone network (PSTN) for the purpose of interchanging traffic on the PSTN. 159 CO Code Assignment Guidelines at §§ 3.1, 4.1. 160 Id. at § 4.4. 161 Id. at § 4.1.3. An applicant may also obtain an initial NXX code in order to establish an initial Location Routing Number (LRN) per POI or switching entity for each Local Access and Transport Area (LATA), if the carrier has no existing resources available for LRN assignment. Id. at § 4.1.3.1. 162 Id. at 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-160A1.doc  
- supra, for a description of ARINC. FAA Revised Petition refers to a broadcast mode of delivery for FIS known as ``Flight Information Services-Broadcast (FIS-B),'' a concept currently under development. With FIS-B, an on-board server will be responsible for personalizing products to pilot's needs. See Aeronautical Spectrum Planning for 1997-2010, Doc. No. RTCA/DO-210 January 27, 1997, published by RTCA, Inc., Section 4.1.2.3. For this Notice, we will use the term FIS that appears to encompass FIS-B. We seek comments on the use of these terms. See para. 12 and note 73, infra. The FAA states that the original petition remains valid except as amended in its revision. FAA Revised Petition at 1. The FAA proposes a 25 kHz channeling plan for the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-202A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-202A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-202A1.txt  
- 8104033; Shy Shin Luh, Digital Subscriber Lines Are the Latest Internet Wave, But Baby Bells Aren't Making the Connection Quickly, Washington Post, Aug. 23, 1999 at F5. A recent report by TeleChoice shows spectacular DSL growth during 1999 and projects continued rapid growth in the future. See TeleChoice, Inc., Deployment - Updated Nov. 5, 1999, http://www.xdsl.com/content/resources/deployment_info.asp. The Yankee Group predicts 4.1 million DSL lines in 2002. See Sarah L. Roberts-Witt, The Coming DSL-Cable Race, Internet World, Nov. 15, 1999, http://www.iw.com/print/1999/11/15/infra/19991115-DSL.html. The Commission's Cable Services Bureau observed in October 1999 that: ``The ILECs' aggressive deployment of DSL can be attributed in large part to the deployment of cable modem service. Although the ILECs have possessed DSL technology since the late 1980s, they 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-264A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-264A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-264A1.txt  
- joint use should be encouraged. See PSWAC Final Report at 3-4. 47 C.F.R. §§ 90.179, 90.421. For example, licenses are issued for ten-year, renewable terms, and a federal entity can only use the 700 MHz band under a Section 2.103(b) agreement for as long as the state or local ally remains licensed. See 47 C.F.R. § 2.106; NTIA Manual § 4.1.3. See also Reallocation Report and Order. Section 337 of the Act required the Commission to consult with the Secretary of Commerce and the Attorney General in the reallocation of the 700 MHz band spectrum. See 47 U.S.C. § 337(a)(1). See First Report and Order, 14 FCC Rcd at 184 ¶ 62 (citing 47 U.S.C. § 305; 47 U.S.C. §§ 901-904 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-289A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-289A1.txt  
- million Tele Danmark 41.6 Norway 720,000 NetCom 19.6 (controls 27.9% through investment in Tele Danmark) Belgium 1.9 million Belgacom 17.5 (controls 24.4% through investment in Tele Danmark, which owns 16.5% of Belgacom) Switzerland 413,000 DiAx 40 Hungary 867,000 MATAV 29.8 South Africa 2.1 million (Vodacom) Telkom SA(owns 50% of Vodacom) 18 Canada 1.9 million (Bell Mobility) Bell Canada 20 Mexico 4.1 million Telmex 9 Taiwan 478,000 TransAsia Tele- communications 19.4 SBC Brazil 900,000 Algar Telecom Leste SA (ATL) 50 (stake is jointly owned with Telmex and can be increased to 50% in 2004) Canada 2.6 million Rogers Cantel 17 Colombia 466,000 Celumovil 14 India 90,000 Birla Communications Ltd. 49 Taiwan 1.425 million FarEasTone 14 Japan 8.1 million (J-Phone) Japan Telecom 15 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-418A1.txt  
- antenna G/T dB 14.5 14.5 14.5 14.5 C/I for other assignments in the BSS Plan dB 20.0 20.0 20.0 20.0 Clear-sky feeder link C/(N+I) dB 26.2 26.2 26.2 26.2 Clear-sky carrier-to-noise plus interference ratio dB 10.7 13.6 8.9 13.7 Required C/(N+I) for operating threshold dB 6.1 6.1 6.1 6.1 Link margin dB 4.6 7.5 2.8 7.7 Rain margin dB 1.82 4.1 0.93 4.22 Rain intensity exceeded for 0.01% of an average year mm/h 30.3 48.2 36.1 95.7 Satellite link availability for an average year % 99.98 99.92 99.71 99.59 Satellite link unavailability for an average year % 0.0207 0.0843 0.2873 0.4120 Total link unavailable time for an average year minutes 108.8 443.1 1510 2165.5 10% of the unavailable time in an 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-47A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-47A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-00-47A1.txt  
- Resource Optimization Report indicates that number pooling techniques and LNP share a common technological architecture, and a number of state commissions noted that continued CMRS LNP implementation is necessary for CMRS participation in number pooling. See Number Resource Optimization Working Group Modified Report to the North American Numbering Council on Number Optimization Methods, October 21, 1998, at Executive Summary, §§ 4.1, 5.1.2 (1998 NANC Numbering Resource Optimization Report) (available at ). See also CMRS LNP Forbearance Order, 14 FCC Rcd at 3093, 3096-97, 3113 and n.120, ¶¶ 2, 8, 43. In the Extension Order, we specifically sought comment from wireless carriers and other interested parties on, among other things, whether it is appropriate from a legal, policy, or technical standpoint to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-11A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-11A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-11A1.txt  
- an AIHS application that includes the transmission and reception, utilizing a names and presence directory (``NPD'') over the Internet Protocol path of AOL Time Warner broadband facilities, of one- or two-way streaming video communication using NPD protocols - including live images or tape - that are new features, functions, and enhancements beyond those offered in current offerings such as AIM 4.1 or ICQ 2000b, unless and until AOL Time Warner has successfully demonstrated it has complied with one of the following grounds for relief. Grounds for Relief. Option One. AOL Time Warner may file a petition demonstrating that it has implemented a standard for server-to-server interoperability of NPD-based services that has been promulgated by the IETF or a widely recognized standard-setting 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-12A1.doc  
- of a football game). Some of these new IM-based services -- and perhaps the most important ones in the long term -- are bandwidth-intensive and therefore will work best with high-speed Internet access. These AIHS include time-sensitive, ``latency-dependent'' applications such as talking (e.g., a Talk Feature that enables users to engage in live conversation online and is included in AIM 4.1), game-playing (e.g., features in AOL's New Windows AIM 4.3, buddies jointly `playing along' with popular quiz shows such as Jeopardy! or Who Wants to Be a Millionaire?, or enacting their own versions of those shows online, independent of television broadcasts), and buddies sending each other brief music and video clips. Even more bandwidth-intensive will be video conferencing via IM, which 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-142A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-142A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-142A1.txt  
- Feb. 9 Response to Supplemental Information Request at 17-18. Id. at 16. The preferred shares DT holds differ from common shares primarily in that the preferred shares have a liquidation preference and receive dividends based on the number of common shares that DT would hold if it converted the preferred shares to common. See VoiceStream Wireless Corporation, Form 8-K, Exh. 4.1, Certificate and Designation of the Powers, Preferences and Relative, Participating, Optional and Other Special Rights and Qualifications, Limitations and Restrictions Thereof of Convertible Voting Preferred Stock of VoiceStream Wireless Corporation (VoiceStream Certification and Designation of Rights) at §§ 1(b), (d) and (h) (filed Oct. 11, 2000, Securities and Exchange Commission); Applicants Response to Supplemental Information Request at 16. Applicants Feb. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-162A1.txt  
- Switching Equipment Account 2220 - Operator Systems Category 1 - Operator Systems Equipment (by type of board) Separate toll boards Separate local manual boards Combined local manual and toll boards Combined toll and DSA boards Separate DSA and DSB boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-173A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-173A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-173A1.txt  
- $16.10 per minute); and Low-Power Multi-Channel Ship Station Service during off-peak hours (from $2.80 to $2.50 per minute). Compare January 16, 2001 Letter at Exhibit A, Annex at § 1.8 with January 16, 2001 Letter at Exhibit B, Annex. Complaint at 4, ¶ 12; Answer at 18-19, ¶ 36; January 16, 2001 Letter at Exhibit B, Attachment 1 at § 4.1. IDB Mobile Communications, Inc. v. COMSAT Corporation, Supplemental Reply Brief of COMSAT Corporation, File No. E-97-48 (filed Jul. 21, 2000) at App. A (``COMSAT Supplemental Reply''). Moreover, in June 1995, COMSAT's tariffed rate for INMARSAT Standard-A space segment was $9.30 per minute, whereas the Contract rate was $5.10. See February 2, 2001 Letter at 3; January 16, 2001 Letter at 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-290A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-290A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-290A1.txt  
- Devices``, published by the Institute of Electrical and Electronics Engineers, Inc. on March 24, 1998 as document number SH94568. This incorporation by reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR Part 51. Other intentional and unintentional radiators are to be measured for compliance using the following procedure excluding section 4.1.5.2, section 5.7, section 9 and section 14: Institute of Electrical and Electronics Engineers (IEEE) C63.4-2000, entitled ``Interim Standard for Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the Range of 9 kHz to 40 GHz,'' published by the Institute of Electrical and Electronics Engineers, Inc. on December 8, 2000 as document number SH94908. This incorporation 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-303A1.txt  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries were not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1. The United States has not adopted 8.33 kHz spacing. See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-305A1.txt  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt.- Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1 - Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt. - Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt. - Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-338A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-338A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-338A1.txt  
- read to impose on incumbent LECs an obligation to provide access to their splitters''); see also Line Sharing Order, 14 FCC Rcd at 20940, para. 76. Line Sharing Reconsideration Order, 16 FCC Rcd at 2109-110. In fact, with respect to DS-1 provisioning quality and maintenance in Missouri, SWBT missed two months in a four-month period for only one performance metric, 56-04.1 (``Percent Installed Within the Customer Requested Due Date DS-1 Loops (1-10)'' ). SWBT Dysart Missouri II Reply Aff. Tab D at D-124, Measurement 56-04.1 (``Percent UNEs Installations Completed Within the Customer Requested Due Dates''). During the 4-month period from April to July 2001, SWBT's 3-day installation rate of DS-1 loops was worse for competitors in May and June, than for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-369A1.txt  
- employees who may handle Classified, Controlled Unclassified or Sensitive Information to maintain the confidentiality and security of such information in accordance with applicable U.S. legal authority and the terms of this Agreement; and Maintain appropriately secure facilities (e.g., offices or areas) for the handling and storage of any Classified, Controlled Unclassified and Sensitive Information. ARTICLE 4: AUDITING, REPORTING, and NOTICE 4.1 Access to Information: In response to reasonable requests made by the FBI or the DOJ, Telenor shall provide in the United States access to information concerning technical, physical, management, or other security measures and other reasonably available information needed by the FBI or the DOJ to assess compliance with this Agreement. 4.2 Visits and Inspections: The FBI and the DOJ 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-49A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-49A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-01-49A1.txt  
- children's, news, sports, and general entertainment -- for the competitive and noncompetitive groups. This table shows that increases were relatively uniform across all programming categories. Attachment C-1 provides additional information on the number of channels offered in each category. Table 9. Average Number of Satellite Channels by Type of Programming Competitive Group Noncompetitive Group 7/1/99 7/1/00 7/1/99 7/1/00 Children's 3.8 4.1 3.2 3.7 News 6.4 6.7 5.9 6.3 Sports 4.3 4.8 3.6 4.0 General Entertainment 29.5 31.7 26.9 29.1 Total Satellite Channels† 44.0 47.3 39.6 43.1 †Satellite channels reported here include all CPST channels, not just those carried on the most highly-subscribed CPST, as well as any satellite channels carried on BST. See Attachment C-1 for other results. Annual System Revenues 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-105A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-105A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-105A1.txt  
- defines the word ``terminates,'' both agreements provide a criterion for determining whether traffic terminates on the other party's network for the purposes of the agreements' reciprocal compensation provisions. Specifically, paragraph 5.7.5 of the First Starpower-Verizon Virginia Agreement provides that traffic shall be designated local or non-local based upon the ``actual originating and terminating points of the complete end-to-end call.'' Paragraph 4.1 of the Second Starpower-Verizon Virginia Agreement similarly states that whether traffic is subject to local call transport and termination rates depends on the ``actual end-to-end jurisdictional nature of each call sent over the trunk.'' We believe that each agreement's use of the phrase ``end-to-end'' is an incorporation of the Commission's long-standing method of determining the jurisdictional nature of particular traffic. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-10A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-10A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-10A1.txt  
- of Intent to Revoke Part 68 Interconnection Authority pursuant to §§ 1.80 and 1.89 of this chapter. * * * * * Subpart D - Conditions for Registration 120. Section 68.317 is amended by revising paragraph (g) as follows: § 68.317 Hearing aid compatibility volume control: technical standards. * * * * * (g) These incorporations by reference of paragraph 4.1.2 (including table 4.4) of American National Standards Institute (ANSI) Standard ANSI/EIA-470-A-1987 and paragraph 4.3.2 of ANSI/EIA/TIA-579-1991 were approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of these publications may be purchased from the American National Standards Institute (ANSI), Sales Department, 11 West 42nd Street, 13th Floor, New York, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-110A1.txt  
- § 25.215. Comments of Tempo at 5. See, e.g., Letter from Pantelis Michalopoulos, Counsel to EchoStar, to Magalie Roman Salas, Secretary (dated August 27, 1999) specifying 1.2 MHz of spectrum for the uplink TT&C functions of the EchoStar 5 or 6 satellites, and 1.2 MHz for the downlink TT&C functions. Section 3.9 of Annex 5 to Appendix 30 and Section 4.1 of Annex 3 to Appendix 30A. 47 C.F.R. § 25.210(a)(3). Comments of Tempo at 5. Section 25.204(b) states that ``in bands shared coequally with terrestrial radio-communication services, the equivalent isotropically radiated power transmitted in any direction towards the horizon by an earth station operating in frequency bands above 15 GHz shall not exceed the following limits except as provided for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-113A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-113A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-113A1.txt  
- While not clearly delineated, it appears from the Investment and Stockholder Agreements that the NBC-nominated members of Paxson's board are permitted to vote on all matters that come before the Paxson board. This includes the right to vote on certain extraordinary Paxson corporate matters for which NBC has a ``veto right.'' These extraordinary matters are outlined in Article IV, Section 4.1 of the Investment Agreement and limit such actions as Paxson amending its corporate documents, increasing the size of its board of directors, or incurring large amounts of additional debt, without NBC's consent. The associated Certificate of Designations of the NBC Preferred Stock also include a covenant that limits Paxson's ability to incur additional indebtedness, a common shareholder protection provision. That 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-147A1.txt  
- within 30 Days A.2.14 P-5 Average Completion Notice Interval - Mechanized A.2.15 P-5 Average Completion Notice Interval - Non-Mechanized A.2.25 P-11 Service Order Accuracy Maintenance and Repair A.3.1 M&R-1 Missed Repair Appointments A.3.2 M&R-2 Customer Trouble Report Rate A.3.3 M&R-3 Maintenance Average Duration A.3.4 M&R-4 % Repeat Troubles within 30 Days A.3.5 M&R-5 Out of Service > 24 hours Billing A.4.1 B-1 Invoice Accuracy A.4.2 B-2 Mean Time to Deliver Invoices - CRIS UNBUNDLED NETWORK ELEMENTS Ordering B.1.1 O-7/O-13 % Rejected Service Requests - Mechanized B.1.2 O-7/O-13 % Rejected Service Requests - Partially Mechanized B.1.3 O-7/O-13 % Rejected Service Requests - Non-Mechanized B.1.4 O-8/O-14 Reject Interval - Mechanized B.1.7 O-8/O-14 Reject Interval - Partially Mechanized - 10 hours B.1.8 O-8/O-14 Reject 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-179A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-179A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-179A1.txt  
- In South Korea, cdma 1X services have proven to be fairly popular thus far. As of March 2002, SK Telecom had over 5 million 1xRTT subscribers, up from approximately 2 million in October 2001. Furthermore, SK Telecom's wireless Internet revenue rose 55 percent during the first quarter of 2002 and represented 6.6 percent of the company's total revenue, up from 4.1 percent during the previous quarter. On the other hand, the adoption rate of GPRS service has been lower than expected in many countries, and the popularity of GPRS service does not match the level of popularity that SMS has achieved around the world. One analyst estimates there were only one million GPRS customers in all of Europe at the end 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-179A1_Erratum.doc  
- In South Korea, cdma 1X services have proven to be fairly popular thus far. As of March 2002, SK Telecom had over 5 million 1xRTT subscribers, up from approximately 2 million in October 2001. Furthermore, SK Telecom's wireless Internet revenue rose 55 percent during the first quarter of 2002 and represented 6.6 percent of the company's total revenue, up from 4.1 percent during the previous quarter. On the other hand, the adoption rate of GPRS service has been lower than expected in many countries, and the popularity of GPRS service does not match the level of popularity that SMS has achieved around the world. One analyst estimates there were only one million GPRS customers in all of Europe at the end 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-298A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-298A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-298A1.txt  
- the necessary bandwidth of the system is 80 kHz, the measurement bandwidth may be adjusted down to 1 kHz, which is the next higher measurement bandwidth above 1% of 80 kHz, or 0.80 kHz. See International Telecommunication Union (ITU) Radio Regulations, Appendix 3, Table of Maximum Permitted Spurious Emission Power Levels, at 10; ITU Recommendation ITU-R SM.329-9, Spurious Emissions, at 4.1 and at Annex 2, 1.1.2. For example, for a digital system operating below 15 GHz, the emissions mask reference bandwidth stated in the rule is 4 kHz, less than the measurement resolution bandwidths of 1 MHz for frequencies above 1 GHz and 100 kHz for frequencies below 1 GHz. Using a wider resolution bandwidth allows more energy to enter the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-312A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-312A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-312A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Note 1 to Table 1. 47 C.F.R. § 1.1310, Note 2 to Table 1. 47 C.F.R. § 1.1307(b). The former Mass Media Bureau granted A-O's application for a license to cover the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-314A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-314A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-314A1.txt  
- ALLTEL Supplemental Answer and Century Supplemental Answer at IV-2 - IV-3, incorporating by reference Citizens Supplemental Answer at III-4. MCI Telecommunications Corp. v. FCC, 59 F.3d 1407, 1414 (D.C. Cir. 1995), cert. denied, 517 U.S. 1129 (1996), quoting 47 U.S.C. § 206 (emphasis added). 47 U.S.C. § 209. See ¶ 33, supra. 1 Dan B. Dobbs, Law of Remedies § 4.1(1), at 555 (2d ed. 1993). See id. See MCI, 59 F. 3d at 1415. Restatement (Third) of Restitution and Unjust Enrichment § 17. See Restatement (Third) of Restitution and Unjust Enrichment § 1 cmt. H (Discussion Draft 2000) (``restitution . . . is itself a source of obligations, analogous in this respect to tort or contract. A liability in restitution 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-329A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-329A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-329A1.txt  
- month); Qwest Corporation Tariff FCC No. 1, Sections 4.7.1, issued Aug. 5, 2002, 13.21, issued Jun. 18, 2002 ($0.56 per line per month "Federal Universal Service End User Charge" for residential customers in Iowa equivalent to an assessment rate of approximately 11.5 percent based on subscriber line charge of $4.87 per line per month); Verizon Tariff F.C.C. No. 1, Sections 4.1.7.1(A), issued Jun. 28, 2002, 4.1.7.1(H), issued Oct. 15, 2002 ($0.59 per line per month "Federal Universal Service Fund" surcharge for residential customers in the District of Columbia equivalent to an assessment rate of approximately 15.28 percent based on subscriber line charge of $3.86 per line per month). Under one carrier's surcharge, a customer that makes a $0.19 one minute call 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-331A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-331A1.txt  
- a benchmark. Note that for some metrics during the period provided there may be changes in the metric definition, or changes in the retail analog applied, making it difficult to compare data over time. Metric SQM No.Metric Name Metric SQM No.Metric Name RESALE A.3.5 M&R-5Out of Service > 24 hours Ordering Billing A.1.1 O-7 % Rejected Service Requests  Mech. A.4.1 B-1 Invoice Accuracy A.1.2 O-7 % Rejected Service Requests - Partially Mech. A.4.2 B-2 Mean Time to Deliver Invoices  CRIS A.1.3 O-7 % Rejected Service Requests - Non-Mech. UNBUNDLED NETWORK ELEMENTS A.1.4 O-8 Reject Interval  Mech. Ordering A.1.7 O-8 Reject Interval - Partially Mech.  10 hours B.1.1 O-7/O-13% Rejected Service Requests  Mech. A.1.8 O-8 Reject Interval 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-340A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-340A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-02-340A1.txt  
- ATM is a ``high bandwidth, low-delay, connection-oriented packet-like switching and multiplexing technique'' in which ``[u]sable capacity is segmented into 53-byte fixed-sized cells, consisting of header and information fields [and] allocated to services on demand.'' Harry Newton, Newton's Telecom Dictionary: The Official Dictionary of Telecommunications and the Internet, 63 (17th ed. 2001) (Newton's Telecom Dictionary); see ASI FCC Tariff, at § 4.1. Frame relay is a ``high-speed, packet-switched technology used to transmit digital data between, among other things, geographically dispersed local area networks (LANs).'' Independent Data Communications Manufacturers Association, Inc., Memorandum Opinion and Order, 10 FCC Rcd 13717, 13720, para. 6 (Com. Car. Bur. 1995) (Frame Relay Order); see ASI FCC Tariff, at § 5.1. ASI sells its ATM and frame relay 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-149A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-149A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-149A1.txt  
- published by the Institute of Electrical and Electronics Engineers, Inc. on March 24, 1998 as document number SH94568. This incorporation by reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR Part 51. (3) Other intentional and unintentional radiators are to be measured for compliance using the following procedure excluding section 4.1.5.2, section 5.7, section 9 and section 14: American National Standards Institute (ANSI) C63.4-2001, entitled ``American National Standard for Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the Range of 9 kHz to 40 GHz'' published by the Institute of Electrical and Electronics Engineers, Inc. on June 22, 2001 as document number SH94908. This incorporation by 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-150A1.txt  
- represents 27 percent of total telecommunications expenditures. The long distance, local, and the payphone segments of wireline telecommunications have all been losing business to wireless substitution. Long distance volumes and revenues are down at AT&T, MCI, and Sprint as customers shift to wireless services to make their calls. Verizon, SBC, and BellSouth saw business and consumer access lines fall 3.6, 4.1, and 3.2 percent, respectively, in 2002, for a total decrease of 5.5 million lines, with wireless substitution being a significant factor. Similarly, the number of payphones has declined from 2.7 million in the mid-1990s to about 1.9 million today, in large part due to wireless phones. Even the prepaid calling card business is suffering, as consumers are now ``utilizing their 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4.txt  
- same band plan, power and out-of-band emission levels for MSS ATC will provide for continued MSS use of the 1610-1626.5 MHz band with ATC operations. 3.2 Intra-Service Sharing 2483.5-2500 MHz The MSS downlink allocation from 2485.3 MHz - 2500 MHz is occupied solely by Globalstar. Therefore, the intra-service considerations are internal to the Globalstar system. 4.0 Inter-Service Sharing Interference Analysis 4.1 Inter-Service Sharing 1610-1626.5 MHz 4.1.1 Limitations on ATC MT Out-Of-Band Emission Levels to Protect Adjacent Band Systems Global Positioning System (GPS). Out-of-band emission levels for ATC MT transmitters are required to protect Radionavigation Satellite Service (RNSS) systems such as GPS and L-band Mobile Satellite Service (MSS) systems such as Inmarsat from potentially unacceptable interference. This specific interference issue has been 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-15A4_Erratum.doc  
- same band plan, power and out-of-band emission levels for MSS ATC will provide for continued MSS use of the 1610-1626.5 MHz band with ATC operations. 3.2 Intra-Service Sharing 2483.5-2500 MHz The MSS downlink allocation from 2485.3 MHz - 2500 MHz is occupied solely by Globalstar. Therefore, the intra-service considerations are internal to the Globalstar system. 4.0 Inter-Service Sharing Interference Analysis 4.1 Inter-Service Sharing 1610-1626.5 MHz 4.1.1 Limitations on ATC MT Out-Of-Band Emission Levels to Protect Adjacent Band Systems Global Positioning System (GPS). Out-of-band emission levels for ATC MT transmitters are required to protect Radionavigation Satellite Service (RNSS) systems such as GPS and L-band Mobile Satellite Service (MSS) systems such as Inmarsat from potentially unacceptable interference. This specific interference issue has been 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-238A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-238A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-238A1.txt  
- Aeronautical Radio Frequency Spectrum Utilization, Amendment No. 72, International Civil Aviation Organization, Montreal, 1997 (ISRP). Ordinarily, when the ICAO adopts International Standards and Recommended Practices, they are binding on the contracting countries. However, contracting countries were not required to implement 8.33 kHz channel bandwidths if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, ¶ 4.1.2.1. The United States continues to use 25 kHz channels. See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, the Netherlands, Switzerland and the United Kingdom. Id. See 47 C.F.R. §§ 87.39 (specifying that aircraft 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-258A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-258A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-258A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. § 1.1310, Note 1 to Table 1. 47 C.F.R. § 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. §§ 1.1307(b), 1.1307(b)(1), 1.1310. Id. at 13520-21; 47 C.F.R. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-324A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-324A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-324A1.txt  
- maximum power, or such other operating conditions, contained in this part or in the station authorization. (d) Safety/public safety priority. The following access priority governs all DSRCS operations: (1) communications involving the safety of life have access priority over all other DSRCS communications; (2) subject to a Control Channel priority system management strategy (see ASTM E2213-03 DSRC Standard at § 4.1.1.2(4)) DSRCS communications involving public safety have access priority over all other DSRC communications not listed in paragraph (d)(1). Roadside Units (RSUs) operated by state or local governmental entities are presumptively engaged in public safety priority communications. (e) Non-priority communications. DSRCS communications not listed in paragraph (d) are non-priority communications. If a dispute arises concerning non-priority communications, the licensee of the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-3A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-03-3A2.txt  
- adhere to the compliance and robustness rules as specified in the DFAST License Agreement. 10 4. Advanced Interactive Digital Cable n (n = TV, Tuner, etc) Product Definition (This is a two-way product) Both MSOs and CE Manufacturers agree to continue to work together to create appropriate specifications, technical descriptions and labeling/information requirements for Advanced Interactive (two-way) Digital Cable Products. 4.1. The Parties will agree upon a recognized term for the advanced interactive digital cable products in summary form. The Parties will discuss whether there should be a requirement to mark product in any way with this name, but both MSOs and CE Manufacturers are encouraged to use this name to promote consumer awareness. 4.2. Interoperability Testing and Certification Requirements: Because 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-165A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-165A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-165A1.txt  
- of Part 15 continues to read as follows: AUTHORITY: 47 U.S.C. 154, 302, 303, 304, 307, 336, and 544A. Section 15.7 is deleted. Section 15.31 is amended by revising paragraph (a)(3) to read as follows: Section 15.31 Measurement standards. * * * (3) Other intentional and unintentional radiators are to be measured for compliance using the following procedure excluding sections 4.1.5.2, 5.7, 9 and 14: ANSI C63.4-2003: ``Methods of Measurement of Radio-Noise Emissions from Low-Voltage Electrical and Electronic Equipment in the Range of 9 kHz to 40 GHz'' (incorporated by reference, see § 15.38). This incorporation by reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR Part 51. 11. Section 15.38 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-168A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-168A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-168A1.txt  
- Comments at 5; IACP Comments at 4; City of New York Comments to Supplemental Comments of the Consensus Parties at 8. See, e.g., 47 C.F.R. § 73.699, Figures 9, 10 and 10b. Consensus Parties Aug. 7 Ex Parte at 45-50 and Appendix F at 2, § 1.2. Id. Appendix F at 3, § 2.1.1. Id. Appendix F at 8, § 4.1.1a. ``Carrier'' in the sense used here, equates with ``desired signal;'' i.e. the signal from the public safety, CII or other non-cellular base station. Consensus Parties Aug. 7 Ex Parte Appendix F at 2, § 1.2.1. Id. Appendix F at 2, § 1.2.2. & Figure 1 infra. Consensus Parties Aug. 7 Ex Parte Appendix F at 3, § 2.1.1a. This level 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-168A1_Erratum.doc  
- Comments at 5; IACP Comments at 4; City of New York Comments to Supplemental Comments of the Consensus Parties at 8. See, e.g., 47 C.F.R. § 73.699, Figures 9, 10 and 10b. Consensus Parties Aug. 7 Ex Parte at 45-50 and Appendix F at 2, § 1.2. Id. Appendix F at 3, § 2.1.1. Id. Appendix F at 8, § 4.1.1a. ``Carrier'' in the sense used here, equates with ``desired signal;'' i.e. the signal from the public safety, CII or other non-cellular base station. Consensus Parties Aug. 7 Ex Parte Appendix F at 2, § 1.2.1. Id. Appendix F at 2, § 1.2.2. & Figure 1 infra. Consensus Parties Aug. 7 Ex Parte Appendix F at 3, § 2.1.1a. This level 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-174A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-174A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-174A1.txt  
- contain any cost studies for these services). Letter from Colin Sandy, NECA, to Marlene H. Dortch, Sec'y, FCC, RM-10603 at 3-4 (filed Jan. 31, 2003) (NECA Jan. 31, 2003 Ex Parte Letter). See 47 C.F.R. §§ 69.130, 69.157. See NECA Tariff F.C.C. No. 5, § 17.1.4(B) ($23.51 per arrangement ISDN PRI Line Port charge); Verizon Tariff F.C.C. No. 1, § 4.1.7(C)(2) ($23.43 per service ISDN PRI line port charge). See infra section IV.B. See MAG Order, 16 FCC Rcd at 19667-68, para. 128. See id. at 19673-74, para. 142. We note that the Joint Board recently reviewed related issues concerning the portability of universal service support and the designation of competitive ETCs. See Federal-State Joint Board on Universal Service, CC Docket 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-188A1.txt  
- citation for Part 4 reads as follows: Authority: Sections 1, 4(i), 4(j), 4(o), 218, 219, 230, 256, 301, 302(a), 303(f), 303(g), 303(j), 303(r), 403, 621(b)(3), and 621(d) of the Communications Act of 1934, as amended, 47 U.S.C. 151, 154(i), 154(j), 154(o), 218, 219, 230, 256, 301, 302(a), 303(f), 303(g), 303(j), 303(r), 403, 621(b)(3), and 621(d), unless otherwise noted. GENERAL § 4.1 Scope, basis and purpose. By these rules the Federal Communications Commission is setting forth requirements pertinent to the reporting of disruptions to communications and to the reliability and security of communications infrastructures. § 4.2 Availability of reports filed under this part. Reports filed under this Part will be presumed to be confidential. Public access to reports filed under this part 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-192A1.txt  
- DTV products represented more than 10 percent of all television sales in 2002. In the first quarter of 2003, according to CEA, 766,000 DTV product units were sold, which was up 86 percent over the first quarter unit sales of 2002. CEA projected that manufacturers would sell 3.8 million DTV sets and displays in 2003. According to the CEA's website, 4.1 million DTV products were sold in 2003 for about $6.1 billion, a 44 percent increase in dollar sales and a 56 percent increase in unit sales from 2002. More than 640,000 digital television sets were sold in December 2003 alone. CEA predicts that 5.8 million digital sets will be sold in 2004, 8.3 million in 2005, 11.9 million in 2006 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-193A1.txt  
- Adopter Agreement at Ex. A, § 1. The applicable administrative fee for content participants is $50,000 per year. HDCP Certification at 15; HDCP Content Participant Agreement at Ex. C. HDCP Certification at 11, 15. The change management provision governing license fees limits adjustments to costs. Id. at 14; HDCP Adopter Agreement at § 4.2; HDCP Content Participant Agreement at § 4.1. TiVoGuard Certification at 25. Id. at 34. Id. at 32-33. TiVo indicates that it has granted licenses to several manufacturers to create products providing DVR capabilities, including Pioneer Corporation, Toshiba Corporation, Toshiba American Consumer Products, Inc., Sony Electronics, Inc., Humax Corporation, Ltd. and DIRECTV, Inc. Id. at 32. TiVo specifies that it has not yet licensed its TiVoToGo technology to 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-281A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-281A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-281A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-30A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-30A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-30A1.txt  
- acceptability of individual TCBs, and to develop procedures that TCBs will use for performing post-market surveillance. (i) The Chief of the Office of Engineering and Technology is delegated authority to make nonsubstantive, editorial revisions to the Commission's rules and regulations contained in parts 2, 4, 5, 15, and 18 of this chapter. PART 4 - DISRUPTIONS TO COMMUNICATIONS GENERAL Sec. 4.1 Scope, basis and purpose. Reporting Requirements for Disruptions to Communications Communications providers covered by the requirements of this part. Definitions of outages, special offices and facilities, and 911 special facilities. Definitions of metrics used to determine the general outage-reporting threshold criteria. Outage reporting requirements -- threshold criteria. 4.11 Initial and final communications outage reports that must be filed by communications 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-04-5A1.txt  
- for example, a movie tier, a variety tier, a sports and information tier, a TeleLatina tier, and a Discovery tier. Cox also offers a series of multiplexed premium digital tiers, including HBO, Showtime, and international premium services, such as TV Asia and Washington Korean TV. As of June 30, 2003, Time Warner had 11.1 million basic cable subscribers and over 4.1 million digital cable subscribers. Time Warner's digital cable service offers up to 200 video and audio channels. By year end 2002, Cablevision had approximately 3.0 million basic cable service subscribers and 216,500 digital video subscribers. At the end of June 2003, the number of Cablevision's digital video subscribers had grown to 597,600. Charter provided digital video service to approximately 2.7 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-12A1.txt  
- ending January 1, 2004. This increase is lower than the 7.8 percent increase for the year ending January 1, 2003, and the 7.5 percent 5-year average annual rate of change over the period beginning July 1, 1998 and ending on January 1, 2004. The average number of channels on basic and expanded basic increased from 67.5 to 70.3 channels, a 4.1 percent increase for the year ending January 1, 2004, which is lower than the 6.3 percent 5-year average. To account for changes in the number of channels, we calculated average price per channel. The price per channel increased by 1.2 percent, from 65.2 cents per channel to 66.0 cents per channel, compared with the 5-year average of 0.4 percent. The 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-14A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-14A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-14A1.txt  
- in line-of-sight of the TDRSS site. Determination of the particular distance at which line-of-sight terminals must coordinate can be accomplished in a number of ways. For example, Section 25.213 uses a formula for determining the distance (d) at which airborne mobile earth stations in the 1.6/2.4 GHz band must coordinate with radio astronomy sites. That formula is d (km) = 4.1 square root of (h), where h is the altitude of the aircraft in meters above ground level. See 47 C.F.R. § 25.213(a)(1)(iv). This public notice would also indicate that the final operating parameters for the new site would be subject to coordination through the Frequency Assignment Subcommittee ("FAS") of NTIA's Interdepartment Radio Advisory Committee, if such coordination has not already 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-14A1_Erratum.doc  
- in line-of-sight of the TDRSS site. Determination of the particular distance at which line-of-sight terminals must coordinate can be accomplished in a number of ways. For example, Section 25.213 uses a formula for determining the distance (d) at which airborne mobile earth stations in the 1.6/2.4 GHz band must coordinate with radio astronomy sites. That formula is d (km) = 4.1 square root of (h), where h is the altitude of the aircraft in meters above ground level. See 47 C.F.R. § 25.213(a)(1)(iv). This public notice would also indicate that the final operating parameters for the new site would be subject to coordination through the Frequency Assignment Subcommittee ("FAS") of NTIA's Interdepartment Radio Advisory Committee, if such coordination has not already 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-173A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-173A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-173A1.txt  
- carriers continue to expand into smaller communities. CTIA reported that roaming revenues for the mobile telephone industry increased over the past year, from $3.8 billion in 2003 to $4.2 billion in 2004, reversing the trend of the last few years. However, the contribution of roaming revenues to total service revenues continued its decline, from 4.3 percent reported in 2003 to 4.1 percent in 2004, and down from over 10 percent five years ago. Advertising and Marketing Firms may engage in advertising and marketing either to inform consumers of available products or services or to increase sales by changing consumer preferences. Mobile telecommunications service is an ``experience good,'' and in general, advertising for an experience good tends to be persuasive rather than 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-199A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-199A2.txt  
- Laboratory Ensembles assists in demodulator characterization. Nevertheless, Laboratory Ensembles do not provide an adequate prediction of how well a receiver will perform in the field. In ATI's experience, demodulators optimized for performance on these Laboratory Ensembles often suffer from degraded performance. 7 Id. at ¶ ¶ 34-36. 8 A/74 Recommended Practice, Section 4.5.3. 9 A/74 Recommended Practice, Section 4.5.2. Sections 4.1 through 4.4 of the A/74 Recommended Practice also include RF measurement and pass/fail thresholds for receiver RF parameters. ATI also has found that receivers that do not reach these thresholds are unlikely to deliver a satisfactory end-user experience. - 5 - On the other hand, in ATI's extensive experience, the fifty performance vectors known as Field Ensembles provide a comparatively 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-30A1.txt  
- 3.14. Inmarsat Terminal D 3.14.1. Inmarsat Terminal D is a land-mobile Inmarsat MET, designed to be mounted on the roof of a motor vehicle. It is derived from its manufacturer's similar Inmarsat Fleet 55 MET. Terminal D has two connections between its Duplexer + LNA Block and its antenna, necessitating a minor modification to the test setup shown in Section 4.1 of the Test Plan. See Figure 12 for the test setup for Terminal D. The single-carrier harmful interference susceptibility levels for this MET are shown in Figure 10. The third-order intermodulation product harmful interference susceptibility levels for this MET are shown in Figure 11. Note that some of the datapoints for MSV's GSM and most of the datapoints for cdma2000 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-63A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-63A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-63A1.txt  
- dBW/4kHz carriers in table 24 (digital carriers) and table 25 (full and dual wideband digital carriers). With respect to interference into digital VSAT carriers operating at 6 dBW/4kHz, failures of 2.7 and 3.3 dB are seen for links V2 and V4, respectively, in table C-21b. With respect to narrowband analog carriers operating at 13 dBW/4kHz failures of 0.4, 6.1, and 4.1 dB are seen for links FMin, FMot, and VCot, respectively, in table C-22b. With respect to digital carriers operating at 6 dBW/4kHz only link D3-6 fails by 3.0 dB in table C-24a. With respect to full and dual wideband digital carriers operating at 6 dBW/4kHz, links 06M1 fails by 3.0 dB in table C-25a. With respect to interference into the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-63A1_Erratum.doc  
- dBW/4kHz carriers in table 24 (digital carriers) and table 25 (full and dual wideband digital carriers). With respect to interference into digital VSAT carriers operating at 6 dBW/4kHz, failures of 2.7 and 3.3 dB are seen for links V2 and V4, respectively, in table C-21b. With respect to narrowband analog carriers operating at 13 dBW/4kHz failures of 0.4, 6.1, and 4.1 dB are seen for links FMin, FMot, and VCot, respectively, in table C-22b. With respect to digital carriers operating at 6 dBW/4kHz only link D3-6 fails by 3.0 dB in table C-24a. With respect to full and dual wideband digital carriers operating at 6 dBW/4kHz, links 06M1 fails by 3.0 dB in table C-25a. With respect to interference into the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-69A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-69A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-05-69A1.txt  
- to the Federal non-military agencies. 47 C.F.R. § 2.106, footnote G5. However, NTIA has revised footnote G5 to read as follows: ``In the bands 162.0125-173.2, 173.4-174, 406.1-410 and 410-420 MHz, use by the military services is limited by the provisions specified in the channeling plans shown in Sections 4.3.7 and 4.3.9 of the NTIA Manual.'' See NTIA Manual at pages 4.1.3. Sections 4.3.7 and 4.3.9 state that the use of these bands by the military services is limited to non-tactical or intra-base operations and by certain provisions. Because footnote G5 applies only to Federal agencies (§ 2.105(d)(5)(iv)) and because the Commission's Rules are explicit that the Federal Government Table is included in Section 2.106 for informational purposes only (§ 2.105(d)(3)), the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-105A1.txt  
- in Western New York, Ohio, Texas, Southern California, Maine, North Carolina, and South Carolina. In addition to its cable systems, Time Warner's businesses include online interactive services, filmed entertainment, television networks, and publishing. Time Warner provides basic cable programming, digital cable programming, HDTV, VOD, subscription video on-demand (``SVOD''), and DVR service. Time Warner also provides high-speed Internet service to approximately 4.1 million residential subscribers, and it provides VoIP to approximately 500,000 subscribers. Time Warner's America Online businesses include the AOL service, a subscription-based online service with more than 22.2 million members in the United States. In addition to AOL, America Online offers other interactive content and services such as AOL.com, AOL Instant Messenger, Moviefone, MapQuest, and Netscape.com. Time Warner's television networks 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-110A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-110A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-110A1.txt  
- maximum power, or such other operating conditions, contained in this part or in the station authorization. (d) Safety/public safety priority. The following access priority governs all DSRCS operations: (1) communications involving the safety of life have access priority over all other DSRCS communications; (2) subject to a control channel priority system management strategy (see ASTM E2213-03 DSRC Standard at § 4.1.1.2(4)), DSRCS communications involving public safety have access priority over all other DSRC communications not listed in paragraph (d)(1). Roadside Units (RSUs) operated by state or local governmental entities are presumptively engaged in public safety priority communications. (e) Non-priority communications. DSRCS communications not listed in paragraph (d) are non-priority communications. If a dispute arises concerning non-priority communications, the licensee of the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-129A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-129A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-129A1.txt  
- § 80.359(b). See Report and Order, 17 FCC Rcd at 6777 ¶ 95. Id.; see 47 C.F.R. § 80.1077 n.11. See Report and Order, 17 FCC Rcd at 6777 ¶ 95. See Neuman Petition for Reconsideration at 1. Id. Id. See, e.g., ITU-R M.493-11 at Annex 1 § 6.4.1 and Tables 4.8 and 4.9; ITU-R M.541-9 at Annex 3 §§ 4.1-4.3. We are also making various non-substantive corrections to Part 80 so that it more accurately reflects the decisions adopted in the Report and Order. The Report and Order retitled Subpart R of Part 80 as ``Technical Equipment Requirements for Cargo Vessels Not Subject to Subpart W.'' See Report and Order, 17 FCC Rcd at 6825. However, this amendment was inadvertently 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-142A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-142A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-142A1.txt  
- revenues on a year-over-year basis for four consecutive quarters, with rural carriers showing particular improvement. Nevertheless, CTIA reported that roaming revenues for the entire mobile telephone industry decreased over the past year, from $4.2 billion in 2004 to $3.8 billion in 2005, roughly the level of 2003. The contribution of roaming revenues to total service revenues continued its decline, from 4.1 percent in 2004 to 3.3 percent in 2005, down from over 10 percent six years ago. One analyst explains that these trends are not surprising ``given the fall in roaming rates as well as the consolidation activity in the wireless industry. Also, a smaller portion of revenues are classified as roaming, as compared to historical years, given the proliferation of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-150A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-150A2.txt  
- DES MOINES 13 13 36.1 609 74427 414947 933656 47714 1038 2.2 56527IA DES MOINES 17 16 500 612 39534 414947 933656 40497 974 0 78915IA DES MOINES 31 628 589 74639 414947 933656 37868 947 0.1 17625IA DUBUQUE 40 43 800 262 39740 423109 903711 19008 305 0.9 29100IA FORT DODGE 21 25 600 363 424903 942441 31286 337 4.1 29095IA IOWA CITY 12 12 17.8 439 75030 414315 912030 35080 1111 0 35096IA IOWA CITY 20 251000 419 39521 414329 912110 33132 1057 1.4 64 Appendix B Federal Communications Commission FCC 06-150 NTSC ChanChanERP (kW)HAAT (m)Antenna ID Latitude (DDMMSS) Longitude (DDDMMSS)Area (sq km) Population (thousand)% Interference Received State and City Facility ID DTV 29086IA MASON CITY 24 18 500 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-167A1.txt  
- this Agreement, and shall issue periodic reminders to them of such obligations. 3.17. Access to Classified, Controlled Unclassified, or Sensitive Information. Nothing contained in this Agreement shall limit or affect the authority of a U.S. government agency to deny, limit or revoke Domestic Communications Companies' access to Classified, Controlled Unclassified, and Sensitive Information under that agency's jurisdiction. ARTICLE 4: DISPUTES 4.1. Informal Resolution. The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements shall be addressed, in the first instance, at the staff level by the Parties designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to the President of a Domestic Communications Company, the General 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-173A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-173A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-173A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-179A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-179A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-179A1.txt  
- ** 3.3 3.3 3.3 2.1 2.2 1.8 4.0 4.0 5.8 Standard error 0.4 0.4 0.8 0.7 0.7 0.6 0.6 1.1 1.7 High definition ** 11.6 11.5 11.6 12.1 12.2 11.9 11.2 11.6 9.7 Standard error 0.3 0.3 0.5 0.5 0.4 0.7 0.4 0.7 0.9 Other digital channels ** 108.1 107.6 113.8 120.0 126.1 102.9 113.4 104.5 100.6 Standard error 4.4 4.1 7.1 7.5 7.3 8.1 4.8 9.7 12.4 * Equals the difference in the monthly programming expense per subscriber for the basic-plus-expanded basic tiers, comparing year 2003 to year 2004. Monthly programming expense per subscriber for each year was approximated by dividing programming cost by end-of-year basic tier subscribers, dividing by 12 months. ** Includes premium, pay-per-view, mini-tiers, and other video 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-90A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-90A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-90A1.txt  
- at 21. See Intelsat Application at Table C.4. See 47 C.F.R. § 25.202(g). See, e.g., In the Matter of EchoStar L.L.C. for Modification of its License to Select TT&C Frequencies for its Ka-Band GSO Satellite at 117ş W.L., Order and Authorization, DA 05-536, paras. 4-10 (released March 2, 2005). See Section 3.9 of Annex 5 to Appendix 30 and Section 4.1 of Annex 3 to Appendix 30A. Typical TT&C transmissions are on the order of 1 MHz in bandwidth. The upper edge of the 17/24 GHz BSS allocation lies just below 17.7 GHz and is not coincident with the upper edge of the DBS feeder link band, i.e., 17.8 GHz. BSS downlink transmissions in this guardband would fall within DBS channel 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-90A1_Erratum.doc  
- at 21. See Intelsat Application at Table C.4. See 47 C.F.R. § 25.202(g). See, e.g., In the Matter of EchoStar L.L.C. for Modification of its License to Select TT&C Frequencies for its Ka-Band GSO Satellite at 117ş W.L., Order and Authorization, DA 05-536, paras. 4-10 (released March 2, 2005). See Section 3.9 of Annex 5 to Appendix 30 and Section 4.1 of Annex 3 to Appendix 30A. Typical TT&C transmissions are on the order of 1 MHz in bandwidth. The upper edge of the 17/24 GHz BSS allocation lies just below 17.7 GHz and is not coincident with the upper edge of the DBS feeder link band, i.e., 17.8 GHz. BSS downlink transmissions in this guardband would fall within DBS channel 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-06-96A1.txt  
- (RF) test port is not provided, radiated measurements will be performed. General information about radio device compliance testing facilities and measurement techniques are assumed to be known and not covered here. 3. REFERENCES [1] Recommendation ITU-R M.1652 [2] ITU Resolution 229 (WRC-03) 4. DEFINITIONS, SYMBOLS AND ABBREVIATIONS For the purposes of the present document, the following terms and definitions apply. 4.1 Definitions Association: An active relationship between two wireless devices in which one device (referred to as a Master Device in this document) exercises certain control functions over other devices (referred to as a Client Device in this document). Available Channel: A Channel on which a Channel Availability Check has not identified the presence of a Radar Waveform. Burst: A series 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-124A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-124A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-124A1.txt  
- superseded by such Commission rule or order. This Consent Decree cannot be modified without the advance written consent of both Parties. This Consent Decree may be signed in counterparts. For the Federal Communications Commission: ____________________________ Marlene H. Dortch Secretary ____________________________ Date For Verizon: ____________________________ Michael D. Poling Senior Vice President -- National Operations and Support ____________________________ Date 47 C.F.R. § 4.1 et seq. 47 U.S.C. § 154(i). Under this provision, Verizon will not be required to provide outage reporting compliance training to employees whose responsibilities do not include gathering, analysis, or data entry of information regarding Verizon's network outages or compiling Verizon's outage reports, or whose involvement in Verizon's outage reporting activities is limited to performing job functions that are not 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-138A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-138A2.txt  
- DES MOINES 13 13 36.1 609 74427 414947 933656 47702 1038 2.2 56527IA DES MOINES 17 16 500 612 39534 414947 933656 40497 974 0 78915IA DES MOINES 31 628 589 74639 414947 933656 37868 947 0.1 17625IA DUBUQUE 40 43 800 262 39740 423109 903711 19008 305 0.9 29100IA FORT DODGE 21 25 600 363 424903 942441 31286 337 4.1 29095IA IOWA CITY 12 12 17.8 439 75030 414315 912030 35044 1110 0.1 35096IA IOWA CITY 20 251000 419 39521 414329 912110 33132 1058 1.4 Appendix B Federal Communications Commission FCC 07-138 NTSC ChanChanERP (kW)HAAT (m)Antenna ID Latitude (DDMMSS) Longitude (DDDMMSS) Area (sq km)Population (thousand)% Interference Received State and City Facility ID DTV 29086IA MASON CITY 24 18 500 437 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-187A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-187A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-187A1.txt  
- Transferor, to Comcast Corporation, Transferee, MB Docket No. 05-192, Memorandum Opinion and Order, 21 FCC Rcd 8203, 8209-12, paras. 8, 12 (2006) (Adelphia/Time Warner Merger) (explaining that, in 2006, Comcast provided facilities-based residential local telephone service to approximately 1.225 million customers and VoIP service to approximately 19 million households, and that Time Warner [Cable] provided high-speed Internet service to approximately 4.1 million residential subscribers, and VoIP to approximately 500,000 subscribers); Annual Assessment of the Status of Competition in the Market for the Delivery of Video Programming, MB Docket No. 05-255, Twelfth Annual Report, 21 FCC Rcd 2503, 2508, para. 15 (2006) (finding that larger incumbent LECs have accelerated plans to roll out video services using digital subscriber line (DSL) and fiber-based 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-206A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-206A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-206A1.txt  
- BSPs face considerable challenge, which, the discussion below indicates, continues. BSP competition to cable is limited to relatively few markets. The Broadband Service Providers Association (``BSPA'') states that the BSPs, all of whom have entered the marketplace since the 1996 Act, have operations in nearly half the states, with nearly 10 million homes under active franchises. Constructed systems currently pass 4.1 million homes, and the companies associated with BSPA have 1.2 million customers. According to BSPA, BSPs have an average residential penetration rate of 29 percent. BSPs are seeking to compete by offering bundles of service which include telephony and high-speed Internet service, as well as various video offerings. BSPA asserts that the BSP model has expanded the deployment of advanced 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-216A1.txt  
- also generally noted that newspaper/broadcast cross-ownership is associated with more candidate coverage, more candidate speaking time and more coverage of opinion polls. Study 3 analyzed the relationship between the ownership structure of television stations and quantity and quality of television programming between 2003 and 2006, finding that cross-owned television stations broadcast (approximately 3.0 percentage points) more local news programming. Study 4.1 collected data on the news and public affairs programming provided by television stations and analyzed the relationship between the quantity of such programming and the ownership structure of each television station. After examining the programming of approximately 1700 stations between 2002 and 2005, the author concluded that cross-owned stations provided 11 percent (18 minutes) more news programming per day than 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-233A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-233A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-233A1.txt  
- voting common stock. NBC also acquired an option to purchase the control stock held by Lowell Paxson, which could not be exercised unless and until the Commission's multiple ownership rules were modified. In addition to the financial relationship between NBC and Paxson, the 1999 Investment Agreement contained provisions setting forth certain aspects of the corporate governance of Paxson. Under Section 4.1 of the Investment Agreement, NBC held approval rights over certain Paxson corporate actions. As set forth in the 1999 Stockholder Agreement, NBC also had the right to nominate three members to the Paxson Board of Directors. In 2001, Paxson initiated arbitration alleging that NBC's planned acquisition of Telemundo Communications Group, Inc. (``Telemundo'') violated the 1999 agreements. Paxson also filed a 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-43A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-43A1.txt  
- a meeting, for reasons of exigent circumstances, an issue related to or affecting the obligations of the Domestic Company under this Agreement, and all Security Director positions are vacant at the time of such a meeting, the absence of the Security Director will not prevent the meeting provided that the Security Officer attends the meeting. ARTICLE 4: DISPUTES AND REMEDIES 4.1. Informal Resolution. The Parties shall use their best efforts to resolve any disagreements or incidents that may arise under this Agreement. Disagreements or incidents shall be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to the policy- level officials of 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-07-76A1.txt  
- EchoStar Comments at A.6.3. See, e.g., 47 C.F.R. § 25.208(a)-(c). See 17/24 GHz BSS NPRM, 21 FCC Rcd at 7442, para. 33. See 47 C.F.R. § 25.202(g). See 17/24 GHz BSS NPRM, 21 FCC Rcd at 7442, paras. 33. Id. See EchoStar Comments at A.6.5. See 47 C.F.R. § 25.148(f), § 3.9.2 of Annex 5 to Appendix 30 and § 4.1 of Annex 3 to Appendix 30A of the International Radio Regulations. See EchoStar Comments at A.6.1. See Section III.F.2. below. However, in the International Bureau 2006 Biennial Review Staff Report, the International Bureau recommended re-examining all the provisions in Part 25 to, among other things, determine whether any rules need to be updated to reflect the transition in satellite services 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-128A1.txt  
- the D Block spectrum and then randomly allocate the spectrum to users in incremental amounts. Accordingly, with such technology this requirement could be characterized as ensuring that public safety has assured access to 50 percent of the engineered RAN capacity. See Network Reliability and Interoperability Council Wireless Network Reliability Final Report, September 2005 at http://www.nric.org/meetings/docs/meeting_20051019/NRICVII_FG3A_FinalRep ort_September_2005.pdf. See 47 C.F.R. §§ 4.1-4.2, 4.3(f), 4.5, 4.7, 4.9(e), 4.11, 4.13. See also New Part 4 of the Commission's Rules Concerning Disruptions to Communications, Report and Order and Further Notice of Proposed Rulemaking, ET Docket No. 04-35, 19 FCC Rcd 16830, 16882-16890 ¶¶ 97-114 (2004). By ``critical network elements,'' we mean to refer to those network elements that would require geographic redundancy and mesh connectivity 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-151A1.txt  
- Docket No. 02-278, Report and Order, 18 FCC Rcd 14014 (July 3, 2003) (2003 TCPA Order). Consumers can add their telephone numbers to the Registry by registering online at www.donotcall.gov. . Numbering for Internet-based Relay Services, Report of Alliance for Telecommunication Industry Solutions (ATIS), Washington, D.C., at 9, para. 3.3.1 (Dec. 19, 2007) (ATIS Report). ATIS Report at 13, para. 4.1.4. ATIS Report at 13, para 4.1.5. ATIS Report at 13, paras. 4.1.1-4.1.3, 4.1.6. . See AT&T Refresh Comments at 2 (``Because VRS users only need to use NANP numbers for inbound service (calls from hearing individuals), there is no need for the VRS user to purchase a local exchange access line to their premise which is more expensive. . . 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-178A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-178A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-178A1.txt  
- increased revenue from additional commercials is greater than the revenue declines due to subscription losses, then the merged entity would consider adding additional commercial time. There are no additional variables included in the calculation to make any conclusions as to Applicants' course of action or whether increasing commercial time during programming would be economically advantageous. (finding that satellite radio constituted 4.1 percent of the market) (visited June 19, 2008). For a related discussion concerning the prohibition on the insertion of local content on terrestrial repeaters, see Section VI.C.2, infra. For instance, we consider ``any efficiencies and other benefits that might be gained through increased ownership or control.'' Communications Act § 613(F)(2)(D), 47 U.S.C. § 533(f)(2)(D). Liberty Media-DIRECTV Order, 23 FCC Rcd 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-28A1.txt  
- ``roams,'' he or she may incur additional charges for each minute of use. CTIA reported that ``outcollect'' roaming revenues for the entire mobile telephone industry decreased again over the past year, from $3.8 billion in 2005 to $3.5 billion in 2006, a level not seen since 1998. The contribution of roaming revenues to total service revenues continued its decline, from 4.1 percent in 2004 to 3.3 percent in 2005 to 2.8 percent in 2006, down from over 10 percent seven years ago. Roaming revenues account for a higher percentage of total service revenues for many rural and smaller regional providers than for nationwide carriers. Rural Cellular, for example, derived 29 percent of its total wireless service revenues from roaming in the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-72A2.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-08-72A2.txt  
- Federal Communications Commission FCC 08-72 Facility ID State City NTSC ChanDTV ChanDTV ERP (kW) DTV HAAT (m) DTV Antenna ID DTV Latitude (DDMMSS) DTV Longitude (DDDMMSS) DTV Area (sq km) DTV Population (thousand) DTV % Interference Received 83181KS HOISINGTON 14 14 50 163 74728 383754 985052 13887 84 0 33345KS HUTCHINSON 8 8 9.28 244 75009 380321 974635 22260 672 4.1 66413KS HUTCHINSON 12 12 18.5 463 74428 380340 974549 36509 822 0.1 77063KS HUTCHINSON 36 351000 310 29560 375623 973042 22741 712 0 60683KS LAKIN 3 8 33 153 68690 374940 1010635 20351 80 2.4 42636KS LAWRENCE 38 41 551 291 74520 385842 943201 19399 1978 0 58552KS PITTSBURG 7 7 15.5 332 80204 371315 944225 29037 542 0.8 83992KS 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-24A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-27A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-27A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-27A1.txt  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm.2 47 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-30A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-30A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-30A1.txt  
- so how much weight should be accorded this factor? We also seek comment on the effect of any changes on station ownership by small businesses, including those owned by minorities and women. C. Establish Section 307(b) Priority for Native American and Alaska Native Tribal Groups Serving Tribal Lands. 19. Background. As of the 2000 U.S. Census, there are more than 4.1 million Native Americans and Alaska Natives living in the United States. There are 563 federally recognized American Indian Tribes and Alaska Native Villages (referred to collectively as ``Tribes''). At present, there are approximately 41 full-power noncommercial educational (``NCE'') FM radio stations in the United States licensed to federally recognized tribes or affiliated groups, with another 31 construction permits for full-power 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-09-44A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2010, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-106A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-106A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-106A1.txt  
- power, or such other operating conditions, contained in this part or in the station authorization. (c) Safety/public safety priority. The following access priority governs all DSRCS operations: (1) Communications involving the safety of life have access priority over all other DSRCS communications; and (2) Subject to a Control Channel priority system management strategy (see ASTM E2213-03 DSRC Standard at § 4.1.1.2(4)) DSRCS communications involving public safety have access priority over all other DSRC communications not listed in paragraph (c)(1) of this section. On-Board Units (OBUs) operated by state or local governmental entities are presumptively engaged in public safety priority communications. APPENDIX C Cross-Reference Tables for Existing and Proposed Rules Ordered by Existing Section Number Existing Proposed Topic 95.1 95.3 GMRS, 218-219 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-106A1_Rcd.pdf  
- maximum power, or such other operating conditions, contained in this part or in the station authorization. (c) Safety/public safety priority. The following access priority governs all DSRCS operations: (1) Communications involving the safety of life have access priority over all other DSRCS communications; and (2) Subject to a Control Channel priority system management strategy (seeASTM E2213-03 DSRC Standard at § 4.1.1.2(4)) DSRCS communications involving public safety have access priority over all other DSRC communications not listed in paragraph (c)(1) of this section. On-Board Units (OBUs) operated by state or local governmental entities are presumptively engaged in public safety priority communications. (d) Non-priority communications. DSRCS communications not listed in paragraph (c) of this section are non-priority communications. If a dispute arises concerning 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-110A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-110A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-110A1.txt  
- (09/2008), IBR approved for § 80.1101. (d) The International Electrotechnical Commission (IEC), 3 Rue de Varembe, CH-1211, Geneva 20, Switzerland. (IEC publications can also be purchased from the American National Standards Institute (ANSI) through its NSSN operation (www.nssn.org), at Customer Service, American National Standards Institute, 25 West 43rd Street, New York NY 10036, telephone (212) 642-4900.) (1) IEC 60092-101, Edition 4.1 (2002-08), ``Electrical installations in ships-Part 101: Definitions and general requirements,'' IBR approved for § 80.1101. (2) IEC 60533, Second edition (1999-11), ``Electrical and electronic installations in ships-Electromagnetic compatibility,'' IBR approved for § 80.1101. (3) IEC 60945, Fourth edition (2002-08), ``Maritime navigation and radiocommunication equipment and systems-General requirements-Methods of testing and required test results,'' with Annexes, IBR approved for §§ 80.273, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-113A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-113A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-113A1.txt  
- 9-10 (both proposing bright-line tests for unbundling forbearance). Because the record does not contain data necessary to perform the hypothetical monopolist test quantitatively, we use the conceptual framework of the traditional approach as ``a methodological tool for gathering and analyzing evidence pertinent to customer substitution and to market definition'' as a way to measure competition. Draft Revised Horizontal Guidelines, § 4.1.3. We reject as unfounded concerns that the use of formal market definition, ``if carried to its logical extreme, [could] eliminate the Commission's ability to bracket uncertainty about complex market interactions even when clearing up that uncertainty would not affect the result,'' and ``would threaten to render section 10 a dead letter by imposing a requirement that . . . would 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-129A7.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-129A7.txt  
- 9,769 6,409 16,178 7,052 15,839 13,428 15,060 22,804 11,503 178 85,865 102,043 Percentages aDSL 3.9 8.1 12.0 6.9 19.8 30.6 27.7 2.5 0.4 0.0 88.0 100.0 sDSL 0.0 0.0 0.0 44.9 32.5 * 1.6 0.0 * 0.0 100.0 100.0 Other Wireline 0.0 0.0 0.0 15.5 12.3 55.1 8.7 3.1 2.2 3.1 100.0 100.0 Cable Modem 1.1 1.5 2.5 0.8 2.8 4.1 13.9 53.0 22.6 0.3 97.5 100.0 FTTP 0.2 0.0 0.2 0.7 1.4 2.7 24.2 1.3 68.4 1.2 99.8 100.0 Satellite 53.2 35.0 88.3 * * * * 0.0 0.0 0.0 11.7 100.0 Fixed Wireless 14.2 4.5 18.7 20.8 22.3 25.2 9.2 1.9 1.8 0.2 81.3 100.0 Mobile Wireless 30.2 11.9 42.1 17.1 33.3 7.0 0.5 0.0 0.0 0.0 57.9 100.0 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1.txt  
- assumptions and definition of interference. According to the ITU reports, approximately 3.5 percent of all FS receivers have elevation angles between 35ş and 50ş. This use of high elevation angles, and their resulting sensitivity to the FSS transmissions, distinguishes V-band HDFS applications from many other FS applications. Table 3.2 - Monte Carlo Study Assumptions 4.0 FS/FSS Interactions in the V-band 4.1 Combined Rain-fade Protection and FSS Antenna Roll-off To further examine the interactions between FS and FSS, the combined effects of both rain-fade and the FSS antenna roll-off have to be examined in detail. The first factor in the Commission staff's analysis is the spatial relationship between the FSS satellite earth station and FS receivers. As discussed above, rain fade requires 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-186A1_Rcd.pdf  
- Winstar of actual FS antennas. Further, the analysis assumes FSS satellites only in those parts of the GSO arc likely to be used by FSS, and excludes portions of the arc that present very lowelevation angles and are unlikely to be used. 15694 Federal Communications Commission FCC 10-186 Table 3.2 -Monte Carlo Study Assumptions 4.0 FS/FSS Interactions in the V-band 4.1 Combined Rain-fade Protection and FSS Antenna Roll-off To further examine the interactionsbetween FS and FSS, the combined effects of both rain-fade and the FSS antenna roll-off have to be examined in detail. The first factor in the Commission staff's analysis is the spatial relationship between the FSS satellite earth station and FS receivers. As discussed above, rain fade requires the 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-24A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-24A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-24A1.txt  
- our Section 307(b) mandate to ``make such distribution of licenses ... among the several States and communities as to provide a fair, efficient, and equitable distribution of radio service'' with regard to tribal lands. Tribal lands comprise 55.7 million acres, or 2.3 percent of the area of the United States (exclusive of the State of Alaska). Roughly one-third of the 4.1 million American Indian and Alaska Native population of the United States live on tribal lands, which are governed by Indian tribal governments that have a unique legal relationship with the federal government as domestic dependent nations with inherent sovereign powers over their members and territory. Because of their status as sovereign nations responsible for, among other things, ``maintaining and sustaining 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-47A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1.txt  
- billion in 2008 from $3.742 billion in 2007. This is consistent with the trend over the past decade where annual roaming revenues have fluctuated between $3.5 billion and $4.2 billion. However, during this same period total industry revenues increased dramatically, from $40 billion to $148.1 billion. Therefore, the contribution of roaming revenues to total service revenues continued its decline: from 4.1 percent in 2004, to 3.3 percent in 2005, to 2.8 percent in 2006, to 2.7 percent in 2007, and to 2.5 percent in 2008, which is down from over ten percent in 1999. Similarly, while reported annual roaming traffic has grown significantly during this same period, roaming minutes as a percentage of total minutes has dropped significantly. Roaming minutes increased 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-81A1_Rcd.pdf  
- 2.6%, NIELSEN WIRE, Mar. 13, 2009, available at http://blog.nielsen.com/nielsenwire/consumer/nielsen-reports-2008-us-ad-spend-down-26/; Ad Spending in U.S. Down 11.5 Percent in First Three Quarters of 2009, NIELSEN WIRE, Dec. 10, 2009, available at http://blog.nielsen.com/nielsenwire/consumer/ad-spending-in-u-s-down-11-5-percent-in-first-three-quarters-of- 2009/. 389Nielsen Ad Intelligence Spotlight on Multi-Cultural Advertising, Nielsen, Oct. 2009, available at http://blog.nielsen.com/nielsenwire/wp-content/uploads/2009/10/MultiCulturalSpotlight10.23.09.pdf, at 3. 390See AT&T PN Comments at 49. 391TNS Media Intelligence Reports U.S. Advertising Expenditures Declined 4.1 Percent in 2008, Press Release, TNS Media Intelligence, May 4, 2009, available athttp://www.tns-mi.com/news/05042009.htm. The advertising expenditures of Verizon and AT&T include those companies' wireline businesses as well. 392Id. 393TNS Media Intelligence Reports U.S. Advertising Expenditures Declined 14.7 Percent in First Nine Months of 2009, Press Release, TNS Media Intelligence, Dec. 9, 2009, available athttp://www.tns-mi.com/news/2009-Ad- Spending-Q3.htm. 394Id. 11492 Federal Communications Commission 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-10-89A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2011, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1.txt  
- largest advertisers in the country, but their ad spending declined in 2009. According to data from Kantar Media (formerly TNS), Verizon Communications (Verizon) and AT&T were the second and fourth largest U.S. advertisers, respectively, during 2009, as they were in 2008. Verizon's advertising expenditures declined 6.9 percent during 2009 from $2.4 billion to $2.2 billion, while AT&T's ad spending dropped 4.1 percent from $1.986 billion to $1.904 billion. On the other hand, ad spending by Sprint Nextel - the 8th largest U.S. advertiser - rose 30 percent during 2009 from $945 million to $1.23 billion. According to Bernstein, AT&T's share of quarterly wireless ad spending fell to 26.2 percent in the third quarter of 2009, from 31.4 percent in the third 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-103A1_Rcd.pdf  
- the largest advertisers in the country, but their ad spending declined in 2009. According to data from Kantar Media (formerly TNS), Verizon Communications (Verizon) and AT&T were the second and fourth largest U.S. advertisers, respectively, during 2009, as they were in 2008.405Verizon's advertising expenditures declined 6.9 percent during 2009 from $2.4 billion to $2.2 billion, while AT&T's ad spending dropped 4.1percent from $1.986 billion to $1.904 billion. On the other hand, ad spending by Sprint Nextel the 8thlargest U.S. advertiser rose 30 percent during 2009 398Reexamination of Roaming Obligations of Commercial Mobile Radio Service Providers and Other Providers of Mobile Data Services, Second Report and Order, 26 FCC Rcd 5411 (2011). 399Id. at 5418-5428 ¶¶ 13-31. 400Id. 401See CTIA Comments at 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-118A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-118A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-118A1.txt  
- than the rules we are adopting for VRS providers in this Second Report and Order, the use of 30 minutes for drawing the distinction between planned outages requiring prior Commission consent and planned outages requiring notification after the fact is consistent with the 30 minute exception for reporting outages found in Part 4 of the rules. See 47 C.F.R. §§ 4.1 et seq. See Sorenson Comments at 8-9. We also will not construe load-shifting among call centers as an interruption in service, for purposes of reporting unforeseen service interruptions, if service is not affected by such load shifting. See para. 54, infra. CSDVRS Comments at 4-5; see also AT&T Reply Comments at 2; Purple Reply Comments at 6; Sorenson Reply Comments 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-120A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-120A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-120A1.txt  
- angle in degrees From centerline of main beam in decibels 5° to 10° 10° to 15° 15° to 20° 20° to 30° 30° to 100° 100° to 140° 140° to 180° * * * * * 5,925 to 6,4255 A 2.2 38 25 29 33 36 42 55 55 B1 2.2 38 21 25 29 32 35 39 45 B2 4.1 32 15 20 23 28 29 60 60 * * * * * 6,525 to 6,8755 A 2.2 38 25 29 33 36 42 55 55 B1 2.2 38 21 25 29 32 35 39 45 B2 4.1 32 15 20 23 28 29 60 60 6,875 to 7,075 A 2.2 38 25 29 33 36 42 55 55 B1 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-134A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-134A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-134A1.txt  
- RFC 3261, SIP: Session Initiation Protocol. IMS allows wireless operators to offer multimedia services on SIP-based platforms. See 3GPP, Technical Specification 23.228, IP Multimedia Subsystem (IMS); Stage 2, version 10.2.0, September 2010, Section 4.0 ``IP multimedia subsystem concepts - General.'' See NENA, Detailed Functional and Interface Specification for the NENA i3 Solution - Stage 3, NENA 08-003 Version 1, § 4.1.9, available at http://www.nena.org/sites/default/files/08-003%20Detailed%20Functional%2 0and%20Interface%20Specification%20for%20the%20NENA%20i3%20Solution%20-% 20Stage%203_1.pdf (last visited Aug. 11, 2011) (NENA i3 Solution). See Internet Engineering Task Force (IETF), The Message Session Relay Protocol, (September 2007) available at http://tools.ietf.org/pdf/rfc4975.pdf (last visited Aug. 12, 2011). XMPP is an open technology for real-time communication, which powers a wide range of applications including instant messaging, presence, multi-party chat, voice and video calls, collaboration, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-161A1.txt  
- Composite sets and repeating coils. (7) Program transmission amplifiers, monitoring devices and volume indicators. (8) Testboards, test desks, repair desks and patch bays, including those provided for test and control, and for telegraph and transmission testing. (b) For apportionment among the operations, the cost of circuit equipment is assigned to the following subsidiary categories: (1) Exchange Circuit Equipment - Category 4.1. (i) Wideband Exchange Line Circuit Equipment - Category 4.11. (ii) Exchange Trunk Circuit Equipment (Wideband and Non-Wideband) - Category 4.12. (iii) Exchange Line Circuit Equipment Excluding Wideband - Category 4.13. (2) Interexchange Circuit Equipment - Category 4.2. (i) Interexchange Circuit Equipment Furnished to Another Company for Interstate Use - Category 4.21. (ii) Interexchange Circuit Equipment Used for Wideband Services including 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-30A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-30A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-30A1.txt  
- and interests of Native communities; and the Wireless Telecommunications Bureau's Notice of Proposed Rulemaking proposes to amend our rules to spur the provision of vital wireless communications services to Native communities. BACKGROUND The Commission has long sought to fulfill its statutory purpose to make available to all citizens of the United States access to telecommunications and information services. There are 4.1 million American Indians and Alaska Natives in the United States and more than 565 federally recognized Tribes, each with their own unique political and governance structures. It is well-established that federally recognized Tribes have inherent sovereignty and self-determination, and exercise jurisdictional powers over their members and territory with the obligations to ``maintain peace and good order, improve their condition, establish 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-34A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-71A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2012, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-74A1.txt  
- local entities. Homeland Security Policy Directive 8 (Dec. 17, 2003), replaced by Presidential Policy Directive 8 on March 30, 2011. See supra note 8. (last visited May 9, 2011). (last visited April 12, 2011). See Network Reliability Steering Committee 2008-2009 Biennial Report (Apr. 2010), http://www.atis.org/nrsc/Docs/ATIS-0100029%20-%20NRSC%20Biennial%20Repor t.pdf (last visited May 9, 2011). (last visited May 9, 2011). See 47 C.F.R. §§ 4.1-4.13. In 1992, the Commission established network outage reporting requirements for wireline providers. Notification by Common Carriers of Service Disruptions, Report and Order, CC Docket No. 91-273, 7 FCC Rcd 2010 (1992) (1992 Part 4 Report and Order); see also Memorandum Opinion and Order and Further Notice of Proposed Rulemaking, 8 FCC Rcd 8517 (1993); Second Report and Order, FCC Rcd 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-82A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-82A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-82A1.txt  
- for example, observed that ``IP based systems are . . . in . . . 18 states (plus the District of Columbia), of which at least 10 are already originating and disseminating CAP messages for EAS, and the remainder appear to have near-term plans to begin introducing CAP message origination and dissemination within their state systems.'' CSRIC Final Report, § 4.1.2. CSRIC further observed that ``[w]here advanced EAS capabilities have not yet been deployed, emergency managers continue to utilize EAS in traditional manners.'' Id. . . See Second Report and Order, 22 FCC Rcd 13275, 13291, para. 32. See id. See id. Id. See 47 C.F.R. § 11.56. Timm Reply Comments at 2-3. Id. at 3. Id. SpectraRep Comments at 3. 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-93A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-93A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-93A1.txt  
- S.12, Analog Modulation Parameters, Schedule S Attachment at 8. DBS networks are required to locate their TT&C operations within specially designated band segments. The DBS guardbands consist of 12 MHz of spectrum at either end of the 17.300-17.800 GHz band. Specifically they are the band segments between 17.300 GHz-17.312 GHz and between 17.788-17.80 GHz. These guardbands are defined in Section 4.1 of Annex 3 to Appendix 30A of the ITU Radio Regulations. In adopting this pfd trigger value we have not changed the power per unit of area that is permitted at the victim antenna. We have only reduced the bandwidth over which it is being measured. Hence, -117 dBW/m2/100 kHz is proportional to our proposed value of -93 dBW/m2/24 MHz, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-11-93A1_Rcd.pdf  
- S.12, Analog Modulation Parameters, Schedule S Attachment at 8. 45DBS networks are required to locate their TT&C operations within specially designated band segments. The DBS guardbands consist of 12 MHz of spectrum at either end of the 17.300-17.800 GHz band. Specifically they are the band segments between 17.300 GHz-17.312 GHz and between 17.788-17.80 GHz. These guardbands are defined in Section 4.1 of Annex 3 to Appendix 30A of the ITU Radio Regulations. 46In adopting this pfd trigger value we have not changed the power per unit of area that is permitted at the victim antenna. We have only reduced the bandwidth over which it is being measured. Hence, -117 dBW/m2/100 kHz is proportional to our proposed value of -93 dBW/m2/24 MHz, 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-22A1.txt  
- available at http://www.kdhnews.com/news/story.aspx?s=42355 (last visited Feb. 7, 2012). See infoTECH News, Scattered Internet Outages Frustrate Businesses, Web Surfers in North Kitsap, June 4, 2010, available at http://it.tmcnet.com/news/2010/06/04/4828578.htm (last visited Feb. 7, 2012). See Fred Posner, Comcast Outage and Phone Service Complaints, VoIP Tech Chat, March 29, 2010, available at http://www.voiptechchat.com/voip/431/comcast-outage-and-phone-service-co mplaints/ (last visited Feb. 7, 2012). See 47 C.F.R. §§ 4.1-4.13. In 1992, the Commission established network outage reporting requirements for wireline providers. 1992 Part 4 Report and Order 7 FCC Rcd 2010 (1992); see also Memorandum Opinion and Order and Further Notice of Proposed Rulemaking, 8 FCC Rcd 8517 (1993); Second Report and Order, FCC Rcd 39-1-1 (1994); Order on Reconsideration of Second Report and Order, 10 FCC Rcd 11764 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-27A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-49A1.txt  
- * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories, as specified in §§ 36.126(b)(1) through (b)(4), among the jurisdictions using the relative use measurements or factors, as specified in §§ 36.126(c)(1) through (c)(3) for the twelve month period ending December 31, 2000. Direct assignment of any subcategory of Category 4.1 Exchange Circuit Equipment to the jurisdictions shall be updated annually. * * * * * (e) * * * (4) Effective July 1, 2001, through June 30, 2014, all study areas shall apportion costs in the categories/subcategories specified in §§ 36.126(e)(1) through (e)(3) among the jurisdictions using relative use measurements or factors, as specified in §§ 36.126(e)(1) through (e)(3) for 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-7A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-7A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-12-7A1.txt  
- alerts. See, e.g., Sage Comments at 18-19; Timm Comments at 5-6; TFT Comments at 8; Monroe Comments at 20. See, e.g., Sage Comments at 18. See, e.g., id. at 20. See, e.g., Sage Reply Comments at 5. . See Second Report and Order, 22 FCC Rcd 13275, 13299-13300, para. 54. Id. at 13300, para. 55. See CSRIC Final Report, § 4.1.2. See NSBA Comments at 10-12. See Third FNPRM, 26 FCC Rcd 8149, 8200-01, para. 139 (citing 47 C.F.R. § 11.13). See 47 C.F.R. § 11.54. See id. § 11.54(b)(3). The EAS Participants display standby script when not airing ``common emergency messages.'' See id. § 11.54(b)(4). See id. § 11.54(b)(3). See Third FNPRM, 26 FCC Rcd 8149, 8202-03, para. 143. See 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-98-26A1.txt  
- in Annex 8 to the Final Acts. The Final Acts also include interim procedures for implementing BSS space stations in Region 2, prior to the planning of BSS for that Region. Subsequently at WARCOrb-85, updated when the Region 2 Plans were adopted. These updated procedures were not included in our rules. See ITU Radio Regulations, Appendix S30 and S30A, Article 4.1. Annex 1 to Appendices S30 and S30A contains coordination thresholds that must be met by proposed systems or such systems must coordinate with affected systems. See ITU Radio Regulations, Appendix S30 and S30A, Annex 1. See e.g., Application of Hughes Communications Galaxy, Inc., for Authority to Construct, Launch and Operate Galaxy/Spaceway, a Global System of Geostationary Ka band Fixed and 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.pdf  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-313A1.txt  
- Electronic Surveillance conducted in violation of Federal or state law or regulation; (iii) access to or disclosure of Subscriber Information in violation of Federal or state law or regulation or this Agreement; or (iv) improper access to or disclosure of Classified Information or Sensitive Information by the Company or any Affiliate. ARTICLE IV DISPUTES AND NON-IMPACT ON OTHER GOVERNMENT ACTIONS 4.1 Dispute Resolution The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements will be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to higher authorized officials, unless the DoD, the DoJ or 
 
- http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-344A1.doc  http://hraunfoss.fcc.gov/edocs_public/attachmatch/FCC-99-344A1.pdf  
- Compliance. TMI agrees that it is obligated to comply with the Communications Assistance for Law Enforcement Act (47 U.S.C. § 1001 et seq.) and will timely modify the switch employed at the TMI U.S. POP or other TMI U.S. facility to provide the capabilities and capacity required for compliance with the Act. ARTICLE IV REPORTING, ASSISTANCE, AND ACCESS TO INFORMATION 4.1 Access to Information. In response to reasonable requests made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and 
 
- http://licensing.fcc.gov/prod/callsign/manuser.html  
- and the required payment are required to be submitted within 15 days from the date of the call sign request. More information about the FCC 159 form is available from the FCC internet site, at [25]Form 159. Also, an Adobe Acrobat version of the form and instructions can be found at [26]159.pdf. 4. Data Entry Problems (FRN, Red Light Warning) 4.1 FRN Entry The FRN - a 10 digit field, is to be entered without dashes. You will need to enter any preceding zeros. The FRN is a required field for all call sign requests. 4.2 Red Light Warning You or an entity sharing the same Taxpayer Identification Number are delinquent on debts owed to the FCC. You can continue with 
 
- http://transition.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.doc  http://transition.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.pdf  http://transition.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.txt  
- 8104033; Shy Shin Luh, Digital Subscriber Lines Are the Latest Internet Wave, But Baby Bells Aren't Making the Connection Quickly, Washington Post, Aug. 23, 1999 at F5. A recent report by TeleChoice shows spectacular DSL growth during 1999 and projects continued rapid growth in the future. See TeleChoice, Inc., Deployment - Updated Nov. 5, 1999, http://www.xdsl.com/content/resources/deployment_info.asp. The Yankee Group predicts 4.1 million DSL lines in 2002. See Sarah L. Roberts-Witt, The Coming DSL-Cable Race, Internet World, Nov. 15, 1999, http://www.iw.com/print/1999/11/15/infra/19991115-DSL.html. The Commission's Cable Services Bureau observed in October 1999 that: ``The ILECs' aggressive deployment of DSL can be attributed in large part to the deployment of cable modem service. Although the ILECs have possessed DSL technology since the late 1980s, they 
 
- http://transition.fcc.gov/Bureaus/Cable/Reports/fcc99418.doc  http://transition.fcc.gov/Bureaus/Cable/Reports/fcc99418.txt  
- the analog signals used by current television sets. Presently, cable operators provide set top devices to the consumer for a monthly fee, though these devices will soon become available to consumers through retail outlets. As of December 1998, there were more than 1.2 million digital cable subscribers. Some analysts estimate that by year-end 1999, there will be as many as 4.1 million digital cable subscribers. Cox is marketing its digital product in seven states and has 144,116 subscribers. Cox offers three digital packages: movie, sports and information, and variety. Customers may purchase one package for $5.95 or all three for $10.95. As of August 1999, Comcast served approximately 285,000 subscribers and expects to serve between 400,000 to 450,000 by the end 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.txt  http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.wp  
- FCC 99-122 __________________________________________________________________________________________________________________________________ 21 "Numbering Plan Area" (NPA), or "area code," refers to the first three digits (NXX) of a ten-digit telephone number in the form NXX-NXX-XXXX, where N represents any one of the numbers 2 through 9 and X represents any one of the numbers 0 through 9. 47 C.F.R. § 52.7(a). 22 See CO Code Guidelines at § 4.1-4.2 (rev. Apr. 26, 1999). 23 Because NXX codes may not begin with either a 0 or a 1, and because any NXX in the form N11 is also excluded, there are 792 possible usable NXX codes in each NPA. This number represents an upper limit, however, because the existence of protected codes may lower the total number of available NXX 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.txt  http://transition.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.wp  
- 16020-21. 17 The PICC first took effect in January 1998. The Consumer Price Index (CPI) for interstate toll service dropped from 75.2 in December 1997 to 74.6 in December 1998, or 0.8 percent in absolute terms and 2.4 percent once adjusted for inflation. PHIL CHEILIK, FEDERAL COMMUNICATIONS COMMISSION, REFERENCE BOOK OF RATES, PRICE INDICES AND EXPENDITURES FOR TELEPHONE SERVICE Tbls. 4.1 & 4.2,at 68, 78 (June 1999). The CPI dropped another 4.1 points to 72.5 between December 1998 and May 1999, making the total decline 3.6 percent from December 1997, without adjusting for inflation. See BUREAU OF LABOR STATISTICS, CONSUMER PRICE INDEX-ALL URBAN CONSUMERS: INTERSTATE TOLL CALLS (Series ID: CUUR0000SS27051) (available at the Bureau of Labor Statistics web site, ). 6 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.txt  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.wp  
- and that it represents the bulk of transport capacity, we consider it a reasonable measure for current capacity on the transpacific route. At least 78 entities own U.S. half-circuits on TPC-5.272 AT&T owns 38.8 percent of the capacity, followed by MCI with 21.6 percent, Sprint with 8.8 percent, Kokusai Denshin Denwa Co., Ltd (KDD) with 6.5 percent, and WorldCom with 4.1 percent.273 94. We note that the amount of capacity in the transpacific region is expected to increase nearly ten-fold by the end of 1999. Construction on the China-U.S. cable system, which will provide the equivalent of 32,256 E-1 circuits on the transpacific route, is scheduled to begin in 1998 and service is set to be offered in December 1999.274 In 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99238.pdf  
- nationwide of which we are aware appears to be the data that we collect annually in connection with the TRS Worksheet. According to our most recent data, 129 companies reported that they were engaged in the provision of competitive access services.1036 1033 See supra paras. 500-504. 1034 See supra paras. 500-504. 1035 Report, Local Competition: August 1999, at 45, Table 4.1 (This report is an update of the Local Competition Report issued in December of 1998. The report was compiled by the Industry Analysis Division of the Common Carrier Bureau of the Federal Communications Commission. This report is available in the Commission's Reference Information Center at 445 12th Street, S.W., Courtyard Level, Washington, DC. Copies may be purchased from the International 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.doc  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.txt  
- See Bell Atlantic Dowell/Canny Decl. Attach. D at (metric NP-2-05); Department of Justice Evaluation at Exhibit 6, 12; New York Commission Comments at 24-25; Allegiance Comments at 9. Bell Atlantic Lacouture/Troy Decl. at para. 7. Bell Atlantic Lacouture/Troy Decl. at para. 7; Bell Atlantic Application App. H, Tab 1 (submitting New York state tariff); see also NYPSC Interceonnection Tariff § 4.1.2-4.1.3 (specifying points of interconnection on BA-NY network). Sprint Comments at 7. New York Commission Comments at 18-20; Bell Atlantic Reply at 22-23; Bell Atlantic Lacouture/Troy Reply Decl. at paras. 30-33. New York Commission Reply at 7; Bell Atlantic Reply at 23; see Petition of Sprint Communications Co., Arbitration of Interconnection Rates, Terms, Conditions, and Related Arrangements With Bell Atlantic-New York, 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.doc  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.txt  
- FCC Rcd at 16022. NRTA/NTCA Comments at 6-7; New Jersey Div. Comments at 16-18. Vermont Dept. Reply at 16-17. Vermont Dept. Reply at 17. 47 U.S.C. 254(g); see CALLS Reply at 28; NADO Reply at 5. NADO Reply at 5. CALLS Reply at 28; NADO Reply at 5. NADO Reply at 5. See, e.g., Bell Atlantic Tariff No. 1, Section 4.1.7 and Bell Atlantic Tariff No. 11, Section 31.4.1. Under the prior system, these SLCs were capped at $6.00. See NARUC v. FCC, 737 F.2d at 1113-14. See CALLS Reply at 28-29. NRTA/NCTA Comments at 6-7; New Jersey Div. Comments at 16-18; see also Access Charge Reform Order, 12 FCC Rcd at 16022. See Access Charge Reform Order, 12 FCC Rcd 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.doc  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.pdf  http://transition.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.txt  
- of 12.9, 22.2, and 8.5 percent, while SWBT's own retail DS1 loops experienced repeat trouble rates of 19.4, 17.9, and 21.8 percent. SWBT Aggregated Performance Data, Measurement No. 69 (``Repeat Reports (%)'') (DS1 Loop with Test Access) at 271-No. 69b. WorldCom Texas II Comments at 41-43. SWBT Auinbauh Texas II Aff. at Attach. C (Amendment 6 to T2A at para. 4.1). Line Sharing Order, 14 FCC Rcd 20912. Line Sharing Order, 14 FCC Rcd at 20982-83, para. 161. Line Sharing Order, 14 FCC Rcd at 20982-83, 21016, paras. 161, 230; 65 Fed. Reg. 1331 (Jan. 10, 2000). See section III.C.1, supra. Line Sharing Order, 14 FCC Rcd at 20982-85, paras. 161-170. SWBT Texas II Cruz Aff. at paras. 5-55; SWBT Texas 
 
- http://transition.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp99-1.pdf  
- by Large ILECs to CLECs for Resale......................25 Table 3.2CLEC Residential and Other Customers Served by ILEC Total Service Resale (TSR) Lines....................................28 Table 3.3Lines Provided by Large ILECs to CLECs as UNE Loops...................32 Table 3.4Percent of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements...............................36 IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA..............................................43 Table 4.1Local Service Competitors Holding Numbering Codes.....................45 Chart 4.1Local Service Competitors Holding Numbering Codes by LATA on July 1, 1999................................................46 Table 4.2Local Service Competitors Identified..................................47 Table 4.3Numbering Codes Assigned to Local Exchange Carriers....................66 V. TELEPHONE NUMBERS TRANSFERRED AMONG CARRIERS....................67 Table 5.1Telephone Numbers Transferred.....................................69 VI.NEW ENTRANT LOCATOR INFORMATION .................................71 Table 6.1Competitive Access Providers and Competitive Local Exchange Carriers ..............................................73 Table 6.2Local Resellers and 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.txt  http://transition.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.wp  
- 190.3 927.0 25044 12593 24863 12621 1.0 0.8 98.2 CA LOS ANGELES 34 35 73.5 896.0 21708 12379 21279 12427 0.6 1.0 98.3 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.wp  
- 0.4 0.0 100.0 ILPEORIA 47 46 50.0 216.0 12924 553 12880 553 2.0 0.3 100.0 ILPEORIA 59 39 50.0 178.0 6421 409 6393 409 0.4 0.5 100.0 ILQUINCY 10 54 1000.0 238.0 26233 313 23635 294 0.0 0.0 100.0 ILQUINCY 16 32 50.0 302.0 15205 198 15084 197 0.0 0.0 100.0 ILQUINCY 27 34 50.0 173.0 4121 103 4109 102 4.1 1.1 100.0 ILROCKISLAND 4 58 1000.0 408.0 38568 1191 31886 1005 0.0 0.0 100.0 ILROCKFORD 13 54 1000.0 216.0 24307 1515 18743 913 0.0 0.0 100.0 ILROCKFORD 17 16 187.6 203.0 15256 886 13542 775 1.5 1.0 100.0 ILROCKFORD 39 42 50.0 176.0 11496 691 11331 686 1.1 1.0 100.0 ILSPRINGFIELD 20 42 72.0 436.0 23640 680 21749 607 0.6 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.txt  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.wp  
- time-averaging provisions recommended in Sections 17.4.1.1 and 17.4.3, of "Biological Effects and Exposure Criteria for Radiofrequency Electromagnetic Fields," NCRP Report No. 86 (1986). With the exception of the limits on exposure to power density above 1500 MHz and the limits for exposure to lower frequency magnetic fields, these MPE limits are also generally based on the guidelines contained in Section 4.1 of ANSI/IEEE C95.1-1992. We also adopted limits for localized ("partial body") absorption for certain portable transmitting devices based on Sections 4.2.1 and 4.2.2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 8 Federal Communications Commission FCC 97-303 20. The Electromagnetic Energy Association (EEA), U S WEST, Inc. and the Department of Defense (DOD) ask us to reconsider 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.txt  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.wp  
- 190.3 927.0 25044 12593 24863 12621 1.0 0.8 98.2 CA LOS ANGELES 34 35 73.5 896.0 21708 12379 21279 12427 0.6 1.0 98.3 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.txt  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.wp  
- the same thing. 73 See 47 C.F.R. § 2.907(b) (equipment marketed by a grantee must be identical to the sample tested). 74 See SEA comments at 5-6. 75 See TIA comments at 6. 76 See Motorola comments at 9. 77 See ACIL comments at 2. 78 A TCB is required to make its services available to all applicants. See clause 4.1.2 of Guide 65. 19 needed for compliance.71 In proposing this requirement, we intended that TCBs use the same standards that we currently use in certifying equipment (i.e., the sample of the equipment for which certification is being obtained must be representative of what will actually be marketed). In the event modifications to a sample are required during compliance testing72 to 
 
- http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.doc  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.pdf  http://transition.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.txt  
- antenna G/T dB 14.5 14.5 14.5 14.5 C/I for other assignments in the BSS Plan dB 20.0 20.0 20.0 20.0 Clear-sky feeder link C/(N+I) dB 26.2 26.2 26.2 26.2 Clear-sky carrier-to-noise plus interference ratio dB 10.7 13.6 8.9 13.7 Required C/(N+I) for operating threshold dB 6.1 6.1 6.1 6.1 Link margin dB 4.6 7.5 2.8 7.7 Rain margin dB 1.82 4.1 0.93 4.22 Rain intensity exceeded for 0.01% of an average year mm/h 30.3 48.2 36.1 95.7 Satellite link availability for an average year % 99.98 99.92 99.71 99.59 Satellite link unavailability for an average year % 0.0207 0.0843 0.2873 0.4120 Total link unavailable time for an average year minutes 108.8 443.1 1510 2165.5 10% of the unavailable time in an 
 
- http://transition.fcc.gov/Bureaus/International/Orders/2001/fcc01142.pdf  
- 9 Response to Supplemental Information Request at 17-18. 80 Id. at 16. The preferred shares DT holds differ from common shares primarily in that the preferred shares have a liquidation preference and receive dividends based on the number of common shares that DT would hold if it converted the preferred shares to common. See VoiceStream Wireless Corporation, Form 8-K, Exh. 4.1, Certificate and Designation of the Powers, Preferences and Relative, Participating, Optional and Other Special Rights and Qualifications, Limitations and Restrictions Thereof of Convertible Voting Preferred Stock of VoiceStream Wireless (continued....) Federal Communications Commission FCC 01-142 17 stake is no different, on a share-for-share basis, from any other shareholder of VoiceStream.81 Furthermore, VoiceStream, unlike the corporations at issue in Fox I 
 
- http://transition.fcc.gov/Bureaus/MB/Orders/2002/fcc02113r.pdf  http://transition.fcc.gov/Bureaus/MB/Orders/2002/fcc02113r.txt  
- While not clearly delineated, it appears from the Investment and Stockholder Agreements that the NBC-nominated members of Paxson's board are permitted to vote on all matters that come before the Paxson board. This includes the right to vote on certain extraordinary Paxson corporate matters for which NBC has a "veto right." These extraordinary matters are outlined in Article IV, Section 4.1 of the Investment Agreement and limit such actions as Paxson amending its corporate documents, increasing the size of its board of directors, or incurring large amounts of additional debt, without NBC's consent. The associated Certificate of Designations of the NBC Preferred Stock also include a covenant that limits Paxson's ability to incur additional indebtedness, a common shareholder protection provision. That 
 
- http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.pdf  http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.txt  http://transition.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.wp  
- AREA PEOPLE AREA PEOPLE AREA PEOPLE MATCH (kW) (m) (Sq km) (thous) (Sq km) (thous) (% NL Area) (% NL Pop) (%) B-6 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/mot-r.pdf  http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/mot-r.txt  
- to provide access within the limits of the "readily achievable" standard will be spent as efficiently as possible, thereby maximizing the potential to realize concrete gains in accessibility. As the TAAC,26 the Access Board,27 the FCC,28 and many commentors representing both the disability community29 and industry30 have recognized, access features can 25 NPRM ¶ 120. 26 TAAC Final Report § 4.1 - 15 - most easily and inexpensively be incorporated if considered at the outset of the product and design and development process. As a result, access features considered early in this process are more likely to be "readily achievable," and therefore required, than those considered later (through no fault of the manufacturer). In the NPRM, the FCC correctly recognizes that 
 
- http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/tia-r.pdf  http://transition.fcc.gov/Bureaus/Wireless/Comments/fcc98055/tia-r.txt  
- therefore required than those considered later (through no fault of the manufacturer). In the NPRM, the FCC correctly recognizes that what is "readily achievable" is likely to change over time as technology and understanding of access issues and solutions advance.66 Where new access features become available, the FCC should, as it 61 NPRM ¶ 120. 62 TAAC Final Report § 4.1. 63 Access Board Guidelines § 1193.23. 64 NPRM ¶ 120. 65 See, e.g., CEMA Comments at 14; SBC Comments at 12; TDI Comments at 12; Trace Research and Development Center ("Trace") Comments at 7. 66 NPRM ¶ 120. - 36 - proposes, "take into account reasonable periods of time required to incorporate new accessibility solutions into products under development."67 What 
 
- http://transition.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.pdf  http://transition.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.txt  http://transition.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.wp  
- or property. This conclusion is also supported by the fact that the statute defines services, not entities.162 67. In the United States, radio spectrum may be allocated exclusively or for shared use to either government (Federal government) or non-government (state/local governments and civilians). Spectrum in the FEDERAL COMMUNICATIONS COMMISSION FCC 98-191 163 See 47 C.F.R. § 2.106; NTIA Manual § 4.1.3. See also Reallocation Report and Order. 164 47 C.F.R. § 2.103. 165 If the Commission concurs with the licensee's request, the Federal entity's use of the non-Government spectrum must not cause harmful interference to non-Federal Government stations and must be in accordance with the Commission's service rules as well as any conditions agreed upon by the Commission and NTIA. 166 
 
- http://transition.fcc.gov/Bureaus/Wireless/Reports/fcc00289.pdf  
- million Tele Danmark 41.6 Norway 720,000 NetCom 19.6 (controls 27.9% through investment in Tele Danmark) Belgium 1.9 million Belgacom 17.5 (controls 24.4% through investment in Tele Danmark, which owns 16.5% of Belgacom) Switzerland 413,000 DiAx 40 Hungary 867,000 MATAV 29.8 South Africa 2.1 million (Vodacom) Telkom SA(owns 50% of Vodacom) 18 Canada 1.9 million (Bell Mobility) Bell Canada 20 Mexico 4.1 million Telmex 9 Taiwan 478,000 TransAsia Tele- communications 19.4 SBC Brazil 900,000 Algar Telecom Leste SA (ATL) 50 (stake is jointly owned with Telmex and can be increased to 50% in 2004) Canada 2.6 million Rogers Cantel 17 Colombia 466,000 Celumovil 14 India 90,000 Birla Communications Ltd. 49 Taiwan 1.425 million FarEasTone 14 Japan 8.1 million (J-Phone) Japan Telecom 15 
 
- http://transition.fcc.gov/Bureaus/Wireless/Reports/fcc98091.pdf  
- scale.77 Since the Second Report, there have been several acquisitions in this category, including the three described below. SBC Communications, Inc. ("SBC") announced that it intended to acquire Southern New England Telecommunication Corp. ("SNET")78 and its cellular licenses covering 5.7 million79 POPs.80 Century Telephone Enterprises, Inc. ("Century") acquired Pacific Telecom, Inc. giving Century an additional 1.9 million cellular POPs plus 4.1 million broadband PCS POPs.81 Lastly, Nextel Communications, Inc. ("Nextel"), the nation's largest SMR operator, acquired Pittencrieff Communications, Inc. ("Pittencrieff"),82 the second largest 75 Second Report , 12 FCC Rcd at 11281. 76 Broadband PCS operators also have been selling licenses to facilitate the deployment of their networks, as discussed below in the section analyzing the broadband PCS sector. 77 Second 
 
- http://transition.fcc.gov/Bureaus/Wireline_Competition/Orders/2002/fcc02118.pdf  
- 5.23 NA 4.95 4.93 5.37 10.25 4.47 5.89 4.66 7.03 b,c,d,e Federal Communications Commission FCC 02-118 C-6 Metric Metric September October November December January Notes Number Full Name VZ CLE C VZ CLE C VZ CLE C VZ CLE C VZ CLE C 6020 PO-1-05- 6030 Telephone Number Availability & Reservation - CORBA 5.23 3.52 4.95 3.65 5.37 4.28 4.47 4.1 4.66 4.19 a PO-1-05- 6050 Telephone Number Availability & Reservation - Web GUI 5.23 5.8 4.95 5.69 5.37 5.97 4.47 5.89 4.66 5.64 PO-1-06- 6020 Facility Availability (Loop Qualification) - EDI 2.58 4.06 3.02 3.62 3.51 3.98 1.69 4.06 2.97 3.8 PO-1-06- 6030 Facility Availability (Loop Qualification) - CORBA 2.58 NA 3.02 NA 3.51 NA 1.69 NA 2.97 NA PO-1-06- 
 
- http://transition.fcc.gov/Reports/fcc2005budget_complete.pdf  
- a bandwidth in excess of 200 kbps in the last mile. Outcome Indicator 3: Number of Wi-Fi Hotspots Worldwide (2001-2004) - 20,000 40,000 60,000 80,000 100,000 120,000 140,000 2001 2002 2003E 2004E Source: Gartner Dataquest, June 2003 13 Outcome Indicator 3: U.S. Cellular Phone Adoption (2000-2006) Outcome Indicator 3: Worldwide Wi-Fi Hardward and Chipset Sales (2001-2007) 32.2 19.3 12.7 7.6 4.1 3.9 3.7 77.3 115.6 56.9 13.0 47.2 82.7 113.0 140.1 38.8 77.0 98.1 109.1 $10.1 $1.0 $1.5 $2.6 $4.3 $6.8 0 20 40 60 80 100 120 140 160 180 200 2000 2001 2002 2003E 2004E 2005E 2006E Millio ns $0 $3 $5 $8 $10 $13Billio ns Analogue Phones Digital Phones Next Generation Phones Wireless Data Revenues Source: MorganStanley, March 
 
- http://transition.fcc.gov/Reports/fcc2005budget_main.pdf  
- a bandwidth in excess of 200 kbps in the last mile. Outcome Indicator 3: Number of Wi-Fi Hotspots Worldwide (2001-2004) - 20,000 40,000 60,000 80,000 100,000 120,000 140,000 2001 2002 2003E 2004E Source: Gartner Dataquest, June 2003 13 Outcome Indicator 3: U.S. Cellular Phone Adoption (2000-2006) Outcome Indicator 3: Worldwide Wi-Fi Hardward and Chipset Sales (2001-2007) 32.2 19.3 12.7 7.6 4.1 3.9 3.7 77.3 115.6 56.9 13.0 47.2 82.7 113.0 140.1 38.8 77.0 98.1 109.1 $10.1 $1.0 $1.5 $2.6 $4.3 $6.8 0 20 40 60 80 100 120 140 160 180 200 2000 2001 2002 2003E 2004E 2005E 2006E Millio ns $0 $3 $5 $8 $10 $13Billio ns Analogue Phones Digital Phones Next Generation Phones Wireless Data Revenues Source: MorganStanley, March 
 
- http://transition.fcc.gov/Speeches/Kennard/2000/spwek001.doc  http://transition.fcc.gov/Speeches/Kennard/2000/spwek001.html  http://transition.fcc.gov/Speeches/Kennard/2000/spwek001.txt  
- the FCC implemented policies to stimulate high-speed Internet access through cable and copper. Some broadcasters have responded, and now more than 100 stations reaching 50% of the American people offer high quality digital TV signals. Dealers have received delivery of about 111,000 digital TVs since August of 1998. Cable modems are now in nearly 1.5 million households, and an estimated 4.1 million households subscribe to digital cable, and it is available to millions more. Almost 500,000 households access the Internet using high-speed DSL connections. And there are almost 11 million digital satellite households. So what's the problem? Why aren't more Americans able to enjoy IPTV? The problem is that those in the cable and consumer electronics and programming industries involved in 
 
- http://transition.fcc.gov/cgb/dro/hacrules.pdf  http://transition.fcc.gov/cgb/dro/hacrules.txt  http://transition.fcc.gov/cgb/dro/hacrules.wp  
- An analog telephone complies with the Commission's volume control requirements if the telephone is equipped with a receive volume control that provides, through the receiver in the handset or headset of the telephone, 12 dB of gain minimum and up to 18 dB of gain maximum, when measured in terms of Receive Objective Loudness Rating (ROLR), as defined in paragraph 4.1.2 of ANSI/EIA-470-A-1987 (Telephone Instruments With Loop Signaling) . The 12 dB of gain minimum must be achieved without significant clipping of the test signal. The telephone also shall comply with the upper and lower limits for ROLR given in Table 4.4 of ANSI/EIA-470-A- 1987 when the receive volume control is set to its normal unamplified level. Note: Paragraph 4.1.2 of 
 
- http://transition.fcc.gov/eb/Orders/2001/fcc01173.doc  http://transition.fcc.gov/eb/Orders/2001/fcc01173.html  
- $16.10 per minute); and Low-Power Multi-Channel Ship Station Service during off-peak hours (from $2.80 to $2.50 per minute). Compare January 16, 2001 Letter at Exhibit A, Annex at § 1.8 with January 16, 2001 Letter at Exhibit B, Annex. Complaint at 4, ¶ 12; Answer at 18-19, ¶ 36; January 16, 2001 Letter at Exhibit B, Attachment 1 at § 4.1. IDB Mobile Communications, Inc. v. COMSAT Corporation, Supplemental Reply Brief of COMSAT Corporation, File No. E-97-48 (filed Jul. 21, 2000) at App. A (``COMSAT Supplemental Reply''). Moreover, in June 1995, COMSAT's tariffed rate for INMARSAT Standard-A space segment was $9.30 per minute, whereas the Contract rate was $5.10. See February 2, 2001 Letter at 3; January 16, 2001 Letter at 
 
- http://transition.fcc.gov/eb/Orders/2002/FCC-02-105A1.html  
- defines the word ``terminates,'' both agreements provide a criterion for determining whether traffic terminates on the other party's network for the purposes of the agreements' reciprocal compensation provisions. Specifically, paragraph 5.7.5 of the First Starpower-Verizon Virginia Agreement provides that traffic shall be designated local or non-local based upon the ``actual originating and terminating points of the complete end-to-end call.''86 Paragraph 4.1 of the Second Starpower- Verizon Virginia Agreement similarly states that whether traffic is subject to local call transport and termination rates depends on the ``actual end-to-end jurisdictional nature of each call sent over the trunk.''87 27. We believe that each agreement's use of the phrase ``end-to-end'' is an incorporation of the Commission's long- standing method of determining the jurisdictional nature 
 
- http://transition.fcc.gov/eb/Orders/2002/FCC-02-312A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 5 47 C.F.R. 1.1310, Note 1 to Table 1. 6 47 C.F.R. 1.1310, Note 2 to Table 1. 7 47 C.F.R. 1.1307(b). 8 The former Mass Media Bureau granted A-O's application for a license to cover 
 
- http://transition.fcc.gov/eb/Orders/2002/FCC-02-314A1.html  
- ALLTEL Supplemental Answer and Century Supplemental Answer at IV-2 - IV-3, incorporating by reference Citizens Supplemental Answer at III-4. 119 MCI Telecommunications Corp. v. FCC, 59 F.3d 1407, 1414 (D.C. Cir. 1995), cert. denied, 517 U.S. 1129 (1996), quoting 47 U.S.C. 206 (emphasis added). 120 47 U.S.C. 209. 121 See 33, supra. 122 1 Dan B. Dobbs, Law of Remedies 4.1(1), at 555 (2d ed. 1993). 123 See id. 124 See MCI, 59 F. 3d at 1415. 125 Restatement (Third) of Restitution and Unjust Enrichment 17. 126 See Restatement (Third) of Restitution and Unjust Enrichment 1 cmt. H (Discussion Draft 2000) (``restitution . . . is itself a source of obligations, analogous in this respect to tort or contract. A liability 
 
- http://transition.fcc.gov/eb/Orders/2003/FCC-03-258A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 5 47 C.F.R. 1.1310, Note 1 to Table 1. 6 47 C.F.R. 1.1310, Note 2 to Table 1. 7 See, for example, OET Bulletin 65. 8 See 47 C.F.R. 1.1307(b), 1.1307(b)(1), 1.1310. 9 Id. at 13520-21; 
 
- http://transition.fcc.gov/eb/Orders/2004/FCC-04-281A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 8Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://transition.fcc.gov/eb/Orders/2005/DA-05-265A1.html  
- Provider [i.e., NIP] is in the business of providing Services . . .; and B. Customer desires to purchase Prepaid Calling Services from Provider for resale to Card Holders. Such language describing the parties' relationship does not differ materially among the Service Contracts. 29 See Revised Joint Statement at 5-6, 4; Service Contracts at 3.7 (custom branding) and 4.0 or 4.1 (technical support). 30 Revised Joint Statement at 7-8, 16. 31 Revised Joint Statement at 9, 20-21. See generally Uniform Commercial Code 2A-103 (stating that identification of the goods to be let is the sine qua non of a lease). 32 APCC Services et al. v. NetworkIP, Informal Complaint, File No. EB-02-MDIC-0017, at 2-4 (filed Mar. 29, 2002); APCC Services et 
 
- http://transition.fcc.gov/eb/Orders/2006/FCC-06-173A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm^2 and 
 
- http://transition.fcc.gov/eb/Orders/2007/DA-07-2279A1.html  
- Kent to Melanie Godschall, Investigations and Hearings Division, Enforcement Bureau, Federal Communications Commission, dated July 6, 2006. See Thompson Response at 5-6; Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications 
 
- http://transition.fcc.gov/eb/Orders/2007/DA-07-4721A1.html  
- is unsupported by specific facts or analysis, and is undermined by the evidence of some boxing on NPTC's poles. Accordingly, we direct NPTC, within 60 days, to revise the Pole Attachment Agreement to eliminate this discriminatory provision. 1. The Pole Attachment Agreement Unreasonably Requires Salsgiver to Incur Make-Ready Costs With No Assurance That Those Costs Will Be Reasonable. 22. Section 4.1.3 of the Agreement provides that Salsgiver's submission of a pole attachment application is deemed to constitute Salsgiver's agreement to pay for the cost of the Make-Ready survey. Under the Agreement, NPTC is not required to provide, nor is Salsgiver apparently permitted to demand, an estimate of those costs before Salsgiver is deemed to have agreed to pay them. We find 
 
- http://transition.fcc.gov/eb/Orders/2007/DA-07-5051A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://transition.fcc.gov/eb/Orders/2007/FCC-07-124A1.html  
- such Commission rule or order. 22. This Consent Decree cannot be modified without the advance written consent of both Parties. 23. This Consent Decree may be signed in counterparts. For the Federal Communications Commission: ____________________________ Marlene H. Dortch Secretary ____________________________ Date For Verizon: ____________________________ Michael D. Poling Senior Vice President -- National Operations and Support ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). Under this provision, Verizon will not be required to provide outage reporting compliance training to employees whose responsibilities do not include gathering, analysis, or data entry of information regarding Verizon's network outages or compiling Verizon's outage reports, or whose involvement in Verizon's outage reporting activities is limited to performing job functions that are not 
 
- http://transition.fcc.gov/eb/Orders/2008/DA-08-711A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Thomas J. Sugrue Vice President, Government Affairs T-Mobile USA, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111 and 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Kathleen O'Brien Ham, T-Mobile USA, Inc. (Aug. 6, 2007). Id. Letter from David H. Solomon, Esq., Wilkinson Barker Knauer, LLP, to Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau (Sept. 5, 2007). Under this provision, 
 
- http://transition.fcc.gov/eb/Orders/2009/DA-09-1053A1.html  
- may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Michael D. Rhoda Senior Vice President Windstream Corporation ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 26, 2007); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Jeffrey R. Gardner, President, CEO and Director, Windstream Corporation (July 7, 2008). Letter 
 
- http://transition.fcc.gov/eb/Orders/2009/FCC-09-27A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm.2 47 
 
- http://transition.fcc.gov/eb/Orders/2010/DA-10-2181A1.html  
- Decree may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date ____________________________ Lohn Weber Chief Financial Officer Norlight, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(f). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. (November 18, 2009). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. 
 
- http://transition.fcc.gov/eb/Orders/2010/DA-10-2303A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Steve Nocella Senior Vice President Network Services XO Communications, LLC ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Heather Burnett Gold, Senior Vice President, External Affairs, XO Communications (May 21, 2010) ("LOI"). See LOI. E-mail from Todd D. Daubert, Esq., Sonnenschein Nath & Rosenthal, LLP to Kevin M. Pittman, Esq., Spectrum Enforcement Division, Enforcement Bureau 
 
- http://transition.fcc.gov/eb/Orders/2010/DA-10-237A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Bureau Chief Enforcement Bureau ____________________________ Date ____________________________ Scott W. McCloud Vice President-Wireless Networks Bluegrass Cellular, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Ronald R. Smith, President, Bluegrass Cellular, Inc. (July 14, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Scott W. McCloud, Vice President, Wireless Networks, Bluegrass Cellular, Inc. 
 
- http://transition.fcc.gov/eb/Orders/2010/DA-10-238A1.html  
- number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ William L. Roughton, Jr. Vice President, Legal and Regulatory Affairs Centennial Communications Corporation ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to Tony L. Wolk, Senior Vice President, General Counsel and Secretary, Centennial Corporation (August 15, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to William L. Roughton, Jr., 
 
- http://transition.fcc.gov/eb/Orders/2011/DA-11-1362A1.html  
- of which counterparts together shall constitute one and the same fully executed instrument. ________________________________ P. Michele Ellison Chief Enforcement Bureau ________________________________ Date ________________________________ Stephen W. Crawford General Counsel and Senior Vice President, Mergers and Acquisitions Alpheus Communications, L.P. ________________________________ Date Alpheus Communications, L.P., Notice of Apparent Liability for Forfeiture, 25 FCC Rcd 8993 (Enf. Bur. 2010) ("NAL"). 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i), 503(b). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(f). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Stephen W. Crawford, Esq., General Counsel and Senior Vice President, Alpheus Communications, LP (September 10, 2009) ("LOI"). "User minutes" are defined as "assigned telephone number minutes ... for telephony and for 
 
- http://transition.fcc.gov/eb/Orders/2011/DA-11-402A1.html  
- and the same fully executed instrument. For the Enforcement Bureau: ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date AT&T: By: ____________________________ Paul Mancini Senior VP & Assistant General Counsel AT&T Services, Inc. 1120 20th Street, N.W. Suite 1000 Washington, DC 20036 ____________________________ Date 47 C.F.R. S: 4.9. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S:S: 4.1 et seq. 47 C.F.R. S: 4.9. Id. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Jacquelyne Flemming, Executive Director Counsel, AT&T Services, Inc. (July 18, 2007). Letter from Peter H. Jacoby , General Counsel, AT&T Services, Inc., to Kathy Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission (August 24, 2007). Letter 
 
- http://transition.fcc.gov/eb/Orders/2011/DA-11-816A1.html  
- Electromagnetic Fields," NCRP Report No. 86, sections 17.4.1, 17.4.1.1, 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. S: 1.1310, Table 1 and Note 2. See 47 C.F.R. S:S: 1.1307(b), 1.1307(b)(1), 1.1307(b)(5); Guidelines, Second Memorandum Opinion and Order and Notice of Proposed Rulemaking, 12 FCC Rcd at 13538, 13540. See also, Public 
 
- http://transition.fcc.gov/eb/Orders/2011/DA-11-968A1.html  
- be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Roger D. Linquist President and CEO MetroPCS California, LLC ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Mark A. Stachiw, Executive Vice President Metro PCS Communications, Inc. ("LOI") 47 C.F.R. S: 4.9(e). 47 C.F.R. S: 4.5(b). See LOI. See Letter from J. Christopher Luna, Staff Vice 
 
- http://transition.fcc.gov/eb/Orders/da002431cd.doc  http://transition.fcc.gov/eb/Orders/da002431cd.html  http://transition.fcc.gov/eb/Orders/da002431cd.txt  
- in QUALCOMM's Petition. In consideration of the termination by the Enforcement Bureau of its inquiry into whether QUALCOMM may have violated the Commission's rules, and in accordance with the terms of this Consent Decree, QUALCOMM agrees to the following terms, conditions and procedures regarding compliance with Section 22.921. For the purposes of this Consent Decree, the following definitions shall apply: 4.1 ``Commission'' or ``FCC'' means the Federal Communications Commission; 4.2 ``Bureau'' means the Enforcement Bureau of the Federal Communications Commission; 4.3 ``QUALCOMM'' means QUALCOMM Incorporated; 4.4 ``Parties'' means QUALCOMM and the Bureau; and 4.5 ``Adopting Order'' means an order of the Bureau adopting the terms and conditions of this Consent Decree. The Parties agree that the provisions of this voluntary Consent 
 
- http://transition.fcc.gov/fcc-bin/audio/DA-06-267A1.doc  http://transition.fcc.gov/fcc-bin/audio/DA-06-267A1.pdf  
- the public interest would be served by reallotting Channel 274C1 at Arlington, Tennessee. Channel 274C1 can be allotted at Arlington in compliance with the minimum distance separation requirements of the Commission's Rules at its existing reference coordinates. The reference coordinates of vacant Channel 274A at Saint Florian, Alabama, can be changed to 34-50-12 NL and 87-37-27 WL, at a site 4.1 kilometers (2.5 miles) south of Saint Florian. 6. The Commission will send a copy of this Report and Order in a report to be sent to Congress and the Government Accountability Office pursuant to the Congressional Review Act, see 5 U.S.C. §801(a)(a)(A). 7. Accordingly, pursuant to the authority found in 47 U.S.C. Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b), 
 
- http://transition.fcc.gov/fcc-bin/audio/DA-07-3558A1.doc  http://transition.fcc.gov/fcc-bin/audio/DA-07-3558A1.pdf  
- reimburse United States CP, LLC, for its costs should Petitioner prevail at auction and become the permittee on Channel 249C2 at Blanca. A staff engineering analysis indicates that Channel 249C2 can be allotted to Blanca consistent with the minimum distance separation requirements of the Commission's rules, at coordinates 37-26-35 NL and 105-26-29 WL, with a site restriction of 6.6 kilometers (4.1 miles) east of the community. Accordingly, we seek comment on the proposed amendment of the FM Table of Allotments, Section 73.202(b), as follows: Community Present Proposed Blanca, Colorado --- 249C2 The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the attached Appendix and are incorporated by reference herein. In particular, we 
 
- http://transition.fcc.gov/fcc-bin/audio/DA-08-2277A1.doc  http://transition.fcc.gov/fcc-bin/audio/DA-08-2277A1.pdf  
- 33-25-55 NL and 99-47-43 WL, at a site 2.7 km (1.6 miles) northeast of Knox City (no site change). Proposed Coordinates for Channel 251C3 at Quanah, Texas: 34-24-09 NL and 99-46-02 WL, at a site 11.9 km (7.4 miles) north of Quanah. Proposed Coordinates for Channel 288C2 at Rule, Texas: 33-10-29 NL and 99-49-26 WL, at a site 6.6 km (4.1 miles) east of Rule. 6. The Commission's authority to institute rule making proceedings, showings required, cut-off procedures, and filing requirements are contained in the attached Appendix and are incorporated by reference herein. In particular, we note that a showing of continuing interest is required in paragraph 2 of the Appendix before a channel will be allotted. 7. Pursuant to Sections 
 
- http://transition.fcc.gov/fcc-bin/audio/DA-08-378A1.doc  http://transition.fcc.gov/fcc-bin/audio/DA-08-378A1.pdf  
- reimburse United States CP, LLC, for its costs should Petitioner prevail at auction and become the permittee on Channel 249C2 at Blanca. A staff engineering analysis indicates that Channel 249C2 can be allotted to Blanca consistent with the minimum distance separation requirements of the Commission's rules, at coordinates 37-26-35 NL and 105-26-29 WL, with a site restriction of 6.6 kilometers (4.1 miles) east of the community. Accordingly, pursuant to the authority contained in 47 U.S.C. §§ 4(i), 5(c)(1), 303(g), and (r), and 307(b), and 47 C.F.R. §§0.61, 0.204(b) and 0.283, IT IS ORDERED That effective March 31, 2008, the FM Table of Allotments, 47 C.F.R. § 73.202(b) IS AMENDED, with respect to the community listed below, as follows: Community Channel Blanca, 
 
- http://transition.fcc.gov/fcc-bin/audio/DA-10-156A1.doc  http://transition.fcc.gov/fcc-bin/audio/DA-10-156A1.pdf  
- City, Texas: 33-25-55 NL and 99-47-43 WL, at a site 2.7 km (1.6 miles) northeast of Knox City (no site change). Coordinates for Channel 251C3 at Quanah, Texas: 34-24-09 NL and 99-46-02 WL, at a site 11.9 km (7.4 miles) north of Quanah. Coordinates for Channel 288C2 at Rule, Texas: 33-10-29 NL and 99-49-26 WL, at a site 6.6 km (4.1 miles) east of Rule. 5. IT IS FURTHER ORDERED, That effective March 15, 2010, the Media Bureau's Consolidated Data Base System will reflect the following: Channel 255C3 at Crowell, Texas, as a vacant allotment, in lieu of Channel 293C3; Channel 293A at Knox City, Texas, as a vacant allotment, in lieu of Channel 291A; Channel 251C3 at Quanah, Texas, as 
 
- http://transition.fcc.gov/fcc-bin/audio/engrser.html  
- Inc., [WMJX (FM), Boston, MA] MO&O, FCC 93-300, 8 FCC Rcd 4065, released June 15, 1993 [ [566]PDF ]. NOTE: In the absence of any listener complaints, RITOIE interference did not require WMJX to satisfy listener complaints. The blanketing interference rule, 47 CFR 73.318, does not apply to RITOIE. 1993 Interference Handbook 1993 Edition; no longer updated [ [567]PDF ] (4.1 MB). NOTE: This handbook was produced by the former Field Operations Bureau of the FCC. Addresses, phone numbers, and FCC field office locations are long out of date. Search for businesses' web sites to obtain current contact information. December 2, 1992 Forus FM Broadcasting of New York, Inc. [WVOA-FM1] MO&O, DA 92-1547, 7 FCC Rcd 7880, released December 2, 1992 
 
- http://transition.fcc.gov/fcc-bin/audio/fmpower.html  
- the maximum (reference) facilities for a given FM station class. Only three pieces of information are required to use this program -- the U.S. state of interest, the station class, and the [48]antenna height above average terrain (HAAT). The HAAT for a particular FM station may be found via the [49]FM Query. For example, the program will tell you that 4.1 kW ERP at 122 meters HAAT is equivalent to reference Class A facilities of 6.0 kW ERP at 100 meters HAAT. Reference parameters for the various classes are specified in [50]47 CFR 73.211 and may be viewed at [51]FM Station Classes page. Options are also available for 3.0 kW ERP / 100 meter HAAT Class A stations, as well as 
 
- http://transition.fcc.gov/ib/sand/mniab/traffic/files09/CREPOR09.pdf  
- 0.0 0.0 0.0 0.0100.0 $1,206,835 0.0 0.0 0.0 0.0100.0 390,667,936 0.0 0.1 1.2 0.0 98.7 Syria $11,956,833 0.0 0.0 8.8 0.0 91.2 $677,320 0.0 0.0 0.0 0.0100.0 $7,583 0.0 0.0 0.0 0.0100.0 88,323,685 0.0 0.0 9.2 0.0 90.8 United Arab Emirates $41,065,767 0.0 0.4 4.3 0.0 95.3 $1,634,271 0.0 0.0 0.0 0.0100.0 $971,699 0.0 0.0 0.0 0.0100.0 345,300,235 0.0 0.4 4.1 0.0 95.5 Yemen $14,588,385 0.0 0.0 2.1 0.0 97.9 $100,093 0.0 0.0 0.0 0.0100.0 $11,387 0.0 0.0 0.0 0.0100.0 135,062,473 0.0 0.0 1.8 0.0 98.2 Middle East $273,564,139 0.0 0.2 5.3 0.0 94.5 $15,411,009 0.0 0.0 0.0 0.0100.0 $11,196,706 0.0 0.0 0.0 0.0100.0 2,860,812,695 0.0 0.1 5.7 0.0 94.1 Carrier 1: EPM Telecomunicaciones S.A. E.S.P. Carrier 2: Reliance Communications, Inc. 
 
- http://transition.fcc.gov/ib/sand/mniab/traffic/files10/CREPOR10.pdf  
- Table A21 shows that 56.6 billion of these minutes and $3.5 billion of this revenue were for calls that originated in the United States or terminated collect or caller toll-free in the United States. Table A22 shows that 1.7 billion of these minutes and $0.2 billion of this revenue was for country-direct and country-beyond type services. Table A23 shows that 4.1 billion of these minutes and $0.4 billion of this revenue was for reorigination services billed to foreign carriers. Foreign-billed traffic is all traffic billed by a foreign or correspondent carrier and includes most calls that originate at foreign points as well as collect and caller toll free calls placed by U.S. customers to foreign points. Foreign-billed calls do not necessarily 
 
- http://transition.fcc.gov/mb/audio/alphaindex.html  
- [309]I [310]L [311]IBOC (In-Band On-Channel) Digital AM and FM Radio [312]Indecent or Obscene Broadcasts * Industry Guidance on the Commission's Case Law Interpreting 18 U.S.C. 1464 and Enforcement Policies Regarding Broadcast Indecency, Policy Statement, FCC 01-90, 16 FCC Rcd 7999, released April 6, 2001. [ [313]PDF | [314]MS Word 97 | [315]Text ] [316]Information about Applications [317]Interference Handbook (1993 Edition). 4.1 MB, PDF. Interference to FAA Installations from AM Stations: [318]"The FAA and FCC Agree to Simplify Procedures for Certain EMI Cases", Public Notice, released 4/16/1991. (AM Radio is the only broadcast service to which this Public Notice applies). [319]Inspection Authority -- This fact sheet, compiled by the [320]Enforcement Bureau, addresses some of the more common questions asked about inspections of 
 
- http://transition.fcc.gov/mb/audio/decdoc/engrser.html  
- Inc., [WMJX (FM), Boston, MA] MO&O, FCC 93-300, 8 FCC Rcd 4065, released June 15, 1993 [ [566]PDF ]. NOTE: In the absence of any listener complaints, RITOIE interference did not require WMJX to satisfy listener complaints. The blanketing interference rule, 47 CFR 73.318, does not apply to RITOIE. 1993 Interference Handbook 1993 Edition; no longer updated [ [567]PDF ] (4.1 MB). NOTE: This handbook was produced by the former Field Operations Bureau of the FCC. Addresses, phone numbers, and FCC field office locations are long out of date. Search for businesses' web sites to obtain current contact information. December 2, 1992 Forus FM Broadcasting of New York, Inc. [WVOA-FM1] MO&O, DA 92-1547, 7 FCC Rcd 7880, released December 2, 1992 
 
- http://transition.fcc.gov/ownership/materials/already-released/localismwelfare060005.pdf  
- 2ThisresultisnotspecifictotheHotellinglineardemandframework,butholdsforany discretechoicemodelwithtwoalternativesandnooutsideoption.SeeAndersonandde Palma(2001)forrelatedresults. 8 andforthelargefirm, 0 1= P = 0 2 0( 0) (18) Wecannowusetheadvertisingchoiceequations(14)and(15)torewrite(17) and(18)as: (1 ) = 0( 1) (19) and P = = 0( 0) (20) Thesecanbesummed,aswiththeanalysisofthefixedadsmodel,togive thesameequilibriumrelationsasthere,exceptwithnow replacing .For futurereference,wecanalsouse(16)towrite(19)and(20)as: µ1 2 6 ¶ = 0( 1), = (21) and P = µ1 2+ 6 ¶ = 0( 0) (22) Notethattheseequationsdefineasystemsolelyintermsofqualities.Clearly, thefirstoftheseindicates(sincethevalueof 0isthesameineach )that smallermarketshavesmallerqualities.Theycorrespondinglyselllessadvertis- ing,andtheyalsohavefewerviewers,andmakelessprofit. 4.1Secondbestoptimum Optimalqualitychoicemaybeevaluatedusingseveraldi erentbenchmarks (suchasthefirst-best,whenbothadvertisingandqualitiesaredeterminedop- timally,etc.).Wetakeasgiventhatfirmschooseadlevelsandsoconsidernow thesecondbestoptimumallocationofqualities.Thischoicereflectstheideaof notregulatingallmarketaspects,andaimstoshedlightonwhetherthequality levelsareintrinsicallysub-optimal.Theissueisthentheoptimalqualitychoice giventhatadvertisinglevelsaretobesetgiventhequalities.Thewelfaremax- imandisthesumofconsumersurplusandadvertisingrevenues,andcostsof providingqualityaretobesubtracted. Recallfromtheproduceranalysisthatadlevelsare2 timesmarketshares, andthesemarketsharesare =12+ 6 (see(16)). Thechoiceof 1thenentails: {(1 )(1 1 1+ 0 1)+ ł 1 1 0 1 ´+ 0 1+ 0 1+ (1 ) 1 1 1 1} 0( 1)=0 9 Thefirstterminparenthesesisthechangeinconsumersurplusforthe viewersofchannel1inmarket ,thesecondtermisthechangeinconsumer surplusfortheviewersofchannel0,andtheothertermsarethechangesin advertisingbenefits. Substitutingtherelations 1= 1 6 , 0 1= 0 1= 1 3 ,and 
 
- http://transition.fcc.gov/ownership/materials/already-released/review090001.pdf  
- that focus on the operating performance of radio companies (i.e., EBIT margins and net profit margins). Ratios that shed light on the financing of radio companies are then explored (i.e., total debt as a percentage of total capital, fixed charge coverage after taxes, market to book ratio, and stock market returns). All charts appear at the end of this section. 4.1 EBIT Margins The earnings before interest and taxes margin (EBIT Margin) is defined as the ratio of a firm's earnings (before subtracting out interest and taxes) to the firm's total sales.23 As such, this ratio reflects how efficiently the firm generates profits from its sales, or alternatively stated, how well the firm minimizes the operating, personnel and administrative costs of 
 
- http://transition.fcc.gov/ownership/materials/already-released/survivor090002.pdf  
- 60.2 32.3 27.8 46.2% 33.5 55.6% 11-20 34.6 23.4 11.3 32.7% 15.5 44.8% 21-30 27.0 20.4 6.5 24.1% 10.8 40.0% 31-40 19.0 15.5 3.5 18.4% 7.3 38.4% 41-50 14.0 12.7 1.3 9.3% 4.9 35.0% 51-60 13.7 10.2 3.5 25.5% 5.9 43.1% 61-70 11.0 8.8 2.2 20.0% 4.5 40.9% 71-80 9.7 9.5 0.2 2.1% 3.0 30.9% 81-90 10.8 8.7 2.0 18.5% 4.1 38.0% 91-100 9.4 8.7 0.7 7.4% 3.2 34.0% 101-110 7.8 6.8 1.0 12.8% 3.0 38.5% 111-120 6.8 6.4 0.4 5.9% 2.1 30.9% 121-130 6.8 6.2 0.6 8.8% 2.1 30.9% 131-150 5.7 5.1 0.6 10.5% 1.9 33.3% 151-175 5.3 4.6 0.7 13.2% 1.9 35.8% 176+ 4.0 3.4 0.7 17.5% 1.5 37.5% Source: National Association of Broadcasters, Television Financial Report, 2001 ed., 
 
- http://transition.fcc.gov/ownership/roundtable_docs/waldfogel-b.pdf  
- Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemp. Hit Radio (CHR, top40) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5 4.2 6.3 
 
- http://transition.fcc.gov/ownership/roundtable_docs/waldfogel-c.pdf  
- Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemporary Hit Radio (CHR) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5 4.2 6.3 Classical 
 
- http://wireless.fcc.gov/antenna/index.htm?job=uls_transaction&page=daily  
- Structure Registration files. These files can be found in the Antenna Structure Registration section of this page. If you have any comments or questions about this information, please contact [69]Technical Support. Daily Transaction Files Aircraft - 47 CFR Part 87 Application Records [70]Sun (07-16-12) 0.16 KB [71]Mon (07-10-12) 0.16 KB [72]Tue (07-11-12) 4.05 KB [73]Wed (07-12-12) 4.71 KB [74]Thu (07-13-12) 4.1 KB [75]Fri (07-14-12) 3.48 KB [76]Sat (07-15-12) 4.79 KB License Records [77]Sun (07-16-12) 0.16 KB [78]Mon (07-10-12) 4.81 KB [79]Tue (07-11-12) 4.42 KB [80]Wed (07-12-12) 4.12 KB [81]Thu (07-13-12) 4.17 KB [82]Fri (07-14-12) 3.44 KB [83]Sat (07-15-12) 10.88 KB Amateur Radio Service Application Records [84]Sun (07-16-12) 0.16 KB [85]Mon (07-10-12) 17.4 KB [86]Tue (07-11-12) 65.02 KB [87]Wed (07-12-12) 39.46 KB 
 
- http://wireless.fcc.gov/auctions/05/releases/d980547a.pdf  
- rules and regulations, it may seek a waiver from the FCC in connection with the transactions contemplated by this Term Sheet. 4 CAPITAL: By the date (the "Confirmation Date") on which the Court enters an order (the "Confirmation Order") confirming the Plan, NEWGSM Co. will have the following commitments for capital conditioned solely upon the occurrence of the Effective Date: 4.1 COMMON EQUITY: 4.1.1the "Initial Equity Investment" 4.1.2[Redacted] 3 4.1.3[Redacted] 4.1.4[Redacted] 4.1.5[Intentionally omitted] 4.2 SUBORDINATED DEBT: 4.2.1the "Initial Purchase Commitment" 4.2.2[Redacted] 4.3 VENDOR FINANCING: 4.3.1[Redacted] 5 ASSUMED DEBT: As part of the Plan, the DIP Lenders shall cause the following obligations to be assumed on the Effective Date in the manner set forth below: 5.1 FCC LICENSE PAYMENTS: 5.1.1The New Licensees 
 
- http://wireless.fcc.gov/auctions/53/releases/fc000418.pdf  http://wireless.fcc.gov/auctions/53/releases/fc000418.txt  
- antenna G/T dB 14.5 14.5 14.5 14.5 C/I for other assignments in the BSS Plan dB 20.0 20.0 20.0 20.0 Clear-sky feeder link C/(N+I) dB 26.2 26.2 26.2 26.2 Clear-sky carrier-to-noise plus interference ratio dB 10.7 13.6 8.9 13.7 Required C/(N+I) for operating threshold dB 6.1 6.1 6.1 6.1 Link margin dB 4.6 7.5 2.8 7.7 Rain margin dB 1.82 4.1 0.93 4.22 Rain intensity exceeded for 0.01% of an average year mm/h 30.3 48.2 36.1 95.7 Satellite link availability for an average year % 99.98 99.92 99.71 99.59 Satellite link unavailability for an average year % 0.0207 0.0843 0.2873 0.4120 Total link unavailable time for an average year minutes 108.8 443.1 1510 2165.5 10% of the unavailable time in an 
 
- http://wireless.fcc.gov/auctions/56/resources/Canadianagreement.pdf  
- request. 3.5 If a license is transferred, the agreement(s) developed by the former licensee (see Section 4) shall continue to apply with respect to the new licensee until a new agreement is reached. 3.6 The Administrations reserve the right to impose appropriate technical limitations to facilitate reasonable implementation and operation of proposed or existing systems. 4. Cross Border Coordination Process 4.1 Sharing Agreements - Licensees on both sides of the border are encouraged to develop sharing agreements that will facilitate reasonable and timely development of broadband wireless systems.3 These agreements should allow for the provision of service by each licensee within its licensed service area to the maximum extent possible. If there is a sharing agreement between the licensees, that agreement 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/98540191.pdf  
- non-use and, in so doing, deprives society of important benefits. None of these difficult-to-measure transaction costs are part of the standard measure of allocational efficiency defined below. Finally, we examine the frequency with which participants withdraw high bids. In some environments, a high number of withdrawn bids indicate that bidders are having substantial difficulty in obtaining their most desired licenses. 4.1 Efficiency An auction is said to be 100% efficient when it assigns the set of offered items so that the total value that society obtains from the items is maximized. The efficient set of assignments is known as the optimal allocation. An auction mechanism's ability to 14 efficiently assign items is measured as the ratio of the sum of the 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/98540193.pdf  
- significant (influential). A p-value below .05 is considered to be a strong indicator of significance. We will use this procedure to study the effect of many different variables on the assignment efficiency, auction revenue, bidder losses, withdrawals, bankruptcies, and auction length. Moreover, this analysis will be conducted on data generated from distinct bidding environments  additive valuations versus superadditive valuations.17 4.1 Efficiency An auction is said to be 100% efficient when it assigns the set of offered items so that the total value that society obtains from the items is maximized. An auction mechanism's ability to efficiently assign items is measured as the ratio of the sum of the values that assignees place on their items divided by the sum of 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/cr_2.pdf  
- difficulties; on the other hand, there is no indication of further efforts to employ package bidding in subsequent auctions. In the remainder of this section, we summarize and evaluate the results from experimental laboratories that assess the desirability of package bidding in the AUSM format. Although the data are limited, the preliminary results are largely consistent with our theoretical analysis. 4.1 Credibility of Experimental Evidence The external validity of experimental results remains a controversial topic among economists. Some economists are skeptical of virtually all experimental results, arguing that the behavior of students in laboratories is not a reliable guide to behavior in "real life." Some experimenters argue that experiments with real money at stake are real life and consequently that nothing 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/cr_3.pdf  
- major procedural rules of the SAA should be modified and extended to account for package bidding. In the following sections we outline the Charles River Associates Report 2: Simultaneous Ascending Auctions with Package Bidding 23 principal considerations that should govern the rules for bidding discounts, minimum bid increments, bidding activity, eligibility and auction stages, withdrawal of bids, waivers, and stopping. 4.1 Discounts for Individual Bids and Small Packages Report 1B illustrated the possibility that individual bidders may be unwilling to bear the burden of increasing their bids sufficiently to oust a standing high package bid, with the result that efficient individual bids fail to win the licenses. This "free rider" problem creates a bias toward package bids that may need to 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/jledyard.pdf  
- bids covering each lane The first SLS Auction results 93-94: 14 firms Round 1Round 2Round 3Round 4Round 5 # of bids submitted 3,3834,4094,5953,6914,589 # of package s submi tted 2,3741,6982,2731,8031,721 # of package s in the winning allocation 650 637 577 595 575 acquisiti on cost ($000 ) if auction is st opped $187,149$179,288$172,744$168,337$165,371 % drop f rom previous 4.5 4.1 2.4 1.8 Interesting observations ·Stopping rule was "auctioneers choice" Created a political problem ·Lobbying by current winners ·Some were not serious early on ·Time to compute winners was 20 min to one hour Now it would be 8- 30 sec.on a 300MHz and good algorithm ·Creative use of "dummy" bids to create OR bids The next 5 SLS auctions 95-96 
 
- http://wireless.fcc.gov/auctions/conferences/combin2000/releases/plott.pdf  
- C B Actual outcome at 98% efficiency. The inefficiency is due to misallocations of the second six items, which are of low value. Only I and K are in the wrong hands. The colors represent bidders and not whether a package is involved. 19990625-2 0 10 20 30 40 50 60 70 80 90 100 1.2 2.1 2.2 3.1 3.2 4.1 4.2 5.1 5.2 6.1 6.2 7.1 7.2 8.1 8.2 Round.Phase 990605-2 0 200 400 600 800 1000 1200 1400 1600 0 500 1000 1500 2000 2500 3000 3500 4000 Time (seconds) Amount Revenue Total Value Sealed Bid Phase Continuous Phase 34 items 8 people package incentives 990705-1 0 1000 2000 3000 4000 5000 6000 7000 8000 9000 10000 0 1000 
 
- http://wireless.fcc.gov/auctions/conferences/combin2001/papers/ausubel-milgrom.pdf  
- the condition found in all deferred acceptance algorithms that the buyers first make the offers they prefer most and proceed monotonically to the offers they prefer least, stopping at last when no unmade offer is preferred to the no-trade outcome. As part of the development, we find analogues for the results described above and other typical results of matching theory. 4.1 The Auction Outcome and the Core To make formal sense of these claims, we begin by defining a coalitional form game (L,w) that is associated with the package economy. The coalitional value function w is defined by w(S) = 0 if the seller is not a member of the coalition (0 S) and otherwise by the following expression: [0,] () 
 
- http://wireless.fcc.gov/auctions/conferences/combin2001/papers/combexch.pdf  
- bidandp0bid p-1 ask;(3)p0ask p-1 bidandp0bid>p-1 ask. Inotherwords,eitheroneormoreofthesupplyordemandcurvesmustbe"smooth" attheclearingpoint,withthefirstexcludedbidatapproximatelythesamebidpriceasthe lastacceptedbid,orthewinningbidandaskpricesmustpreciselycoincide. 4Vickrey-BasedBudget-BalancedPaymentRules Intheintroductionwedividedthespaceof(BB)and(IR)mechanismsintomechanisms ofkind(a)andkind(b).Mechanisms(a)areincentive-compatible,andmustexplicitly implementaninefficienttradeeventhoughagentsrevealenoughinformationtocompute theefficientoutcome.Mechanisms(b)arenon-incentive-compatible,andcanclearthe exchangetomaximizereportedsurpluswithoutbreakingtheimpossibilitytheorem.We arguedthatthesetwoapproachesarefundamentallydifferentwithbounded-rationaland poorly-informedagents,becausetherevelationprincipleimpliesthatagentsareableto implementnon-truthfulequilibriainnon-incentive-compatiblemechanisms. Ourthesisisthatwell-designedmechanismsofkind(b)mayhavebetterefficiencythan anymechanismofkind(a)iftheyaresuccessfulinmakingitdifficultforanagentto benefitfromfollowingnon-truthfulbiddingstrategies.Pragmatically,wefurtherbelieve thatitwilloftenbeunacceptablewithinactualexchanges,suchasB2BmarketsorFCC spectrumwirelessmarkets,toreducetradeandexplicitlyimplementinefficientoutcomes toachievebudget-balance. Wetakeanextremeversionofdesignapproach(b),andproposetocleartheexchange tomaximizereportedsurplus,whichreducesthemechanismdesignproblemtothepricing problem,whichcanbeformulatedasadiscountallocationproblem.Wetake(BB)and(IR) ashardconstraintsandproposemethodstodistributesurpluswhenanexchangeclearsto minimizethedistancebetweendiscountsandVickreydiscounts.Thechoiceofdistance functionhasadistributionaleffectontheallocationofsurplusandchangestheincentive- compatibilitypropertiesoftheexchange. Inthissectionwedothefollowing: ·Formulatethepricingproblemasamathematicalprogram,tominimizethedistance toVickreypaymentswith(BB)and(IR)ashardconstraints. ·Introducepossibledistancefunctionsandconstructcorrespondingbudget-balanced paymentschemes. ·Derivesometheoreticalpropertiesthatholdfortherules,andpresentanexample applicationoftherulestotheexamplefirstpresentedintheIntroduction. 23 bid price adjusted price no discount Vickrey discount IR constraint BB constraint Allocation changes middle-ground? Figure7:Thediscountallocationdesignspace.With"nodiscount",anagent'sadjustedprice decreasesasitsbidapproachesthesmallestpricethatisstillsufficienttoimplementthesametrade. TheVickreydiscountprovidesaflatadjustedprice,thatisthesameforarangeofbidprices. Later,inSection5wepresentatheoreticalanalysisofeachpaymentschemeinasimple biddingmodel,andinSection6wepresentanexperimentalanalysisofeachpaymentscheme withinaslightlymorerealisticenvironment. 4.1ASurplus-AllocationModelforthePricingProblem Thepricingproblemistousetheavailablesurplus,V ,computedattrade ,toallocate discountstoagentsthathavegoodincentivepropertieswhileensuring(IR)and(BB). ConsiderthegraphicalillustrationinFigure7.Wemustallocatetheavailablediscounts acrossagentsthatarelessthantheVickreydiscountinsomeplaces,toachieve(BB),and nevernegativetoensure(IR). Weformulatethisproblemasalinearprogram,toallocatesurplustoagentstominimize distancetoVickreydiscounts.LetV denotetheavailablesurpluswhentheexchangeclears, beforeanydiscounts;letI Idenotethesetofagentsthattrade.Wecomputediscounts =( 1,..., I)tominimizethedistanceL( , vick)toVickreydiscounts,forasuitable distancefunctionL. min L( , vick) [PP] s.t. i I i V (BB') i vick,i, i I (VD) i 0, i I (IR') 24 Noticethatthediscountsareper-agent,notperbidorask,andthereforeapplytoa widerangeofbiddinglanguages(asdescribedinSection2).Eachagentmayperforma numberofbuysandsells,dependingonitsbidsandasksandthebidsandasksofother agents. Constraints(BB')and(IR')overthediscountallocationwerefirstintroducedinSection 2.2.(BB')givesworst-case(orexpost)budget-balance,suchthattheexchangenevermakes anetpaymenttoagents.Thisconstraintcanbeeasilystrengthenedifitisdesirablefor themarket-makertotakeasliverofthesurplusbeforecomputingthediscounts.The(IR') constraintsensurethattruthfulbidsandasksare(expost)individual-rationalforanagent, suchthatanagenthasnon-negativeutilityforparticipationwhateverthebidsandasks receivedbytheexchange.11 Constraints(VD)ensurethatnoagentreceivesmorethanitsVickreydiscount.The constraintsarenotredundantforcertaindistancemetrics,suchastheLRE(·)metric. InadditiontothestandardL2( , vick)= i( vick,i- i)2and L 
 
- http://wireless.fcc.gov/auctions/conferences/combin2001/papers/sandholm1.pdf  
- ľË Ý ´ Č ľË Ý µ « .Next Thiscorrespondstovariableordering.ChoosingbetweentheIN-branch (Ü ˝)andtheOUT-branch(Ü Ľ)firstcorrespondstovalueordering. InthecurrentversionofCABOB,wealwaystrytheIN-branchfirst.The reasonisthatwetrytoincludegoodbidsearlysoastofindgoodsolutions early.Thisenablesmorepruningthroughupperbounding.Italsoimproves theanytimeperformance.CPLEX,ontheotherhand,usesvalueorderingas wellinthatitsometimestriestheOUT-branchfirst.Infutureresearchwe plantoexperimentwiththatoptioninCABOBaswell. weshowedexperimentallythatthefollowingmodifica- tiontothenormalizationleadstofasterperformance: Ű Ô Č ľË Ý ĐÓ ´ Č ľË Ý µ WecallthisschemeNSS. Ż BidGraphNeighbors(BGN):Branchonabidwiththe largestnumberofneighborsinthebidgraph .The motivationisthatthiswillallowCABOBtoexcludethe largestnumberofstilleligiblebidsfromconsideration. Ż NumberofItems(NI):Branchonabidwiththelargest numberofitems.ThemotivationisthesameasinBGN. Ż OneBids(OB):BranchonabidwhoseÜ -valuefrom LPisclosestto1.Theideaisthatthemoreofthebidis acceptedintheLP,themorelikelyitistobecompetitive. Ż FractionalBids(FB):BranchonabidwithÜ closestto 0.5.Thisstrategyisadvocatedintheoperationsresearch literature[Wolsey,1998].TheideaisthattheLPisleast sureaboutthesebids,soitmakessensetoresolvethat uncertaintyratherthantoinvestbranchingonbidsabout whichtheLPis"morecertain".Moreoftenthannot, thebidswhoseÜ valuesarecloseto0or1tendtoget closertothoseextremevaluesassearchproceedsdown apath,andintheend,LPwillgiveanintegersolution. Thereforethosebidsneverendupbeingbranchedon. 4.1ChoosingBidOrderingHeuristicsDynamically Weranexperimentsonseveraldistributions(discussed later)usingeachoneoftheheuristicsastheprimaryheuristic, whileusingeachoftheotherheuristicsasatie-breaker.We alsotriedusingathirdheuristictobreakremainingties,but thatneverhelped.Thebestcompositeheuristic(OB+NSS) usedOBfirst,andbroketiesusingNSS. Wenoticedthatoncertaindistributions,OB+NSSwasbest whileondistributionswherethebidsincludedalargenum- berofitems,NSSalonewasbest.Theselectivesuperiorityof theheuristicsledustotheideaofchoosingthebidordering heuristicdynamicallybasedonthecharacteristicsofthere- mainingsubproblem.Wedeterminedthatthedistinguishing characteristicbetweenthedistributionswasLPdensity: density numberofnonzerocoefficientsinLP numberofLProws˘numberofLPcolumns OB+NSSwasbestwhendensitywaslessthan0.25andNSS wasbestotherwise.Intuitively,whentheLPtableissparse, LPisgoodat"guessing"whichbidstoaccept.Whenthetable isdense,theLPmakespoorguesses(mostbidsareaccepted toasmallextent).Inthosecasestheprice-basedschemeNSS (thatstillusestheshadowpricesfromtheLP)wasbetter. So,ateverysearchnodeinCABOB,thedensityiscom- puted,andthebidorderingschemeischosendynamically (OB+NSSifdensityislessthan0.25,NSSotherwise). Asafundamentallydifferentbidorderingmethodology,we observethatstochasticlocalsearch-oranyotherapproxi- matealgorithmfortheproblem-couldbeusedtocomeup withagoodsolutionfast,andthenthatsolutioncouldbe forcedtobetheleftbranch(IN-branch)ofCABOB(withthe "mostsure"bidsnearesttheroot)soastogiveCABOBa moreglobalformofguidanceinbidordering. 5DesignPhilosophyofCABOBvs.CPLEX WebenchmarkedCABOBagainstageneral-purposein- tegerprogrammingpackage,CPLEX7.0.Itwasrecently shown[Anderssonetal.,2000]thatCPLEX6.5isfaster(or comparable)indeterminingwinnersincombinatorialauc- tionsthanarethefirst-generationspecial-purposesearchal- gorithms[Sandholm,1999;Fujishimaetal.,1999].CPLEX 7.0isabout1.6timesfasterthanCPLEX6.5,sowhenwe compareCABOBagainstCPLEX7.0,toourknowledge,we arecomparingitagainstthestate-of-the-art. TherearesomefundamentaldifferencesbetweenCABOB andCPLEXthatwewanttoexplaintoputtheexperiments incontext.CPLEXusesbest-boundsearch(A*)[Wolsey, 1998]whichrequiresexponentialspace(italsohasanoption toforcedepth-firstsearch,butthatmakesCPLEXsomewhat slower),whileCABOBusesdepth-firstbranch-and-bound (DFBnB)whichrunsinlinearspace.Thus,onsomehard problems,CPLEXranoutofvirtualmemory.Inourexperi- mentsweonlyshowcaseswhereCPLEXwasabletorunin RAM.DFBnBputsCABOBatadisadvantagewhenitcomes toreachingtheoptimalsolutionfastsinceitdoesnotallow CABOBtoexplorethemostpromisingleavesofthesearch treefirst.Atthesametime,webelievethatthememoryis- suemakeA*unusableforcombinatorialauctionsinpractice. LikeCABOB,CPLEXusesLPtoobtainupperbounds. CPLEXusesa"presolver"tomanipulatetheLPtableal- gebraically[Wolsey,1998]toreduceitbeforesearch.Inthe experiments,weranCABOBwithoutanypresolving.Natu- 
 
- http://wireless.fcc.gov/auctions/conferences/combin2001/papers/sandholm2.pdf  
- Ü Ň ˝ Ô Ü s.t. Ň ˝ Ü Ľ ˝ ľ Ń Ifthereisnofreedisposal(buyersarenotwillingtotakeextra units,andsellersarenotwillingtokeepanyunitsoftheir winningbids),anequalityisusedinplaceoftheinequality. Definition12(BMUCEWDP)Binary MUCEWDP:MUCEWDPwherethedecisionvariablesare binary(Ü ľ Ľ ˝ ,i.e.,eachbidhastobecompletelyac- ceptedornotatall). Proposition3.2BMUCEWDPisĆČ-complete(withand withoutfreedisposal),evenwithintegerpricesandunits.It isalsoinapproximableinpolynomialtime(unlessČ ĆČ). PROOF.BCAWDPisaspecialcaseofBMUCEWDP. ľ Definition13(CMUCEWDP)Continuous MUCEWDP:MUCEWDPwherethedecisionvariablesare continuous(Ľ Ü ˝,i.e.,bidsandaskscanbeaccepted partially). CMUCEWDPisdirectlysolvablebylinearprogrammingin polytime. 3.4SpanningtheSpectrumofCombinatorial MarketDesigns Inthenextsectionweanalyzethecomplexityofwinnerde- terminationunderdifferentsideconstraints.Wepresentthe positiveresultsinthecontextofthemostgeneralcombinato- rialmarketdesign(MUCEWDP).Theythereforeapplytoall specialcasesofitaswell,suchasCAWDPandCRAWDP. WepresentthenegativeresultsinthecontextofCAWDPand CRAWDP.Theythereforeapplytoallgeneralizationsthereof aswell,suchasMUCEWDP. 4SideConstraintsinCombinatorialMarkets Inthissectionwediscusshowthecomplexityofclearinga combinatorialmarketchangesasdifferenttypesofsidecon- straintsareimposedontheoutcome.Itturnsoutthatdifferent sideconstraintsintroducesharpcutoffsinthecomplexityof clearing.Seeminglysimilarsideconstraintsleadtoproblems thatlieondifferentsidesoftheČvs.ĆČ-completecutoff. Inthefirstsubsectionwepresentsideconstraintsunderwhich thecontinuouscaseremainseasyandthebinarycaseremains hard.Inthenextsubsectionwepresentsideconstraintsthat makebothcaseshard.Inthelastsubsectionwepresentaside constraintthatmakebothcaseseasy. 4.1SideConstraintsunderwhichtheContinuous CaseRemainsEasy,andtheBinaryCase RemainsHard Thefollowingclassesofdomain-independentsidecon- straints,whichweviewaspracticallyimportantandquite general,turnouttobeeasyforthecontinuouswinnerdeter- minationproblem,andremainhardforthebinarycase.The constraintclassesmayseemcumbersome.Thatisbecausewe focusedonmakingthemasgeneralaspossible.Eachcon- straintclassencompassesseveraltypesofsimplerpractical constraints,aswewilldiscussviaexamples. Theconstraintsusethefollowingterminology.Letthe netrevenue(NR)ofasetofbids be Č ľ Ô Ü (bids decreaseNR,butasksincreaseNRbecausethepricesare negative).Letthegrossrevenue(GR)ofasetofbids beČ ľ Ô Ü (bothbidsandasksincreaseGR).Letthe netunits(NU)ofasetofbids andsetofitems be Č ľ Č ľ Ü (unitsboughtincreaseNUbutunitssold arenegative,sotheydecreaseNU).Letthegrossunits(GU) ofasetofbids andsetofitems beČ ľ Č ľ Ü (unitsboughtandsoldincreaseGU).Roughly,thegrossterms measuremarketshareandthenettermsmeasurepropertyob- tained.Therevenuetermsmeasuretheseinmoneyreceived, whiletheunittermsmeasuretheseingoodsreceived.Onall fourterms,eachplayerprefersahighvalue. Maximumtradeconstraints: 1.MAX-SUBSET-NET-REVENUE:Ofacertainsetof bids Ľ (forexample,byacertainplayerorbya setofplayers),NR $ .Forexample,thiscanbeused toenforcethatasellerdoesnotgetanetrevenuethatis obscenelyhigh(whichcouldbeconsideredoutofline). 2.%MAX-SUBSET-NET-REVENUE:Ofacertainsetof bids Ľ 
 
- http://wireless.fcc.gov/auctions/conferences/combin2003/papers/masterevanjohn.pdf  
- Spectrum...........................................................................3 2.1 Flexibility of Use............................................................................................................3 2.2 Exhaustive assignment of spectrum rights......................................................................4 2.3 Exclusive licenses...........................................................................................................5 2.4 Proper definition of interference rights...........................................................................6 2.5 Special provisions for low-power devices......................................................................7 3 Elements of an Efficient Transition to Spectrum Markets......................................................8 3.1 Speed...............................................................................................................................9 3.2 Low transaction costs......................................................................................................9 3.3 Transparency...................................................................................................................9 3.4 Liquidity........................................................................................................................10 3.5 Participation..................................................................................................................10 3.6 Simultaneity..................................................................................................................11 3.7 Package Bidding...........................................................................................................14 4 A Proposed Transition Market Mechanism: Band-Restructuring Auctions........................16 4.1 Simultaneous two-sided auction with package bidding................................................16 4.2 Voluntary participation is the quid pro quo for flexibility............................................19 4.3 An incumbent need not sell its license..........................................................................21 4.4 Efficient and fair division of auction proceeds.............................................................22 4.5 FCC conducted band restructuring auctions................................................................23 5 What Spectrum Should be Restructured?.............................................................................24 5.1 300 MHz to 3000 MHz.................................................................................................25 5.2 Eliminating difficult bands from the initial implementation........................................26 Federal government 
 
- http://wireless.fcc.gov/auctions/conferences/combin2003/papers/pdhetero-rakesh.pdf  
- IntheexampleofSection3.2(Table2)thesubmodularitycondition ofTheorem4issatisfied,sotheauctionresultsinVCGpayments.It isstraightforwardtoobservethatforthosevaluationfunctions,wehave V({1,2,3})=V({1,3})=9,V({2,3})=7,andV({1,2})=8.Therefore, Bidder2'sVCGpayoffiszero;heshouldeitherconsumenothing,orpay hisfullvalueforwhateverbundlehereceives.Thisoccursinanyofthe fourefficientassignmentsintheexample.Similarly,thefinalsurplusofBid- ders1and3equaltheirVCGpayoffs(ofV({1,2,3})-V({2,3})=2and V({1,2,3})-V({1,2})=1respectively). WithoutthesubmodularityconditioninTheorem4,aPDauctionneed notterminateinVCGpayments.10Itisofinteresttonote,however,that 10Suchanexampleisavailableuponrequest.TheexampleshowsthattheAgentsare 19 eveninsuchcases,asingle(predetermined)bidder'sVCGpaymentcanbe obtainedbychoosing,wheneverpossible,anundersuppliedsetexcludingthat bidder. Theorem5Fixbidderj,andsupposethatineachround,aPDAuction choosestheminimallyundersuppliedsetofbiddersKsothat,wheneverpos- sible,j K.ThenpricesatterminationgivebidderjhisVCGpayoff. ProofWeshowthatbymakingsuchchoicesofminimallyundersupplied sets,wehave j=V(N)-V(N\j)attermination.Fixingjasinthe Theorem,letiterationtbethelastoneatwhich tj=V(N)-V(N\j).The existenceoftfollowsfromtheintegralityofthepricechangesandvaluations, asintheproofofTheorem4. Ifthealgorithmisnotfinished,thenjbelongstotheundersuppliedset choseniniterationt.Bysupposition,then,jmustbeamemberofevery minimallyundersuppliedsetatiterationt.Inparticulartheremustexist µ (D)tsuchthatµi Dtiforalli N\{j},andµj= (otherwise N\{j}wouldcontainaminimallyundersuppliedset). Sincethedualvariablesarenotoptimalfor(D)wehave V(N)<( s)t+ i N ti= i N\j pti(µi)+ i N ti = i N\j [vi(µi)- ti]+ i N ti V(N\j)+ tj =V(N\j)+V(N)-V(N\j)=V(N) whichisacontradiction. 4.1Incentives WhenVCGpaymentsareimplementedthroughtheuseofasealed-bidauc- tion(i.e.adirectrevelationmechanism),biddersmaximizetheirpayoffsby biddingtruthfully(i.e.truthfullyreportingtheirvaluations).Inotherwords, theVCGmechanismisstrategyproof.Thereforeitwouldnotbesurprising foranascendingauction(i.e.extensiveformgame)thatimplementsVCG SubstitutesconditionisnotsufficienttoguaranteethatVCGpaymentsresultfromany PDauction,dependingonthechoiceofundersuppliedsetsofbidders. 20 paymentstoinheritgoodincentivesproperties.Infact,theargumentistypi- callymadethatifsucha(extensiveform)gameimplementsVCGpayments, then"truthfulbehavior"(suitablydefined)mustbeanequilibriumofthe game. Theargument,followingthelogicoftheRevelationPrinciple,maybe madeasfollows.Supposeabidderbehavesinawaywhichisconsistentwith somefalsevaluationfunction(differentfromhistrueone).Furthersuppose thatthiscauseshimtoreceiveobjectsandmakepaymentscorrespondingto theVCGpayoffforthefalsevaluation.Bystrategy-proofnessoftheVCG (directrevelation)mechanism,thebiddercannotbebetteroffthanifhehad behavedtruthfully. Unfortunately,thisargumentdoesnotworkifthebiddercouldbehave inawaywhichisinconsistentwithanyvaluationfunction.11Second,it doesnotapplyifthebidderbehavesconsistentlywithrespecttoavaluation functionthatdoesnotyieldaVCGpayoffforthatvaluation.Inoursetting, forexample,thatcouldhappenifthe(ASC)conditionfails. Thefirstoftheseproblemscanbefixedbyspecifyingtherulesofthe auctioninawaythatbiddersmustbehaveconsistentlywithsomevaluation function.Secondly,observethat(i)aPDauctionmustresultinanefficient outcome(withrespecttotheinferredvaluationfunctions),and(ii)abidder paysatleasthisVCGpaymentatthefinal,efficientassignment.Together, theseimplythatifaPDauctionwouldresultinVCGpayoffsunder"truthful" bidding,thensuchbiddingisanequilibrium. Theorem6FixaPDauction,andsupposethebidders'valuationfunctions aresuchthatVCGpayoffswouldresultundertruthfulbidding(e.g.under thesubmodularityconditionofTheorem4).ThentruthfulbiddingisaNash EquilibriuminthesuitablydefinedPDauction.12 ProofSupposeotherbidderswithvaluationsv-jarebiddingtruthfully. Whenbidderjbidstruthfullywithrespecttovj,heobtainshisVCGpayoff; denotetheresultingassignmentasµ.Whenhebidsasifhisvaluation 11Similardifficultiesappearintheliteratureonextensive-formimplementation.See MooreandRepullo(1988). 12ThisresultrequiresaformaldefinitionofagamebasedonthePDauction.Specifically, theproofbelowrequiresthatanybiddingbehaviorintheauctioncorrespondstotruthful behaviorforsomevaluationfunction.Sucharequirementcanbeenforcedbyprohibiting bidwithdrawals,etc.Weleavethisformalizationtothereader. 21 functionisv j,denotetheresultingassignmentasµ andhisresultingpayment (forµ j)asp j.Finally,letµ argmax i =jvi(·)beanassignmentachieving valueV(N\j). Bythenatureofthedualvariable j,aPDauctionyieldsapayoffno higherthantheVCGpayoff.Appliedtov j,thisimplies v 
 
- http://wireless.fcc.gov/auctions/data/papersAndStudies/fc000289.pdf  
- million Tele Danmark 41.6 Norway 720,000 NetCom 19.6 (controls 27.9% through investment in Tele Danmark) Belgium 1.9 million Belgacom 17.5 (controls 24.4% through investment in Tele Danmark, which owns 16.5% of Belgacom) Switzerland 413,000 DiAx 40 Hungary 867,000 MATAV 29.8 South Africa 2.1 million (Vodacom) Telkom SA(owns 50% of Vodacom) 18 Canada 1.9 million (Bell Mobility) Bell Canada 20 Mexico 4.1 million Telmex 9 Taiwan 478,000 TransAsia Tele- communications 19.4 SBC Brazil 900,000 Algar Telecom Leste SA (ATL) 50 (stake is jointly owned with Telmex and can be increased to 50% in 2004) Canada 2.6 million Rogers Cantel 17 Colombia 466,000 Celumovil 14 India 90,000 Birla Communications Ltd. 49 Taiwan 1.425 million FarEasTone 14 Japan 8.1 million (J-Phone) Japan Telecom 15 
 
- http://wireless.fcc.gov/auctions/data/papersAndStudies/fc95317.pdf  http://wireless.fcc.gov/auctions/data/papersAndStudies/fc95317.txt  
- New Orleans-Baton Rouge A WirelessCo, LP 4.9 94 New Orleans-Baton Rouge B PCS PRIMECO 4.9 89 Cincinnati-Dayton A AT&T Wireless PCS 4.7 42 Cincinnati-Dayton B GTE Macro 4.7 43 St. Louis A AT&T Wireless PCS 4.7 119 St. Louis B WirelessCo, LP 4.7 114 Milwaukee A WirelessCo, LP 4.5 85 Milwaukee B PCS PRIMECO 4.5 86 Pittsburgh A WirelessCo, LP 4.1 29 Pittsburgh B APT 4.1 32 Denver A WirelessCo, LP 3.9 64 Denver B GTE Macro 3.9 65 Richmond-Norfolk A AT&T Wireless PCS 3.8 34 Richmond-Norfolk B PCS PRIMECO 3.8 33 Seattle (Excluding Alaska) A GTE Macro 3.8 106 Seattle (Excluding Alaska) B WirelessCo, LP 3.8 105 Puerto Rico-U.S. Virgin A AT&T Wireless PCS 3.6 57 Islands Puerto Rico-U.S. Virgin 
 
- http://wireless.fcc.gov/auctions/data/papersAndStudies/fcc98091.pdf  
- scale.77 Since the Second Report, there have been several acquisitions in this category, including the three described below. SBC Communications, Inc. ("SBC") announced that it intended to acquire Southern New England Telecommunication Corp. ("SNET")78 and its cellular licenses covering 5.7 million79 POPs.80 Century Telephone Enterprises, Inc. ("Century") acquired Pacific Telecom, Inc. giving Century an additional 1.9 million cellular POPs plus 4.1 million broadband PCS POPs.81 Lastly, Nextel Communications, Inc. ("Nextel"), the nation's largest SMR operator, acquired Pittencrieff Communications, Inc. ("Pittencrieff"),82 the second largest 75 Second Report , 12 FCC Rcd at 11281. 76 Broadband PCS operators also have been selling licenses to facilitate the deployment of their networks, as discussed below in the section analyzing the broadband PCS sector. 77 Second 
 
- http://wireless.fcc.gov/outreach/2004broadbandforum/comments/KotzEssein.pdf  
- thecurrentsessionandthestarttimeofthenewsession.This rulewasnecessarybecauseitappearedthatmanysessions didnotendwithaDisassociateorDeauthenticatemessage, eitherbecausetheAPdidnotsendthemessageorwedidnot receiveit. 3.Theendofthetraceisreached.Whenthisoccurs,allongo- ingsessionsendatthelastAPbeingusedbytheclientand thesessionisassumedtoendatthetimeofthelastloginthe entiretrace. Roam:acardswitchesaccesspointswithinasession,identified byaReassociatemessagetoanewAP,orbyanAssociatemessage thatistreatedasaroam(asdescribedabove). Extra-subnetroam:aroamtoanAPinanothersubnet. Intra-subnetroam:aroamtoanAPinthesamesubnet. Stationarysession:asessioncontainingnoroams. Roamingsession:asessioncontainingroams. Extra-subnetsession:asessioncontaininganextra-subnetroam. Intra-subnetsession:aroamingsessioncontainingnoextra-subnet roams. Inbound:trafficsentbytheaccesspointtothecard. Outbound:trafficsentbythecardtotheaccesspoint. Thesecard-centricdefinitionsof"in"and"out"arethereverse ofthoseusedinourearlierdrafts[12,8],butmatchthoseusedby TangandBaker[13]. Ifasniffersawaframewithawirelesssourceanddestination (likelyrare),wecounteditas"inbound,"ratherthandouble-counting itasinboundandoutbound.IntheSNMPanalysis,webelievethe APcountedsuchtraffictwice. AnoteabouttheSessionThresholdmentionedabove.Onocca- sion,acardwouldAssociateratherthanReassociate,apparently becausethestatemachineonthecardwasoutofsyncwiththaton theAP[5].ItisdifficulttoidentifypreciselywhichoftheseAs- sociatemessagesshoulddefineanew"session,"andwhichreally representaroamwithinthecurrentsession.WesetSessionThresh- oldto30seconds,undertheassumptionthatanythingshorteris certainlynotanew"session"intheeyesoftheuser. Anoteaboutthetimestampsinthesyslog.Althoughthemes- sagesmaybedelayedorreorderedastheypassthroughthecampus networktoourserver,thedelaysaresmallrelativetoourtimestamp granularity(onesecond)andanyreorderingthataffectscausality shouldberare. 4.RESULTS Wecollectedanenormousamountofdata,andcanpresentonly asubsetoftheinterestingcharacteristicsinthispaper.First,the basics.Inthe77-daytraceperiodwesaw1706distinctcards.Of the476installedaccesspoints,wemonitored430bysyslog,451 bySNMP,and22bytcpdump.Theaccesspointsweredistributed among161buildings,whichwedivideintofivecategories:82Res- idence,32Academic,6Library,19Social,and22Administrative. Theresidentialbuildingsaremostlyundergraduatedormitoriesand fraternities,butalsoincludesomeDartmouth-ownedhousingfor facultyandstaff,andaresidentialfacilityforthebusinessschool. Allbusiness-schoolstudentshavelaptopsand(asthedatashows) manyarebusywirelessusers.Thesocialbuildingsincludedining facilities,theartscenter,andathleticfacilities(includingalodgeat theskiareaandaboathouseontheriver). Intherestofthissectionwepresentaseriesofquestionsabout thenetwork'susage,andouranalysisbasedonthedata.Foreach figureortable,weidentifythedatasourceas[syslog],[SNMP],or [tcpdump]. 4.1Traffic Perhapsthemostfundamentalquestionsaboutanewnetwork involvehowmuchitisused,andwhen: ·Howmuchtrafficdoesthenetworkhandle? ·Howmuchtrafficpercard? ·Howdoestrafficvaryacrosshours,days,weekdays? Overthecourseofourstudyperiodwemeasured3.3terabytes oftotaltraffic,althoughmorethanhalfthattrafficwascausedby only5%ofcards.Thebusiestcardtransferred117GB,whilethe mediancardusedonly350MB. Thedailytrafficalsovariedconsiderably.Figure1isatimese- ries,andFigure2isacumulativedistributionfunction;weusethe CDFformatinallofourdistributiongraphs.Onthebusiestday thenetworkmovedover240GB,whereasthemediandailytraffic was53MB.ThereisacleardiparoundtheThanksgivingholiday. Therewasalwayslessoutboundtrafficthaninboundtraffic,butthe proportionofoutbounddatavarieddailybetween18and89%. InFigure3wenormalizethedatabythenumberofcardsactive inthatday.Thispresentationflattensthecurvesomewhat,although thereisstillawidevariationindailyactivity. Thesefiguresshowareasonablystrongweeklypatternwithsome surprisingpeaksonMondays.InFigure4weseetheweeklypat- ternsmoreclearly.FridayandSaturdayarethequietestdays,as studentsrelax,butSundaypicksupasstudentsbegintheirhome- work.Monday'saverageisskewedbyactivityinonebuilding, Whittemore,whichincludesstudyroomsandresidencesforstu- dentsoftheTuckSchoolofBusiness.IfWhittemoreisremoved fromFigure4,Monday'strafficmatchesTuesday's(notshown). Figure1:[SNMP]Dailytraffic(GB).Adate'sbarappearstotheright ofitsticmark.Gapsintheplotrepresentholesinourdata.Notethat thereistypicallymoreinboundthanoutboundtraffic. 0 50 100 150 200 250 Sep 30Oct 07Oct 14Oct 21Oct 28Nov 04Nov 11Nov 18Nov 25Dec 02Dec 09 Date (Sundays are labeled) Total Inbound Outbound Figure2:[SNMP]Dailytraffic(GB),distributionacrossdays. 0 0.1 0.2 0.3 
 
- http://wireless.fcc.gov/releases/JV_speech_4_2_03.pdf  
- mutual exclusivity 11 Auctions Foster Efficient Spectrum Use ·Well designed auctions facilitate efficient spectrum aggregation ·Auctions improve assignment decisions by providing information about relative value of spectrum ·Reduces government incentives to employ inefficient assignment methods for awarding spectrum 12 Auctions Speeds Technology to the Marketplace 48 14.6 0 12 24 36 48 Assignment Method Auctions Cellular Lotteries Comparative Hearings Months 4.1 13 Background ·Traditional Oral Outcry ·Sealed Bid ·Simultaneous Multiple Round Ascending ·Combinatorial Common Auction Types Common Auction Types 14 Simultaneous Multiple Round Ascending Auction ·Simultaneous ·All licenses are available during entire auction ·Bids are accepted until there are no bids on any licenses ·Multiple Round ·More than one bidding period ·Promotes aggregation strategy ·Promotes aggregation strategy changes ·Ascending ·Prices increase 
 
- http://wireless.fcc.gov/releases/da051650PublicUse.pdf  
- Channel Allocation (PURCA)...............................24 3.3 Public Use Reservation by Preference and Limitation (PURPL).....................24 3.4 Public Use Reservation by Departure Allocation (PURDA)............................25 3.5 Public Use Reservation with Queuing (PURQ)................................................26 3.6 Public Use Reservation with Queuing  All Calls (PURQ-AC).......................26 3.7 Allocation Percentage.......................................................................................27 3.8 Busy Period and Super Count...........................................................................28 3.9 Time Preference Algorithms (TPA)..................................................................28 3.10 PURAA (and PURQA).....................................................................................29 4. Network Modeling and Benefits...............................................................................30 4.1 Network Performance in "Hot Spot" Scenario.................................................30 4.2 Network Performance in Wide Scenario..........................................................31 4.3 End-to-End Performance..................................................................................32 5. Sensitivities...............................................................................................................33 5.1 Priorities............................................................................................................33 5.2 Queue Attributes...............................................................................................35 5.2.1 Maximum Number Calls Allowed in Queue............................................35 5.2.2 Maximum Allowed Time in Queue..........................................................36 5.2.3 Combination Size and Time......................................................................37 5.3 Cell Size............................................................................................................38 5.4 Random Access Control Channel.....................................................................40 5.5 GSM SDCCH....................................................................................................42 5.6 Directed Retry...................................................................................................45 5.7 Handovers.........................................................................................................47 5.8 Traffic Routing Mix..........................................................................................48 
 
- http://wireless.fcc.gov/reports/documents/avatar-migratory-bird-report10104.pdf  
- Channel of Northern Colorado Tower Study.............................................3-59 3.4.3 Coconino and Prescott National Forest Tower Study..........................................3-60 3.4.4 Philadelphia Tower Study....................................................................................3-60 3.4.5 Mobile Lighting Study.........................................................................................3-61 3.4.6 U.S. Coast Guard "Rescue 21" Study..................................................................3-61 3.5 BIOLOGICAL SIGNIFICANCE...................................................................................3-61 3.5.1 Introduction..........................................................................................................3-61 3.5.2 Summary of Respondents' Comments.................................................................3-62 3.5.3 Other Relevant Information.................................................................................3-64 Notice Of Inquiry Comment Review iii September 2004 Final 3.5.4 Conclusions..........................................................................................................3-66 4. DATA NEEDS AND MITIGATION METHODS...............................................................4-1 4.1 GOING FORWARD AND DATA NEEDS.....................................................................4-1 4.1.1 Standardized Methods and Metrics........................................................................4-1 4.1.2 Species Differences and Susceptibility to Tower Collisions.................................4-2 4.1.3 Site Monitoring Approaches..................................................................................4-2 4.1.3.1 Radar..........................................................................................................4-2 4.1.3.2 Acoustics....................................................................................................4-3 4.1.3.3 Strike Indicators.........................................................................................4-3 4.1.3.4 Tower Site Studies.....................................................................................4-5 4.1.4 Study Biases...........................................................................................................4-5 4.1.5 Research on Avian Vision.....................................................................................4-6 4.1.6 Other Concepts, Approaches, and Recommendations...........................................4-7 4.1.7 Oversight and Research Organization...................................................................4-7 4.2 CURRENT STATE-OF-THE-ART MITIGATION METHODS AND APPROACHES4-8 4.2.1 
 
- http://wireless.fcc.gov/reports/documents/fc000289.pdf  
- million Tele Danmark 41.6 Norway 720,000 NetCom 19.6 (controls 27.9% through investment in Tele Danmark) Belgium 1.9 million Belgacom 17.5 (controls 24.4% through investment in Tele Danmark, which owns 16.5% of Belgacom) Switzerland 413,000 DiAx 40 Hungary 867,000 MATAV 29.8 South Africa 2.1 million (Vodacom) Telkom SA(owns 50% of Vodacom) 18 Canada 1.9 million (Bell Mobility) Bell Canada 20 Mexico 4.1 million Telmex 9 Taiwan 478,000 TransAsia Tele- communications 19.4 SBC Brazil 900,000 Algar Telecom Leste SA (ATL) 50 (stake is jointly owned with Telmex and can be increased to 50% in 2004) Canada 2.6 million Rogers Cantel 17 Colombia 466,000 Celumovil 14 India 90,000 Birla Communications Ltd. 49 Taiwan 1.425 million FarEasTone 14 Japan 8.1 million (J-Phone) Japan Telecom 15 
 
- http://wireless.fcc.gov/siting/fact2.pdf  
- in "Biological Effects and Exposure Criteria for Radiofrequency Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1, 17.4.2 and 17.4.3. Copyright NCRP, 1986, Bethesda, Maryland 20814. In the frequency range from 100 MHz to 1500 MHz, exposure limits for field strength and power density are also generally based on guidelines recommended by the American National Standards Institute (ANSI) in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992, Copyright 1992 by the Institute of Electrical and Electronics Engineers, Inc., New York, New York 10017. TABLE 1: LIMITS FOR MAXIMUM PERMISSIBLE EXPOSURE (MPE) (A) Limits for Occupational/Controlled Exposure Frequency Electric Field Magnetic Field Power Averaging Range 
 
- http://wireless.fcc.gov/uls/ebf/EBF_VEC_Users_Guide.doc  
- Content-Type: text/plain Content-Transfer-Encoding: 8bit Table of Contents 4. Response File 9 4.1. File Format 9 4.2. Record Types 9 5. Status and Error Codes 12 5.1. Status Codes 12 5.2. Error Codes 12 List of Tables Session Response 9 Application Response 10 Status Codes 12 List of Figures Figure 6 - Order of Record Types in Response File 9 Figure 7 - Sample RS Record 10 Figure 8 - Sample RA Record 
 
- http://wireless.fcc.gov/uls/index.htm?&job=transaction&page=daily  
- Structure Registration files. These files can be found in the Antenna Structure Registration section of this page. If you have any comments or questions about this information, please contact [92]Technical Support. Daily Transaction Files Aircraft - 47 CFR Part 87 Application Records [93]Sun (07-16-12) 0.16 KB [94]Mon (07-10-12) 0.16 KB [95]Tue (07-11-12) 4.05 KB [96]Wed (07-12-12) 4.71 KB [97]Thu (07-13-12) 4.1 KB [98]Fri (07-14-12) 3.48 KB [99]Sat (07-15-12) 4.79 KB License Records [100]Sun (07-16-12) 0.16 KB [101]Mon (07-10-12) 4.81 KB [102]Tue (07-11-12) 4.42 KB [103]Wed (07-12-12) 4.12 KB [104]Thu (07-13-12) 4.17 KB [105]Fri (07-14-12) 3.44 KB [106]Sat (07-15-12) 10.88 KB Amateur Radio Service Application Records [107]Sun (07-16-12) 0.16 KB [108]Mon (07-10-12) 17.4 KB [109]Tue (07-11-12) 65.02 KB [110]Wed (07-12-12) 39.46 KB 
 
- http://wireless.fcc.gov/uls/index.htm?job=transaction&page=daily  
- Structure Registration files. These files can be found in the Antenna Structure Registration section of this page. If you have any comments or questions about this information, please contact [92]Technical Support. Daily Transaction Files Aircraft - 47 CFR Part 87 Application Records [93]Sun (07-16-12) 0.16 KB [94]Mon (07-10-12) 0.16 KB [95]Tue (07-11-12) 4.05 KB [96]Wed (07-12-12) 4.71 KB [97]Thu (07-13-12) 4.1 KB [98]Fri (07-14-12) 3.48 KB [99]Sat (07-15-12) 4.79 KB License Records [100]Sun (07-16-12) 0.16 KB [101]Mon (07-10-12) 4.81 KB [102]Tue (07-11-12) 4.42 KB [103]Wed (07-12-12) 4.12 KB [104]Thu (07-13-12) 4.17 KB [105]Fri (07-14-12) 3.44 KB [106]Sat (07-15-12) 10.88 KB Amateur Radio Service Application Records [107]Sun (07-16-12) 0.16 KB [108]Mon (07-10-12) 17.4 KB [109]Tue (07-11-12) 65.02 KB [110]Wed (07-12-12) 39.46 KB 
 
- http://wireless.fcc.gov/uls/weeklypn.htm?job=transaction&page=daily  
- Structure Registration files. These files can be found in the Antenna Structure Registration section of this page. If you have any comments or questions about this information, please contact [92]Technical Support. Daily Transaction Files Aircraft - 47 CFR Part 87 Application Records [93]Sun (07-16-12) 0.16 KB [94]Mon (07-10-12) 0.16 KB [95]Tue (07-11-12) 4.05 KB [96]Wed (07-12-12) 4.71 KB [97]Thu (07-13-12) 4.1 KB [98]Fri (07-14-12) 3.48 KB [99]Sat (07-15-12) 4.79 KB License Records [100]Sun (07-16-12) 0.16 KB [101]Mon (07-17-12) 3.89 KB [102]Tue (07-11-12) 4.42 KB [103]Wed (07-12-12) 4.12 KB [104]Thu (07-13-12) 4.17 KB [105]Fri (07-14-12) 3.44 KB [106]Sat (07-15-12) 10.88 KB Amateur Radio Service Application Records [107]Sun (07-16-12) 0.16 KB [108]Mon (07-17-12) 10.56 KB [109]Tue (07-11-12) 65.02 KB [110]Wed (07-12-12) 39.46 KB 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-303907A1.pdf  
- SkyTel Spectrum LLC San Diego 12/30/2010 00454.70000 33-01-28.2 N CA MD KUD227 117-05-19.1 W 0004552344 SkyTel Spectrum LLC San Diego 12/30/2010 00454.75000 33-01-28.2 N Page 37 CG - General Aviation Air-ground Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City NM MD WPON853 106-46-48.1 W 0004552349 Stratophone, LLC Albuquerque 12/30/2010 00454.70000 35-04-04.1 N NM MD WPON853 106-46-48.1 W 0004552349 Stratophone, LLC Albuquerque 12/30/2010 00454.82500 35-04-04.1 N MD MD KGC405 076-53-05.9 W 0004552375 Stratophone, LLC LANDOVER HILLS 12/30/2010 00454.77500 38-57-02.3 N MD MD KGC405 076-53-05.9 W 0004552375 Stratophone, LLC LANDOVER HILLS 12/30/2010 00454.82500 38-57-02.3 N CA MD KWU510 118-35-12.3 W 0004552376 SkyTel Spectrum LLC CHATSWORTH 12/30/2010 00454.70000 34-19-35.0 N CA MD KWU510 121-52-19.8 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-304028A1.pdf  
- Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY MD KZK92 086-47-22.0 W 0004558883 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 06705.62500 37-57-29.0 N KY MD KZK92 086-47-22.0 W 0004558883 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 10553.12500 37-57-29.0 N KY MD WLR62 086-46-42.8 W 0004558884 BIG RIVERS ELECTRIC CORPORATIONHAWESVILLE 01/04/2011 06865.62500 37-56-04.1 N TX MD WQKQ710 098-36-36.8 W 0004559119 CLEARWIRE SPECTRUM HOLDINGS IIILeon Valley 01/04/2011 21925.00000 29-29-55.5 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19375.00000 29-30-26.9 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19475.00000 29-30-26.9 N TX MD WQKL966 098-35-07.9 W 0004559120 CLEARWIRE SPECTRUM HOLDINGS IIISan Antonio 01/04/2011 19525.00000 29-30-26.9 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-304247A1.pdf  
- N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06315.84000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06345.49000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06375.14000 29-29-59.8 N TX RM WCU361 098-58-59.1 W 0004575755 TEXAS ELECTRONIC TRANSPORT COMHONDO 01/18/2011 06404.79000 29-29-59.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05945.20000 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05960.02500 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05974.85000 29-18-48.8 N TX RM KLR38 099-16-04.1 W 0004575764 TEXAS ELECTRONIC TRANSPORT COMD HANIS 01/18/2011 05989.67500 29-18-48.8 N TX RM KLR38 099-16-04.1 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-304388A1.pdf  
- listing of applications, subject to the pre-grant notice and petition procedure of Section 309 of the Communications Act of 1934, as amended, that were accepted for filing. AF - Aeronautical and Fixed State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City ME NE 069-55-52.8 W 0004583682 Midcoast Regional Redevelopment AuthorBrunswick 01/24/2011 00122.72500 43-54-04.1 N LA NE 090-49-54.9 W 0004585033 Golden Ranch Aviation Thibodaux 01/24/2011 00122.80000 29-44-52.2 N NJ NE 074-06-52.9 W 0004585173 Aviation Spectrum Resources, Inc South Kearny 01/24/2011 00131.97500 40-43-40.9 N NY NE 073-52-21.4 W 0004585183 Aviation Spectrum Resources, Inc New York 01/24/2011 00130.55000 40-46-38.1 N SC NE 080-02-25.9 W 0004585194 Aviation Spectrum Resources, Inc Charleston 01/24/2011 00130.12500 32-53-55.1 N NJ NE 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-304657A1.pdf  
- 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19440.00000 34-04-17.5 N CA MD WPXF902 118-03-56.9 W 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19570.00000 34-04-17.5 N CA MD WPXF902 118-03-56.9 W 0004607709 Los Angeles SMSA Limited Partnership El Monte 02/09/2011 19690.00000 34-04-17.5 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 05974.85000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 06063.80000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 10552.50000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership Compton 02/09/2011 10561.25000 33-53-04.1 N CA MD WMQ712 118-11-22.3 W 0004607710 Los Angeles SMSA Limited Partnership 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-304911A1.pdf  
- LLC Avondale 02/22/2011 10935.00000 32-58-11.0 N TX NE 097-56-30.7 W 0004623841 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11425.00000 32-42-13.2 N TX NE 097-47-00.7 W 0004623842 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10775.00000 32-43-08.6 N TX NE 097-47-00.7 W 0004623842 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10935.00000 32-43-08.6 N TX NE 097-42-27.6 W 0004623843 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11385.00000 32-38-04.1 N TX NE 097-37-19.3 W 0004623844 Wireless Infrastructure Partners, LLC Aledo 02/22/2011 10895.00000 32-41-59.8 N TX NE 097-48-34.3 W 0004623845 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11265.00000 32-39-16.6 N TX NE 097-48-12.3 W 0004623846 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 11225.00000 32-47-58.0 N TX NE 097-45-47.0 W 0004623847 Wireless Infrastructure Partners, LLC Weatherford 02/22/2011 10735.00000 32-51-03.1 N TX NE 097-30-15.2 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-305045A1.pdf  
- Fones West Digital Systems Inc 03/04/2011 RO WPSH600 0004640125 Fones West Digital Systems Inc 03/04/2011 RO WPSH796 0004640126 Fones West Digital Systems Inc 03/04/2011 CL - Cellular State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KS MD KNKN815 099-18-36.2 W 0004639932 Alltel Communications, LLC Coldwater 03/03/2011 37-15-57.0 N KS MD KNKN815 098-56-04.1 W 0004639932 Alltel Communications, LLC Sun City 03/03/2011 37-16-45.6 N NV MD KNKN224 117-41-59.4 W 0004640246 WWC License LLC McDermitt 03/04/2011 41-59-34.1 N KS MD KNKN801 099-18-36.2 W 0004640378 Alltel Communications, LLC Coldwater 03/04/2011 37-15-57.0 N IK - Industrial/Business Pool - Commercial, Conventional State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-305453A1.pdf  
- N VA MD KNKN662 077-21-15.4 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCFREDERICKSBURG 03/21/2011 38-17-52.7 N VA MD KNKN662 078-10-37.4 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCGordonsville 03/21/2011 38-08-06.3 N VA MD KNKN662 077-54-49.6 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCJEFFERSONTON 03/21/2011 38-40-51.0 N VA MD KNKN662 078-03-15.7 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCLouisa 03/21/2011 37-58-22.4 N VA MD KNKN662 078-28-04.1 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCLURAY 03/21/2011 38-41-09.8 N VA MD KNKN662 078-17-48.6 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMadison 03/21/2011 38-23-42.9 N VA MD KNKN662 077-54-58.3 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMineral 03/21/2011 37-56-01.9 N VA MD KNKN662 077-55-26.5 W 0004659730 NEW CINGULAR WIRELESS PCS, LLCMineral 03/21/2011 38-02-13.8 N VA MD KNKN662 078-07-14.0 W 0004659730 NEW CINGULAR 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-306296A1.pdf  
- 0004705178 Clearwire Hawaii Partners Spectrum LLCHonolulu 04/26/2011 19480.00000 21-20-09.8 N HI MD WQDT680 157-48-45.3 W 0004705178 Clearwire Hawaii Partners Spectrum LLCHonolulu 04/26/2011 21825.00000 21-20-09.8 N CO MD WQNF332 104-43-07.9 W 0004706342 San Isabel Electric Association, Inc. Segundo 04/27/2011 00957.55000 37-06-28.1 N CO MD WQNF334 104-30-57.0 W 0004706348 San Isabel Electric Association, Inc. Trinidad 04/27/2011 00953.95000 37-14-17.5 N OH MD WPNL700 081-41-04.1 W 0004707081 WKYC-TV, Inc. CLEVELAND 04/27/2011 23420.00000 41-30-12.6 N CO MD WNEG893 108-24-55.3 W 0004707282 Xcel Energy Services Inc. GRAND JUNCTION 04/27/2011 06615.62500 39-02-48.9 N CO MD WNEW397 108-13-40.3 W 0004707299 Xcel Energy Services Inc. PALISADE 04/27/2011 06423.75000 39-05-18.9 N CO MD WNEW397 108-13-40.3 W 0004707299 Xcel Energy Services Inc. PALISADE 04/27/2011 06775.62500 39-05-18.9 N TX NE 094-04-38.3 W 0004701746 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-306419A1.pdf  
- United Wireless Communications, Inc. Fowler 05/04/2011 10715.00000 37-22-40.3 N KS NE 100-11-47.6 W 0004715956 United Wireless Communications, Inc. Fowler 05/04/2011 10915.00000 37-22-40.3 N TX NE 096-16-33.4 W 0004716000 Heath Internet /Wi-Five TERRELL 05/04/2011 10735.00000 32-47-48.8 N TX NE 096-16-33.4 W 0004716000 Heath Internet /Wi-Five TERRELL 05/04/2011 10815.00000 32-47-48.8 N TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 10935.00000 32-45-04.1 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 11015.00000 32-45-04.1 N TX NE 096-28-13.8 W 0004716001 Heath Internet /Wi-Five FORNEY 05/04/2011 11225.00000 32-45-04.1 N TX NE 096-28-13.8 W 0004716001 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-306653A1.pdf  
- 05/12/2011 17750.00000 13-26-33.0 N GU NE 144-52-26.8 E 0004725603 PTI Pacifica Inc. Yigo 05/12/2011 11115.00000 13-32-58.2 N GU NE 144-45-47.2 E 0004725605 PTI Pacifica Inc. Yona 05/12/2011 11225.00000 13-22-54.8 N GU NE 144-44-37.0 E 0004725606 PTI Pacifica Inc. Agana Hts 05/12/2011 17770.00000 13-28-16.3 N GU NE 144-42-23.8 E 0004725609 PTI Pacifica Inc. Santa Rita 05/12/2011 11355.00000 13-24-01.1 N GU NE 144-52-04.1 E 0004725610 PTI Pacifica Inc. Dededo 05/12/2011 11075.00000 13-34-47.3 N GU NE 144-44-26.9 E 0004725611 PTI Pacifica Inc. Talofofo 05/12/2011 10865.00000 13-21-42.5 N GU NE 144-44-26.9 E 0004725611 PTI Pacifica Inc. Talofofo 05/12/2011 11055.00000 13-21-42.5 N GU NE 144-39-56.1 E 0004725612 PTI Pacifica Inc. Umatac 05/12/2011 11245.00000 13-17-34.4 N GU NE 144-52-02.3 E 0004725614 PTI Pacifica Inc. Yigo 05/12/2011 10895.00000 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-306919A1.pdf  
- MULTICOMM, INC. 05/27/2011 00465.75000 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00465.85000 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00465.87500 PA MD WPKR443 X 0004745234 MULTICOMM, INC. 05/27/2011 00466.27500 PA MD WPKR443 078-07-51.0 W 0004745234 MULTICOMM, INC. HUNTINGDON 05/27/2011 00460.85000 40-29-50.3 N PA MD WPKR443 078-07-51.0 W 0004745234 MULTICOMM, INC. HUNTINGDON 05/27/2011 00461.27500 40-29-50.3 N PA MD WPKR443 078-54-04.1 W 0004745234 MULTICOMM, INC. JOHNSTOWN 05/27/2011 00460.72500 40-26-25.3 N PA MD WPKR443 078-54-04.1 W 0004745234 MULTICOMM, INC. JOHNSTOWN 05/27/2011 00460.87500 40-26-25.3 N PA MD WPKR443 077-53-22.0 W 0004745234 MULTICOMM, INC. PINE GROVE MILLS 05/27/2011 00460.75000 40-42-56.2 N MD WPDN412 A 0004745236 MULTICOMM, INC. 05/27/2011 00460.65000 MD WPDN412 A 0004745236 MULTICOMM, INC. 05/27/2011 00465.65000 PA MD WPDN412 X 0004745236 MULTICOMM, INC. 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-307209A1.pdf  
- 23030.00000 42-11-14.1 N IA NE 093-27-37.0 W 0004747562 airBand Communications, Inc. Bondurant 05/31/2011 21975.00000 41-42-08.1 N Page 25 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IA NE 093-36-01.6 W 0004747563 airBand Communications, Inc. Story City 05/31/2011 21830.00000 42-11-16.6 N NV NE 115-03-04.1 W 0004747564 airBand Communications, Inc. Las Vegas 05/31/2011 11035.00000 35-56-49.3 N NV NE 115-05-23.1 W 0004747565 airBand Communications, Inc. Henderson 05/31/2011 11525.00000 36-01-15.9 N CA NE 117-37-06.0 W 0004747640 New Cingular Wireless PCS, LLC Red Mountain 05/31/2011 19645.00000 35-19-27.2 N PR NE 065-58-02.5 W 0004747658 PR Wireless, Inc. Trujillo Alto 05/31/2011 11165.00000 18-19-36.9 N CA NE 122-09-43.3 W 0004747796 WiLine 
 
- http://wireless.fcc.gov/weeklypn/2011/DOC-307787A1.pdf  
- 088-47-36.0 W 0004761965 NTCH-West Tenn, Inc. Greenfield 06/13/2011 11505.00000 36-08-48.0 N VA NE 076-57-51.3 W 0004762039 RAPPAHANNOCK ELECTRIC COOPERATAPPAHANNOCK 06/13/2011 06197.24000 37-53-31.6 N TN NE 088-50-56.0 W 0004762077 NTCH-West Tenn, Inc. Martin 06/13/2011 10815.00000 36-20-32.7 N TN NE 088-50-56.0 W 0004762077 NTCH-West Tenn, Inc. Martin 06/13/2011 10895.00000 36-20-32.7 N TX NE 095-30-27.8 W 0004762079 Franklin Group Inc. Houston 06/13/2011 11585.00000 29-51-04.1 N TX NE 095-30-27.8 W 0004762079 Franklin Group Inc. Houston 06/13/2011 11625.00000 29-51-04.1 N Page 45 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN NE 088-42-40.0 W 0004762112 NTCH-West Tenn, Inc. Dresden 06/13/2011 11305.00000 36-18-07.0 N TN NE 088-42-40.0 W 0004762112 NTCH-West Tenn, Inc. Dresden 
 
- http://www.fcc.gov/3G/3gfinalreport.doc  http://www.fcc.gov/3G/3gfinalreport.pdf  
- not specify different D/U ratio values based upon whether the incumbent licensee is operating an analog or digital system. Therefore, for purposes of this study the required 45 dB D/U ratio was used for the co-channel analysis. For the adjacent channel analysis, FCC rules specify that a D/U ratio of 0 dB be maintained. Tables 4-A and 4-B in Appendix 4.1 summarize the pertinent provisions of the FCC rules for ITFS/MDS response stations and ITFS/MDS main stations. The analysis assumed two operating scenarios for 3G base stations based on the five IMT-2000 radio interface standards, one operating with high power - 500 watts EIRP (27 dBW), and one operating with low power - 10 watts EIRP (10 dBW). The analysis of 
 
- http://www.fcc.gov/3G/3gfinalreportappendices.doc  http://www.fcc.gov/3G/3gfinalreportappendices.pdf  
- at the UE antenna connector. [6] ``3rd Generation Partnership Project; Technical Specification Group Radio Access Networks; UE Radio Transmission and Reception'', (3G Technical Specification 25.101), clause 5.4.1. [7] ``RF Minimum performance requirements 136HS Outdoor and 136HS Indoor Bearers'', (TR45 technical specification, TIA/EIA-136-290), clause 2. [8] ``RF Minimum performance requirements 136HS Outdoor and 136HS Indoor Bearers'', (TR45 technical specification, TIA/EIA-136-290), clause 4.1.1.2. Refers to Power Class II mobile station. [9] ``RF Minimum performance requirements 136HS Outdoor and 136HS Indoor Bearers'', (TR45 technical specification, TIA/EIA-136-290), clause 6.2. Specifies data rates and reference sensitivity. Reference sensitivity listed for 144 kb/s at a 10% block erasure rate (BLER). [10] ``RF Minimum performance requirements 136HS Outdoor and 136HS Indoor Bearers'', (TR45 technical specification, TIA/EIA-136-290), Table A3a: 
 
- http://www.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.doc  http://www.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.pdf  http://www.fcc.gov/Bureaus/Cable/Orders/2000/fcc00202.txt  
- 8104033; Shy Shin Luh, Digital Subscriber Lines Are the Latest Internet Wave, But Baby Bells Aren't Making the Connection Quickly, Washington Post, Aug. 23, 1999 at F5. A recent report by TeleChoice shows spectacular DSL growth during 1999 and projects continued rapid growth in the future. See TeleChoice, Inc., Deployment - Updated Nov. 5, 1999, http://www.xdsl.com/content/resources/deployment_info.asp. The Yankee Group predicts 4.1 million DSL lines in 2002. See Sarah L. Roberts-Witt, The Coming DSL-Cable Race, Internet World, Nov. 15, 1999, http://www.iw.com/print/1999/11/15/infra/19991115-DSL.html. The Commission's Cable Services Bureau observed in October 1999 that: ``The ILECs' aggressive deployment of DSL can be attributed in large part to the deployment of cable modem service. Although the ILECs have possessed DSL technology since the late 1980s, they 
 
- http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.doc  http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.pdf  http://www.fcc.gov/Bureaus/Cable/Orders/2001/fcc01012.txt  
- of a football game). Some of these new IM-based services -- and perhaps the most important ones in the long term -- are bandwidth-intensive and therefore will work best with high-speed Internet access. These AIHS include time-sensitive, ``latency-dependent'' applications such as talking (e.g., a Talk Feature that enables users to engage in live conversation online and is included in AIM 4.1), game-playing (e.g., features in AOL's New Windows AIM 4.3, buddies jointly `playing along' with popular quiz shows such as Jeopardy! or Who Wants to Be a Millionaire?, or enacting their own versions of those shows online, independent of television broadcasts), and buddies sending each other brief music and video clips. Even more bandwidth-intensive will be video conferencing via IM, which 
 
- http://www.fcc.gov/Bureaus/Cable/Public_Notices/2001/fcc01011.doc  http://www.fcc.gov/Bureaus/Cable/Public_Notices/2001/fcc01011.pdf  http://www.fcc.gov/Bureaus/Cable/Public_Notices/2001/fcc01011.txt  
- an AIHS application that includes the transmission and reception, utilizing a names and presence directory (``NPD'') over the Internet Protocol path of AOL Time Warner broadband facilities, of one- or two-way streaming video communication using NPD protocols - including live images or tape - that are new features, functions, and enhancements beyond those offered in current offerings such as AIM 4.1 or ICQ 2000b, unless and until AOL Time Warner has successfully demonstrated it has complied with one of the following grounds for relief. Grounds for Relief. Option One. AOL Time Warner may file a petition demonstrating that it has implemented a standard for server-to-server interoperability of NPD-based services that has been promulgated by the IETF or a widely recognized standard-setting 
 
- http://www.fcc.gov/Bureaus/Cable/Reports/fcc99418.doc  http://www.fcc.gov/Bureaus/Cable/Reports/fcc99418.txt  
- the analog signals used by current television sets. Presently, cable operators provide set top devices to the consumer for a monthly fee, though these devices will soon become available to consumers through retail outlets. As of December 1998, there were more than 1.2 million digital cable subscribers. Some analysts estimate that by year-end 1999, there will be as many as 4.1 million digital cable subscribers. Cox is marketing its digital product in seven states and has 144,116 subscribers. Cox offers three digital packages: movie, sports and information, and variety. Customers may purchase one package for $5.95 or all three for $10.95. As of August 1999, Comcast served approximately 285,000 subscribers and expects to serve between 400,000 to 450,000 by the end 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.txt  http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99122.wp  
- FCC 99-122 __________________________________________________________________________________________________________________________________ 21 "Numbering Plan Area" (NPA), or "area code," refers to the first three digits (NXX) of a ten-digit telephone number in the form NXX-NXX-XXXX, where N represents any one of the numbers 2 through 9 and X represents any one of the numbers 0 through 9. 47 C.F.R. § 52.7(a). 22 See CO Code Guidelines at § 4.1-4.2 (rev. Apr. 26, 1999). 23 Because NXX codes may not begin with either a 0 or a 1, and because any NXX in the form N11 is also excluded, there are 792 possible usable NXX codes in each NPA. This number represents an upper limit, however, because the existence of protected codes may lower the total number of available NXX 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.txt  http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99168.wp  
- 16020-21. 17 The PICC first took effect in January 1998. The Consumer Price Index (CPI) for interstate toll service dropped from 75.2 in December 1997 to 74.6 in December 1998, or 0.8 percent in absolute terms and 2.4 percent once adjusted for inflation. PHIL CHEILIK, FEDERAL COMMUNICATIONS COMMISSION, REFERENCE BOOK OF RATES, PRICE INDICES AND EXPENDITURES FOR TELEPHONE SERVICE Tbls. 4.1 & 4.2,at 68, 78 (June 1999). The CPI dropped another 4.1 points to 72.5 between December 1998 and May 1999, making the total decline 3.6 percent from December 1997, without adjusting for inflation. See BUREAU OF LABOR STATISTICS, CONSUMER PRICE INDEX-ALL URBAN CONSUMERS: INTERSTATE TOLL CALLS (Series ID: CUUR0000SS27051) (available at the Bureau of Labor Statistics web site, ). 6 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Notices/1999/fcc99379.doc  
- established. Nationwide, the number of CLECs with a single numbering code has increased from 90 carriers in 1997 to 158 carriers in 2nd Quarter 1999, a 75 percent increase. Table 3: Local Service Competitors Holding Numbering Codes Nationwide State* 4th Quarter 1997 90 296 4th Quarter 1998 150 441 2nd Quarter 1999 158 470 *Local Competition Report, August 1999, Table 4.1. 21. The Competition Report also found that there is a significant variation in the entry of new local competitors across the U.S. As of June 30, 1998, only 18 of the nation's 193 LATAs had no CLECs with numbering codes. Twenty LATAs now have 10 or more CLECs with codes, and 62 LATAs have 5 or more such CLECs. West 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97074.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97074.txt  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97074.wp  
- imperceptible; rather, the experiment tested impatience levels among the participants when exposed to differences in post-dial delay.) The MacDonald & Archambault Study's authors specifically note that a customer's threshold for post-dial delay may change over time, and customers may demand shorter average post-dial delay than was found tolerable when the study was conducted. See MacDonald & Archambault Study at ¶ 4.1; see also AT&T November 21, 1996 Ex Parte Filing at 2. The Cotton & Kuong-lau Study is inconclusive, because the authors 15 longer post-dial delay than occurs for calls that are placed to non-ported numbers. (The 66 additional steps in the call flow required by QOR are illustrated in Appendix C.) No party disputes that QOR causes additional post-dial delay. 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97298.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97298.txt  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1997/fcc97298.wp  
- 5R.11, Jenkins Reply Aff. at 13, 21. 722 Michigan Attorney General Comments at 7. 723 By its own admission, Ameritech only instituted procedures to perform an accuracy review of all 724 competing LEC end user data in its 911 database after the events occurred which gave rise to the formal complaint filed by the City of Southfield. Ameritech Application, Vol. 4.1, Ameritech Michigan's Submission of Additional Information, Michigan Public Service Commission Case No. U-11104, Tab 110 at 18 (filed Mar. 27, 1997); Ameritech Reply Comments, Vol. 5R.11, Jenkins Reply Aff. at 17. Ameritech Reply Comments, Vol. 5R.11, Jenkins Reply Aff. at 25. 725 See Ameritech Reply Comments, Vol. 5R.11, Jenkins Reply Aff. at 16 (stating that it plans to have such 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.txt  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1998/fcc98225.wp  
- and that it represents the bulk of transport capacity, we consider it a reasonable measure for current capacity on the transpacific route. At least 78 entities own U.S. half-circuits on TPC-5.272 AT&T owns 38.8 percent of the capacity, followed by MCI with 21.6 percent, Sprint with 8.8 percent, Kokusai Denshin Denwa Co., Ltd (KDD) with 6.5 percent, and WorldCom with 4.1 percent.273 94. We note that the amount of capacity in the transpacific region is expected to increase nearly ten-fold by the end of 1999. Construction on the China-U.S. cable system, which will provide the equivalent of 32,256 E-1 circuits on the transpacific route, is scheduled to begin in 1998 and service is set to be offered in December 1999.274 In 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99238.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99238.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99238.txt  
- Local Competition First Report and Order, 11 FCC Rcd at 16157-58, para. 1364. See supra Section (IV)(D). See supra Section (IV)(E). See 5 U.S.C. § 801(a)(1)(A). See 5 U.S.C. § 604(b). . See 5 U.S.C. § 603(a). See id. Local Competition Third Reconsideration Order, 12 FCC Rcd. at 12462, para.3. . . Report, Local Competition: August 1999, at 45, Table 4.1 (This report is an update of the Local Competition Report issued in December of 1998. The report was compiled by the Industry Analysis Division of the Common Carrier Bureau of the Federal Communications Commission. This report is available in the Commission's Reference Information Center at 445 12th Street, S.W., Courtyard Level, Washington, DC. Copies may be purchased from the International 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/1999/fcc99404.txt  
- See Bell Atlantic Dowell/Canny Decl. Attach. D at (metric NP-2-05); Department of Justice Evaluation at Exhibit 6, 12; New York Commission Comments at 24-25; Allegiance Comments at 9. Bell Atlantic Lacouture/Troy Decl. at para. 7. Bell Atlantic Lacouture/Troy Decl. at para. 7; Bell Atlantic Application App. H, Tab 1 (submitting New York state tariff); see also NYPSC Interceonnection Tariff § 4.1.2-4.1.3 (specifying points of interconnection on BA-NY network). Sprint Comments at 7. New York Commission Comments at 18-20; Bell Atlantic Reply at 22-23; Bell Atlantic Lacouture/Troy Reply Decl. at paras. 30-33. New York Commission Reply at 7; Bell Atlantic Reply at 23; see Petition of Sprint Communications Co., Arbitration of Interconnection Rates, Terms, Conditions, and Related Arrangements With Bell Atlantic-New York, 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc000j2.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc000j2.txt  
- Switching Equipment Account 2220 - Operator Systems Category 1 - Operator Systems Equipment (by type of board) Separate toll boards Separate local manual boards Combined local manual and toll boards Combined toll and DSA boards Separate DSA and DSB boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00104.txt  
- Pennsylvania Consumer Advocate at 5. Bell Atlantic comments at 12; AT&T comments at 24; CinBell comments at 9; Ohio Commission comments at 14; Wisconsin Commission comments at 4. The POI is the carrier's physical point of interconnection to the public switched telephone network (PSTN) for the purpose of interchanging traffic on the PSTN. CO Code Assignment Guidelines at §§ 3.1, 4.1. Id. at § 4.4. Id. at § 4.1.3. An applicant may also obtain an initial NXX code in order to establish an initial Location Routing Number (LRN) per POI or switching entity for each Local Access and Transport Area (LATA), if the carrier has no existing resources available for LRN assignment. Id. at § 4.1.3.1. Id. at § 4.1. Id. 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00193.txt  
- FCC Rcd at 16022. NRTA/NTCA Comments at 6-7; New Jersey Div. Comments at 16-18. Vermont Dept. Reply at 16-17. Vermont Dept. Reply at 17. 47 U.S.C. 254(g); see CALLS Reply at 28; NADO Reply at 5. NADO Reply at 5. CALLS Reply at 28; NADO Reply at 5. NADO Reply at 5. See, e.g., Bell Atlantic Tariff No. 1, Section 4.1.7 and Bell Atlantic Tariff No. 11, Section 31.4.1. Under the prior system, these SLCs were capped at $6.00. See NARUC v. FCC, 737 F.2d at 1113-14. See CALLS Reply at 28-29. NRTA/NCTA Comments at 6-7; New Jersey Div. Comments at 16-18; see also Access Charge Reform Order, 12 FCC Rcd at 16022. See Access Charge Reform Order, 12 FCC Rcd 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.pdf  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00238.txt  
- of 12.9, 22.2, and 8.5 percent, while SWBT's own retail DS1 loops experienced repeat trouble rates of 19.4, 17.9, and 21.8 percent. SWBT Aggregated Performance Data, Measurement No. 69 (``Repeat Reports (%)'') (DS1 Loop with Test Access) at 271-No. 69b. WorldCom Texas II Comments at 41-43. SWBT Auinbauh Texas II Aff. at Attach. C (Amendment 6 to T2A at para. 4.1). Line Sharing Order, 14 FCC Rcd 20912. Line Sharing Order, 14 FCC Rcd at 20982-83, para. 161. Line Sharing Order, 14 FCC Rcd at 20982-83, 21016, paras. 161, 230; 65 Fed. Reg. 1331 (Jan. 10, 2000). See section III.C.1, supra. Line Sharing Order, 14 FCC Rcd at 20982-85, paras. 161-170. SWBT Texas II Cruz Aff. at paras. 5-55; SWBT Texas 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2000/fcc00306.pdf  
- Life Rate Category Description Life Salvage Depreciation Rate ----------------------------------- -------------- ----------- ------------------- ---------------- (years) (%) (%) (%) A B C D=(100%-B-C)/A 2112 MOTOR VEHICLES 3.0 10 68.2 7.3 2115 GARAGE WORK EQ 7.1 0 21.4 11.1 2116 OTHER WORK EQ 6.0 0 46.2 9.0 2121 BUILDINGS 29.0 0 26.3 2.5 2122 FURNITURE 5.0 0 43.2 11.4 2123.1 OFFICE SUPPORT EQ 4.1 0 9.8 22.0 2123.2 COMPANY COMMUN EQ 3.6 0 100.0 - 2124 GEN PURPOSE COMPUTERS 2.4 0 94.7 2.2 2212 DIGITAL ELECTRONIC SW 6.6 0 42.9 8.7 2220 OPERATOR SYSTEMS 5.6 0 100.0 - 2231 RADIO SYSTEMS 3.8 0 77.8 5.8 2232 CIRCUIT EQ 5.8 0 48.2 8.9 2362 OTHER TERMINAL EQ 2.7 0 39.0 22.6 2411 POLES 13.1 -78 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01162.doc  http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2001/fcc01162.txt  
- Switching Equipment Account 2220 - Operator Systems Category 1 - Operator Systems Equipment (by type of board) Separate toll boards Separate local manual boards Combined local manual and toll boards Combined toll and DSA boards Separate DSA and DSB boards Service observing boards Auxiliary service boards Traffic service positions Account 2230 - Circuit Equipment Category 4 - Circuit Equipment Subcategory 4.1 - Exchange Circuit Equipment 4.11 - Wideband Exchange Line Circuit Equipment 4.12 - Exchange Trunk Circuit Equipment 4.13 - Exchange Line Circuit Equipment State private line and state WATS Interstate private line and interstate WATS Message telephone service 4.2 - Interexchange Circuit Equipment 4.21 - Interexchange circuit equipment furnished to another company for IS use 4.22 - Interexchange circuit equipment 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Orders/2002/fcc02331.pdf  
- a benchmark. Note that for some metrics during the period provided there may be changes in the metric definition, or changes in the retail analog applied, making it difficult to compare data over time. Metric SQM No.Metric Name Metric SQM No.Metric Name RESALE A.3.5 M&R-5Out of Service > 24 hours Ordering Billing A.1.1 O-7 % Rejected Service Requests  Mech. A.4.1 B-1 Invoice Accuracy A.1.2 O-7 % Rejected Service Requests - Partially Mech. A.4.2 B-2 Mean Time to Deliver Invoices  CRIS A.1.3 O-7 % Rejected Service Requests - Non-Mech. UNBUNDLED NETWORK ELEMENTS A.1.4 O-8 Reject Interval  Mech. Ordering A.1.7 O-8 Reject Interval - Partially Mech.  10 hours B.1.1 O-7/O-13% Rejected Service Requests  Mech. A.1.8 O-8 Reject Interval 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Public_Notices/Tariffs/Dominant/d090897.pdf  
- S Y N O P S I S --------------------------------------------------------------------------------------------------------------------------------------------------------------- 9/12/97 JWL 9 15 9/5/97 PUERTO RICO TELEPHONE CO. 22 1 PETN-DUE PUS PGS NTC #CDs #DISK TRANS# CARRIER ISSUED FCC# EFFDATE 9/20/97 FILING# 1 61.3861.49 Defines the term completed query in compliance with the CC Docket Nos. 93-129 and 86-10(FCC 96-392); removes from the Table of Contents the descriptive subsections 4.1 through 4.6 contained in Section 4, End User Access Service of Tariff F.C.C. No. 1. S Y N O P S I S --------------------------------------------------------------------------------------------------------------------------------------------------------------- 9/12/97 tRANSMITALS LISTED: -FCC- 7 PUBLIC REFERENCE LOG: 09/08/97 --------------------------------------------------------------------------------------------------------------------------------------------------------------- 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Fiber/fiber97.pdf  
- in Thousands of Miles Calendar Year: 199119921993 1994199519961997 1991 1992 1993 1994 1995 1996 1997 AT&T 45%50%51% 53%55%53%52% 4,383.9 5,188.9 5,203.3 5,243.5 5,864.0 6,864.5 10,354.3 Consolidated 53%53%58% 54% NA NA NA 29.9 31.6 NA 29.7 NA 29.8 NA Electric Lightwave NA NA NA NA NA NA NA NA NA NA NA NA NA NA Frontier (RCI) 56%57%57% 57%46%46%18% 15.5 17.7 4.1 4.3 4.3 4.3 26.5 GST Telecom NA NA NA NA NA NA NA NA NA NA NA NA 5.1 NA IXC 58%66%56% NA NA NA NA 34.6 38.2 39.2 NA NA NA NA LCI 60%60%60% 69%71%76%59% 42.1 47.1 69.3 94.5 132.0 163.4 216.6 MCI NA NA NA NA NA NA NA NA NA NA NA NA NA NA Norlight (was 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd0801.pdf  
- * Data witheld to maintain firm confidentiality. High-Speed Lines by Type of User Table 7 (Over 200 kbps in at Least One Direction) 1/ Other includes medium and large business, institutional, and government customers. Number of Providers Zero 44.0% 30.1% 25.0% One 24.5 25.8 24.5 Two 14.2 16.7 18.6 Three 8.1 9.3 10.7 Four 4.4 6.0 6.2 Five 2.6 4.2 4.1 Six 1.5 3.1 3.0 Seven 0.6 2.2 2.3 Eight 0.2 1.2 2.0 Nine 0.0 0.6 1.6 Ten or More 0.0 0.9 2.1 * Data for June 2000 have been revised. December 1999 June 2000* December 2000 Table 8 Percentage of Zip Codes with High-Speed Lines in Service High-Speed Providers by Zip Code Number of Reporting Providers 7 or more 4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/hspd1208_tables.doc  
- Fixed Wireless 58 20 77 87 92 103 36 7 7 # 332 410 Mobile Wireless 5,509 2,492 8,001 5,759 4,113 1,156 114 0 0 0 11,142 19,142 Power Line and Other 0 0 0 * * * * 0 * 0 5 5 Total 7,419 5,616 13,035 8,103 10,877 10,915 13,533 21,317 10,325 86 75, 154 88,190 Percentages aDSL 4.1 8.9 13.0 7.1 20.6 29.9 26.6 2.4 0.4 0.0 87.0 100.0 sDSL 0.0 0.0 0.0 49.6 29.6 * 1.2 0.0 * 0.0 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.8 48.5 19.8 3.4 18.9 0.6 0.0 100.0 100.0 Cable Modem 1.0 1.4 2.5 0.8 2.9 4.2 14.6 53.4 21.5 0.2 97.5 100.0 FTTP 0.1 0.0 0.2 0.5 1.1 2.0 25.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias0609_tables.doc  
- 0.1 100.0 100.0 Other Wireline 0.0 0.0 0.0 14.1 12.8 54.4 9.5 3.6 2.5 3.1 100.0 100.0 Cable Modem 0.4 1.6 2.0 0.4 3.4 4.9 12.3 34.9 * * 98.0 100.0 FTTP 0.1 0.0 0.2 0.7 1.2 2.5 15.2 1.2 77.9 1.1 99.8 100.0 Satellite 47.8 39.1 86.9 * * * * 0.0 0.0 0.0 13.1 100.0 Fixed Wireless 9.6 4.1 13.6 19.4 24.1 27.3 12.2 1.5 1.6 0.2 86.4 100.0 Mobile Wireless 24.1 13.0 37.2 26.3 30.3 5.7 0.6 * 0.0 * 62.8 100.0 Power Line and Other 0.0 0.0 0.0 * * * * 0.0 * * 100.0 100.0 Total 9.5 6.8 16.4 10.9 17.0 11.8 12.9 13.4 17.5 0.2 83.6 100.0 # = Rounds to Zero. * = 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias0610_tables.doc  
- Fixed Wireless 37 20 57 80 139 164 91 17 3 1 493 551 Mobile Wireless * * 15,085 15,894 24,982 7,482 1,601 2,744 * * 52,704 67,789 Power Line and Other 0 0 0 * * * * 0 * * 6 6 Total 9,220 10,164 19,384 18,241 31,823 20,835 13,602 16,038 28,860 749 130,147 149,531 Percentages aDSL 3.4 4.1 7.5 6.4 18.9 30.6 29.2 5.7 1.6 0.0 92.5 100.0 sDSL 0.0 0.0 0.0 36.3 37.6 * 5.3 0.9 * 0.1 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.4 10.4 57.8 11.7 3.9 3.3 4.5 100.0 100.0 Cable Modem 0.3 1.9 2.2 0.3 1.6 6.9 5.9 26.0 56.3 0.8 97.8 100.0 FTTP 0.1 0.0 0.1 0.4 1.2 2.3 5.1 2.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ias1209_tables.doc  
- 145 75 10 8 1 467 527 Mobile Wireless 7,587 6,040 13,627 13,557 19,479 2,728 949 * 0 * 38,015 51,642 Power Line and Other 0 0 0 * * * * 0 * * 5 5 Total 9,366 8,773 18,139 16,108 27,502 14,498 16,132 12,708 26,207 309 1 13,465 131,604 Percentages aDSL 3.5 4.8 8.3 6.7 19.6 29.2 30.9 4.1 1.2 0.0 91.7 100.0 sDSL 0.0 0.0 0.0 41.9 32.2 17.5 7.5 * * * 100.0 100.0 Other Wireline 0.0 0.0 0.0 8.8 10.4 59.9 10.8 3.7 3.0 3.4 100.0 100.0 Cable Modem 0.4 1.8 2.2 0.5 3.8 4.4 11.9 23.6 53.2 0.5 97.8 100.0 FTTP 0.1 0.0 0.2 0.5 1.2 2.6 10.2 1.6 81.7 2.1 99.8 100.0 Satellite 45.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0202.pdf  
- state totals for these individual states were inconsistently reported at the end of June 2000 compared to the other filing periods. Jun 2001 Percent Resold 2/ Percent Change Jun 00 - Jun 01 Table 10 Mobile Wireless Telephone Subscribers 1/ Number of CLECs 0 46.6% 40.0% 1 19.7 16.3 2 9.1 9.9 3 6.9 8.2 4 5.0 5.6 5 3.9 4.1 6 2.4 3.3 7 1.6 2.6 8 1.2 2.2 9 1.1 1.7 10 or More 2.5 5.9 1/ Data for June 2000 have been revised. Households Percentage 14,961,004 14.5% 9.5% 13,916,596 13.5 9.0 12,347,623 11.9 8.8 12,926,647 12.5 11.5 11,440,264 11.1 10.1 9,885,363 9.6 8.7 6,604,080 6.4 7.6 4,448,655 4.3 6.0 3,824,159 3.7 5.6 3,865,944 3.7 4.5 10 2,910,477 2.8 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0501.pdf  
- 1/ Carriers with under 10,000 subscribers in a state were not required to report. 2/ Percentage of mobile wireless subscribers receiving their service from a mobile wireless reseller. Table 9 Mobile Wireless Telephone Subscribers Number of CLECs June 2000 December 2000 0 46.2 % 44.5 % 1 19.8 17.0 2 9.1 10.3 3 6.8 7.2 4 5.1 5.3 5 3.9 4.1 6 2.4 2.9 7 1.7 2.3 8 1.3 1.7 9 1.1 1.4 10 or More 2.6 3.4 Table 11 Households in Zip Codes with Competitive Local Exchange Carriers Households Percentage Households Percentage 14,039,322 13.6 12,514,914 12.1 14,055,272 13.6 11,054,909 10.7 12,244,926 11.8 11,034,005 10.7 12,670,581 12.3 12,118,475 11.7 11,846,579 11.5 11,512,655 11.1 10,072,717 9.7 9,891,501 9.6 6,565,183 6.4 7,307,707 7.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0603.pdf  
- The remainder of CLEC lines was provided over local- loop facilities owned by the CLECs. · ILECs reported providing about 37% more UNE loops with switching to other carriers at the end of December 2002 than they reported six months earlier (10.2 million compared to 7.5 million) and about 5% more UNE loops without switching (about 4.3 million compared to 4.1 million). · At least one CLEC was serving local telephone service end-user customers in 69% of the nation's zip codes at the end of December 2002, up from 62% a year earlier. About 94% of United States households reside in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto Rico. As additional information 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0604.pdf  
- Percent Change Dec 02 - Dec 03 December 2003 Carriers 1Percent Resold 2 2000 2001 2003 Zero 46.6% 44.0%40.0%38.0%33.0%31.3% 26.8% 25.1% One 19.7 16.8 16.3 16.8 19.5 19.3 18.6 17.3 Two 9.1 10.4 9.9 10.0 10.3 10.4 10.0 10.4 Three 6.9 7.2 8.2 7.7 7.9 6.7 6.7 7.0 Four 5.0 5.5 5.6 6.1 6.6 6.3 5.6 5.3 Five 3.9 4.0 4.1 4.5 4.9 5.2 5.0 4.8 Six 2.4 3.0 3.3 3.8 4.0 4.4 4.4 4.7 Seven 1.6 2.3 2.6 2.9 3.1 3.5 4.1 4.1 Eight 1.2 1.7 2.2 2.2 2.5 2.9 3.6 3.7 Nine 1.1 1.4 1.7 2.1 1.9 2.6 3.1 3.2 Ten or More 2.5 3.7 5.9 5.9 6.3 7.3 12.2 14.4 Zero 14.5% 11.8% 9.5% 8.8% 6.6% 5.8% 4.5% 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0705.pdf  
- 1Percent Resold 2 2000 2001 2003 Zero 46.6% 44.0%40.0%38.0%33.0%31.3% 26.8% 25.1% 21.0% 21.9% One 19.7 16.8 16.3 16.8 19.5 19.3 18.6 17.3 15.3 15.3 Two 9.1 10.4 9.9 10.0 10.3 10.4 10.0 10.4 9.8 11.6 Three 6.9 7.2 8.2 7.7 7.9 6.7 6.7 7.0 7.5 7.6 Four 5.0 5.5 5.6 6.1 6.6 6.3 5.6 5.3 6.1 5.7 Five 3.9 4.0 4.1 4.5 4.9 5.2 5.0 4.8 5.4 5.2 Six 2.4 3.0 3.3 3.8 4.0 4.4 4.4 4.7 5.6 4.4 Seven 1.6 2.3 2.6 2.9 3.1 3.5 4.1 4.1 5.4 4.2 Eight 1.2 1.7 2.2 2.2 2.5 2.9 3.6 3.7 5.4 3.7 Nine 1.1 1.4 1.7 2.1 1.9 2.6 3.1 3.2 4.0 3.2 Ten or More 2.5 3.7 5.9 5.9 6.3 7.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom0800.pdf  
- * 882,779 * Nebraska 4 576,296 0.7 1,666,028 0.35 Nevada 7 750,335 0.9 1,809,253 0.41 New Hampshire 6 280,508 0.4 1,201,134 0.23 New Jersey 5 2,289,181 2.9 8,143,412 0.28 New Mexico 6 363,827 0.5 1,739,844 0.21 New York 7 4,833,816 6.1 18,196,601 0.27 North Carolina 11 2,536,068 3.2 7,650,789 0.33 North Dakota * * * 633,666 * Ohio 12 3,237,786 4.1 11,256,654 0.29 Oklahoma 9 826,637 1.0 3,358,044 0.25 Oregon 7 914,848 1.1 3,316,154 0.28 Pennsylvania 12 2,767,474 3.5 11,994,016 0.23 Puerto Rico * * * 3,889,507 * Rhode Island 6 279,304 0.4 990,819 0.28 South Carolina 7 1,137,232 1.4 3,885,736 0.29 South Dakota * * * 733,133 * Tennessee 9 1,529,054 1.9 5,483,535 0.28 Texas 20 5,792,453 7.3 20,044,141 0.29 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1202.pdf  
- leased from other carriers. The remainder of CLEC lines was provided over local- loop facilities owned by the CLECs. · ILECs reported providing about 29% more UNE loops with switching to other carriers at the end of June 2002 than they reported six months earlier (7.5 million compared to 5.8 million) and about 10% more UNE loops without switching (about 4.1 million compared to 3.7 million). · At least one CLEC was serving local telephone service end-user customers in 67% of the nation's zip codes at the end of June 2002, up from 60% a year earlier. About 93% of United States households resided in these zip codes. CLECs reported customers in all 50 states, the District of Columbia, and Puerto 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1203.pdf  
- Resold 2 Note: Some previously published data for December 2001, June 2002, and December 2002 have been revised. Number of CLECs Zero 46.6% 44.0%40.0%38.0%33.0%31.3% 26.8% One 19.7 16.8 16.3 16.8 19.5 19.3 18.6 Two 9.1 10.4 9.9 10.0 10.3 10.4 10.0 Three 6.9 7.2 8.2 7.7 7.9 6.7 6.7 Four 5.0 5.5 5.6 6.1 6.6 6.3 5.6 Five 3.9 4.0 4.1 4.5 4.9 5.2 5.0 Six 2.4 3.0 3.3 3.8 4.0 4.4 4.4 Seven 1.6 2.3 2.6 2.9 3.1 3.5 4.1 Eight 1.2 1.7 2.2 2.2 2.5 2.9 3.6 Nine 1.1 1.4 1.7 2.1 1.9 2.6 3.1 Ten or More 2.5 3.7 5.9 5.9 6.3 7.3 12.2 Number of CLECs Zero 14.5% 11.8% 9.5% 8.8%6.6% 5.8% 4.5% One 13.5 10.6 9.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcom1204.pdf  
- Jun 04 June 2004 Carriers 1Percent Resold 2 2000 2001 2003 Zero 46.6% 44.0%40.0%38.0%033.0%31.3% 26.8% 25.1% 21.0% One 19.7 16.8 16.3 16.8 19.5 19.3 18.6 17.3 15.3 Two 9.1 10.4 9.9 10.0 10.3 10.4 10.0 10.4 9.8 Three 6.9 7.2 8.2 7.7 7.9 6.7 6.7 7.0 7.5 Four 5.0 5.5 5.6 6.1 6.6 6.3 5.6 5.3 6.1 Five 3.9 4.0 4.1 4.5 4.9 5.2 5.0 4.8 5.4 Six 2.4 3.0 3.3 3.8 4.0 4.4 4.4 4.7 5.6 Seven 1.6 2.3 2.6 2.9 3.1 3.5 4.1 4.1 5.4 Eight 1.2 1.7 2.2 2.2 2.5 2.9 3.6 3.7 5.4 Nine 1.1 1.4 1.7 2.1 1.9 2.6 3.1 3.2 4.0 Ten or More 2.5 3.7 5.9 5.9 6.3 7.3 12.2 14.4 14.7 Zero 14.5% 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp98.pdf  
- or Higher Capacity Facilities)......32 Table 3.6Percentage of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements (Voice Grade Lines and High Capacity Lines)............................35 Table 3.7Percentage of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements (Residential Lines and Other Lines).......................................38 i IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA........................................41 Table 4.1Nationwide Information: Local Service Competitors Receiving First, Relinquishing Last, and Holding Numbering Codes by Type of Market........................................44 Chart 4.1Nationwide Information: Local Service Competitors Holding Numbering Codes by Type of Market........................44 Table 4.2Nationwide Information: Percentage of Markets with One or More Local Service Competitors Holding Numbering Codes.............45 Chart 4.2Nationwide Information: Percentage of Markets with One or More Local Service Competitors Holding Numbering 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/lcomp99-1.pdf  
- by Large ILECs to CLECs for Resale......................25 Table 3.2CLEC Residential and Other Customers Served by ILEC Total Service Resale (TSR) Lines....................................28 Table 3.3Lines Provided by Large ILECs to CLECs as UNE Loops...................32 Table 3.4Percent of ILEC Lines Served by Switching Centers Where New Entrants Have Collocation Arrangements...............................36 IV.NEW ENTRANTS IN THE SWITCHED MARKET: NATIONWIDE, BY STATE, AND BY LATA..............................................43 Table 4.1Local Service Competitors Holding Numbering Codes.....................45 Chart 4.1Local Service Competitors Holding Numbering Codes by LATA on July 1, 1999................................................46 Table 4.2Local Service Competitors Identified..................................47 Table 4.3Numbering Codes Assigned to Local Exchange Carriers....................66 V. TELEPHONE NUMBERS TRANSFERRED AMONG CARRIERS....................67 Table 5.1Telephone Numbers Transferred.....................................69 VI.NEW ENTRANT LOCATOR INFORMATION .................................71 Table 6.1Competitive Access Providers and Competitive Local Exchange Carriers ..............................................73 Table 6.2Local Resellers and 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ldrpt101.pdf  
- 4.0 4.0 4.0 3.9 3.8 6 3.3 3.3 3.2 3.2 3.1 7 2.9 2.9 2.8 2.8 2.7 8 2.7 2.6 2.5 2.5 2.3 9 2.3 2.4 2.3 2.2 2.1 10 2.3 2.2 2.1 2.0 2.0 11-15 8.2 8.1 8.0 7.7 7.3 16-20 5.8 5.6 5.4 5.1 4.7 21-25 4.0 3.7 3.7 3.5 3.2 26-30 2.8 2.5 2.6 2.5 2.2 31-45 4.1 4.0 3.9 3.8 3.3 46-60 1.6 1.5 1.5 1.5 1.3 Greater Than 60 1.3 1.1 1.2 1.2 1.1 Average Duration 9.4 8.9 8.9 8.7 8.0 Median Duration 4.0 3.0 3.0 3.0 3.0 Source: Calculated by IAD staff with data provided by TNS Telecoms (formerly PNR and Associates), Telecoms Market MonitorTM. Sample Size: 110,734 calls for 1995; 94,830 calls for 1996; 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ldrpt103.pdf  
- 3.3 0.0 22.3 0.0 4.2 38.9 134,230 24,046 West Coast 10.8 16.3 2.7 0.0 2.2 42.9 14.2 10.9 165,300 35,837 Mid-Atlantic 10.7 15.0 4.3 0.0 1.0 0.0 52.9 16.2 192,151 35,662 Mid-West 15.9 10.4 3.8 0.0 1.4 31.0 8.1 29.4 207,733 38,367 Northeast 27.4 18.4 0.7 0.0 1.4 9.8 16.0 26.2 73,682 13,990 Southwest 15.5 7.9 8.0 0.0 0.7 30.5 4.1 33.4 87,031 16,630 Total 15.4% 13.2% 4.8% 1.4% 4.3% 17.9% 17.6% 25.3% 945,027 180,094 Region 1 AT&T 2 MCI 3 Sprint Minutes Calls Southeast 17.6% 12.4% 13.4% 19.8% 0.4% 0.1% 6.3% 30.1% 85,446 16,554 West 20.8 16.0 2.9 0.0 28.8 0.0 3.3 28.2 159,581 26,944 West Coast 13.6 14.1 2.0 0.0 1.3 44.1 14.3 10.6 176,438 37,062 Mid-Atlantic 14.8 13.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/mksh3q98.pdf  
- Revenues of Long Distance Carriers Only.................................. 16 TABLE 3.3 Revenues: Market Share Based on Operating Revenues of Long Distance Carriers and Total Toll Revenues for Local Exchange Carriers.............................................17 TABLE 3.4 The Toll Market...................................... 18 TABLE 3.5 Quarterly Toll Revenues Reported to Shareholders.............. 19 TABLE 3.6 Toll Revenues by Type of Provider......................... 21 4. RESIDENTIAL LONG DISTANCE MARKET SHARES....................... 22 TABLE 4.1 Market Share of Residential Access Lines by State.............. 23 TABLE 4.2 Market Share of Residential Toll Revenue by State.............. 24 TABLE 4.3 Market Share of Residential Direct Dial Toll Minutes by State...... 25 5. THE INTERNATIONAL LONG DISTANCE TELEPHONE MARKET............. 26 TABLE 5.1 International Telephone Service........................... 27 APPENDIX 1: AT&T'S MARKET SHARE................................. 28 CHART A1.1 AT&T Share of Interstate Minutes........................ 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/mksh4q98.pdf  
- Revenues of Long Distance Carriers Only.................................. 16 TABLE 3.3 Revenues: Market Share Based on Operating Revenues of Long Distance Carriers and Total Toll Revenues for Local Exchange Carriers.............................................17 TABLE 3.4 The Toll Market...................................... 18 TABLE 3.5 Quarterly Toll Revenues Reported to Shareholders.............. 19 TABLE 3.6 Toll Revenues by Type of Provider......................... 21 4. RESIDENTIAL LONG DISTANCE MARKET SHARES....................... 22 TABLE 4.1 Market Share of Residential Access Lines by State.............. 23 TABLE 4.2 Market Share of Residential Toll Revenue by State.............. 24 TABLE 4.3 Market Share of Residential Direct Dial Toll Minutes by State...... 25 5. THE INTERNATIONAL LONG DISTANCE TELEPHONE MARKET............. 26 TABLE 5.1 International Telephone Service........................... 27 APPENDIX 1: AT&T'S MARKET SHARE................................. 28 CHART A1.1 AT&T Share of Interstate Minutes........................ 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/pntris00.pdf  
- 13,015 12,867 11,130 11,103 10,608 10,304 9,937 14,174 13,768 13,540 11,833 11,998 11,625 11,542 11,735 11,169 10,631 10,513 9,271 9,061 9,176 9,016 9,207 7,910 7,342 7,275 6,482 6,714 6,607 6,714 6,670 12,392 12,323 12,746 10,966 11,435 12,337 13,209 13,467 58,970 57,079 56,941 49,682 50,311 50,353 50,785 51,016 * Current dollar equivalents are at the end of Table 4 65 Alabama 4.1 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.6 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.5 Hawaii 3.1 Oregon 3.0 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/pntris01.pdf  
- 9,941 9,680 14,174 13,768 13,540 11,833 11,998 11,625 11,542 11,739 11,258 11,169 10,631 10,513 9,271 9,061 9,176 9,016 9,234 8,970 7,910 7,342 7,275 6,482 6,714 6,607 6,714 6,643 6,522 12,392 12,323 12,746 10,966 11,435 12,337 13,209 13,459 13,203 58,970 57,079 56,941 49,682 50,311 50,353 50,785 51,016 49,633 * Current dollar equivalents are at the end of Table 4 66 Alabama 4.1 Montana 2.5 Alaska 3.4 Nebraska 2.2 Arizona 2.7 Nevada 3.6 Arkansas 3.6 New Hampshire 2.7 California 1.1 New Jersey 2.3 Colorado 2.1 New Mexico 3.6 Connecticut 2.6 New York 1.4 Delaware 2.8 North Carolina 2.0 District Of Columbia 4.6 North Dakota 1.9 Florida 1.7 Ohio 1.9 Georgia 3.3 Oklahoma 3.5 Hawaii 3.1 Oregon 3.0 Idaho 2.6 Pennsylvania 1.4 Illinois 2.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/quarterly_roll-upsasof110110.pdf  
- Exchange 1,961.9 2,665.0 596.0 622.0 4.4 613.0 1.4 Carriers (ILECs) Total ILECs 8,410.8 20,303.9 4,117.0 4,183.3 1.6 4,101.0 2.0 Competitive Access Providers (CAPs) 860.9 3,264.7 904.6 941.1 4.0 907.7 3.5 and Competitive Local Exchange Carriers (CLECs) Local Resellers 101.6 313.5 60.6 64.1 5.7 60.8 5.2 Private Service Providers 20.7 21.4 17.9 17.7 -1.1 17.7 0.2 Shared-Tenant Service Providers * 14.6 4.1 4.1 0.8 3.9 6.6 Other Local Service Providers 84.2 22.6 6.8 7.7 13.0 6.7 12.7 Total Local Competitors 1,067.7 3,636.8 994.1 1,034.8 4.1 996.8 3.7 Fixed Local Service Providers 9,478.5 23,940.8 5,111.1 5,218.1 2.1 5,097.8 2.3 Payphone Service Providers 38.0 123.1 9.6 10.5 9.4 10.0 4.9 Wireless Telephony Including Cellular, 1,066.0 19,323.6 4,379.8 4,771.7 8.9 4,641.1 2.7 Personal Communications Service 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ref98.pdf  
- Table 3.5 Average Annual Household Expenditures by Size of the Household...........................57 Table 3.6 Household Telecommunications Expenditures by Type of Provider.............................58 B. Business Expenditures........................................59 Table 3.7 Use of Communications by U.S. Industry, 1992.......60 Table 3.8 Use of Commodities by the U.S. Communications Industry......................................63 C. Additional Sources of Information on Expenditures for Telephone Service...........................................65 IV. Price Indices..................................................66 A. Consumer Price Indices.......................................66 Table 4.1 Changes in the Consumer Price Indices Since 1980...67 Chart 1 Consumer Price Indices for Toll Service since 1984....68 Chart 2 Consumer Price Indices for Toll Service since 1984, Adjusted for Inflation............................69 Table 4.2 Monthly Consumer Price Indices...................70 Table 4.3 New Consumer Price Indices......................78 B. Producer Price Indices........................................79 Table 4.4 Monthly Producer Price Indices....................80 Table 4.5 Discontinued Monthly Producer Price Indices.........85 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/ref99.pdf  
- Table 3.5 Average Annual Household Expenditures by Size of the Household........................59 Table 3.6 Household Telecommunications Expenditures by Type of Provider..........................60 B. Business Expenditures.....................................61 Table 3.7 Use of Communications by U.S. Industry, 1992......62 Table 3.8 Use of Commodities by the U.S. Communications Industry...................................65 C. Additional Sources of Information on Expenditures for Telephone Service.......................................67 IV. Price Indices..............................................68 A. Consumer Price Indices...................................68 Table 4.1 Changes in the Consumer Price Indices Since 1980...69 Chart 1 Consumer Price Indices for Toll Service since 1984...70 (Adjusted for inflation) Chart 2 Consumer Price Indices for Toll Service since 1984. . .71 Table 4.2 Monthly Consumer Price Indices..............72 Table 4.3 New Consumer Price Indices...................79 B. Producer Price Indices....................................80 Table 4.4 Monthly Producer Price Indices..................81 Table 4.5 Discontinued Monthly Producer 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/strev-97.pdf  
- 593,074 100.0 0.0 0.0 FLORIDA 7,114,917 232,955 2,779,199 7,230,425 236,7372,824,318 59.3 39.1 1.6 GEORGIA 2,674,779 116,942 1,292,308 2,977,856 130,1931,438,738 83.8 0.6 15.7 HAWAII 454,717 19,649 183,279 454,939 19,659 183,369 0.0 100.0 0.0 IDAHO 445,342 20,036 153,752 492,026 22,136 169,869 71.7 21.7 6.6 ILLINOIS 4,704,322 282,070 2,642,253 4,816,423 288,7922,705,216 85.6 12.3 2.1 INDIANA 2,221,241 84,297 933,285 2,319,914 88,042 974,744 62.4 33.5 4.1 IOWA 932,997 38,574 348,539 1,129,719 46,707 422,028 65.1 21.0 14.0 KANSAS 880,791 74,289 317,968 1,043,585 88,020 376,737 84.0 8.6 7.4 KENTUCKY 1,227,474 49,239 353,193 1,409,765 56,551 405,645 56.9 34.7 8.4 LOUISIANA 1,584,986 46,553 567,966 1,706,756 50,130 611,601 92.9 0.0 7.1 MAINE 414,650 37,152 146,734 493,938 44,256 174,792 83.9 0.0 16.1 MARYLAND 2,260,772 60,548 1,141,471 2,264,956 60,6601,143,583 99.8 0.0 0.2 MASSACHUSETTS 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0300.pdf  
- March 2000 Change Alabama 87.9% 91.2% 3.3% Alaska 83.8 95.4 11.6 * Arizona 88.8 94.8 6.1 * Arkansas 88.2 90.1 1.9 California 91.7 95.6 3.9 * Colorado 94.4 95.7 1.3 Connecticut 95.5 95.8 0.3 Delaware 95.0 97.2 2.2 District of Columbia 94.7 90.8 -3.9 Florida 85.5 92.2 6.7 * Georgia 88.9 91.8 2.9 Hawaii 94.6 93.6 -1.0 Idaho 89.5 93.6 4.1 * Illinois 95.0 93.0 -2.0 Indiana 90.3 95.7 5.4 * Iowa 95.4 96.7 1.3 Kansas 94.9 94.6 -0.3 Kentucky 86.9 93.9 7.0 * Louisiana 88.9 90.8 1.9 Maine 90.7 98.5 7.8 * Maryland 96.3 96.3 0.0 Massachusetts 94.3 94.1 -0.2 Michigan 93.8 95.9 2.1 * Minnesota 96.4 97.8 1.5 Mississippi 82.4 88.8 6.4 * Missouri 92.1 95.7 3.6 * Montana 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0302.pdf  
- Mississippi 82.4 90.7 8.3 * Missouri 92.1 95.9 3.8 * Montana 92.8 96.2 3.4 * Nebraska 94.0 96.2 2.2 Nevada 89.4 96.4 7.0 * New Hampshire 95.0 97.6 2.6 New Jersey 94.1 95.6 1.5 New Mexico 85.3 92.7 7.4 * New York 90.8 95.6 4.8 * North Carolina 89.3 94.3 5.0 * North Dakota 95.1 96.4 1.3 Ohio 92.2 96.3 4.1 * Oklahoma 91.5 92.8 1.3 Oregon 91.2 97.3 6.1 * Pennsylvania 95.1 97.7 2.6 * Rhode Island 93.3 96.1 2.8 South Carolina 81.8 93.4 11.6 * South Dakota 92.7 95.1 2.4 Tennessee 87.6 93.6 6.0 * Texas 89.0 94.7 5.7 * Utah 90.3 96.6 6.3 * Vermont 92.7 98.0 5.3 * Virginia 93.1 96.6 3.5 * Washington 92.5 96.6 4.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0303.pdf  
- 89.4 94.9 5.5 * New Hampshire 95.0 97.5 2.6 New Jersey 94.1 96.1 2.0 New Mexico 85.3 93.0 7.7 * New York 90.8 95.3 4.5 * North Carolina 89.3 94.4 5.1 * North Dakota 95.1 94.4 -0.7 Ohio 92.2 96.6 4.4 * Oklahoma 91.5 92.7 1.2 Oregon 91.2 96.7 5.5 * Pennsylvania 95.1 97.1 2.0 * Rhode Island 93.3 97.4 4.1 * South Carolina 81.8 93.6 11.8 * South Dakota 92.7 94.8 2.1 Tennessee 87.6 94.3 6.7 * Texas 89.0 94.8 5.8 * Utah 90.3 97.7 7.4 * Vermont 92.7 96.4 3.7 * Virginia 93.1 95.9 2.8 Washington 92.5 97.0 4.6 * West Virginia 88.1 94.9 6.8 * Wisconsin 94.8 96.3 1.5 Wyoming 89.7 93.8 4.1 * Total United States 91.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0399.pdf  
- March 1999 Change Alabama 87.9% 91.9% 4.0% * Alaska 83.8 94.9 11.2 * Arizona 88.8 92.8 4.0 Arkansas 88.2 88.9 0.8 California 91.7 94.7 3.0 * Colorado 94.4 95.9 1.6 Connecticut 95.5 94.9 -0.6 Delaware 95.0 98.2 3.1 District of Columbia 94.7 92.3 -2.4 Florida 85.5 92.6 7.1 * Georgia 88.9 92.3 3.4 Hawaii 94.6 95.6 1.0 Idaho 89.5 93.6 4.1 Illinois 95.0 91.2 -3.8 ** Indiana 90.3 93.8 3.4 * Iowa 95.4 96.1 0.7 Kansas 94.9 97.1 2.2 Kentucky 86.9 93.5 6.6 * Louisiana 88.9 90.3 1.4 Maine 90.7 97.5 6.8 * Maryland 96.3 96.8 0.5 Massachusetts 94.3 95.4 1.1 Michigan 93.8 94.0 0.2 Minnesota 96.4 95.9 -0.4 Mississippi 82.4 87.1 4.7 Missouri 92.1 94.6 2.5 Montana 92.8 95.4 2.7 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0700.pdf  
- 93 94 95 96 Month (March, July, November) Percent with Telephone N83M84J84N84M85J85N85M86J86N86M87J87N87M88J88N88M89J89N89M90J90N90M91J91N91M92J92N92M93J93N93M94J94N94M95J95N95M96J96N96M97J97N97M98J98N98M99J99N99M00J00 In Housing Unit Available Telephone Penetration Households 7 Table 2 Telephone Penetration by State (Percentage of Households with Telephone Service) State November 1983 July 2000 Change Alabama 87.9% 92.3% 4.4% * Alaska 83.8 91.9 8.1 * Arizona 88.8 93.8 5.1 * Arkansas 88.2 89.1 0.9 California 91.7 95.8 4.1 * Colorado 94.4 96.4 2.0 Connecticut 95.5 97.6 2.1 Delaware 95.0 96.2 1.2 District of Columbia 94.7 95.3 0.6 Florida 85.5 92.1 6.6 * Georgia 88.9 90.6 1.7 Hawaii 94.6 93.5 -1.1 Idaho 89.5 93.3 3.8 * Illinois 95.0 92.1 -2.9 ** Indiana 90.3 93.3 3.0 Iowa 95.4 95.3 -0.1 Kansas 94.9 96.6 1.7 Kentucky 86.9 93.7 6.8 * Louisiana 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0701.pdf  
- 96.3 95.5 -0.8 Massachusetts 94.3 95.7 1.4 Michigan 93.8 94.7 0.9 Minnesota 96.4 97.7 1.4 Mississippi 82.4 88.1 5.7 * Missouri 92.1 96.6 4.5 * Montana 92.8 94.8 2.0 Nebraska 94.0 96.5 2.5 * Nevada 89.4 95.2 5.8 * New Hampshire 95.0 97.8 2.8 * New Jersey 94.1 95.9 1.8 New Mexico 85.3 93.6 8.3 * New York 90.8 94.9 4.1 * North Carolina 89.3 93.9 4.6 * North Dakota 95.1 94.6 -0.5 Ohio 92.2 96.7 4.5 * Oklahoma 91.5 93.0 1.5 Oregon 91.2 96.2 5.0 * Pennsylvania 95.1 97.0 1.9 * Rhode Island 93.3 95.7 2.4 South Carolina 81.8 94.9 13.1 * South Dakota 92.7 94.9 2.2 Tennessee 87.6 93.2 5.6 * Texas 89.0 94.3 5.3 * Utah 90.3 96.5 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0704.pdf  
- Table 1 Household Telephone Subscribership in the United States 6 Chart 1 85 90 95 100 Month (March, July, November) Percent with Telephone N83 M84J84N84M85J85N85 M86J86N86 M87J87N87M88J88N88M89J89N89M90J90N90M91J91N91M92J92N92M93J93N93M94J94N94M95J95N95M96J96N96M97J97N97M98J98N98M99J99N99M00J00N00M01J01N01M02J02N02M03J03N03M04J04 In Housing Unit Available Telephone Penetration Households 7 Table 2 Telephone Penetration by State (Percentage of Households with Telephone Service) State Alabama 87.9% 91.4% 3.5% Alaska 83.8 94.5 10.7 * Arizona 88.8 92.8 4.1 * Arkansas 88.2 87.1 -1.0 California 91.7 95.8 4.1 * Colorado 94.4 95.0 0.6 Connecticut 95.5 94.3 -1.2 Delaware 95.0 96.3 1.2 District of Columbia 94.7 91.9 -2.8 Florida 85.5 93.3 7.8 * Georgia 88.9 90.8 1.9 Hawaii 94.6 96.9 2.3 Idaho 89.5 95.2 5.8 * Illinois 95.0 89.7 -5.3 Indiana 90.3 91.8 1.5 Iowa 95.4 95.0 -0.3 Kansas 94.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs0798.pdf  
- Households 6 Table 2 Telephone Penetration by State (Percentage of Households with Telephone Service) State November 1983 July 1998 Change Alabama 87.9% 93.2% 5.3% * Alaska 83.8 94.4 10.7 * Arizona 88.8 91.0 2.2 Arkansas 88.2 88.2 0.1 California 91.7 95.3 3.6 * Colorado 94.4 95.8 1.4 Connecticut 95.5 96.2 0.7 Delaware 95.0 96.8 1.8 District of Columbia 94.7 90.6 -4.1 ** Florida 85.5 92.2 6.7 * Georgia 88.9 92.2 3.3 Hawaii 94.6 96.1 1.5 Idaho 89.5 93.4 3.9 Illinois 95.0 93.3 -1.7 Indiana 90.3 94.5 4.2 * Iowa 95.4 97.3 1.9 Kansas 94.9 93.2 -1.7 Kentucky 86.9 93.6 6.7 * Louisiana 88.9 91.7 2.7 Maine 90.7 97.7 7.0 * Maryland 96.3 96.9 0.6 Massachusetts 94.3 94.0 -0.3 Michigan 93.8 95.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1101.pdf  
- J98 N98 M99 J99 N99 M00 J00 N00 M01 J01 N01 In Housing Unit Available Telephone Penetration Households 7 Table 2 Telephone Penetration by State (Annual Average Percentage of Households with Telephone Service) State 1984 2001 Change Alabama 88.4% 92.8% 4.3% * Alaska 86.5 96.0 9.5 * Arizona 86.9 94.5 7.5 * Arkansas 86.6 91.3 4.7 * California 92.5 96.6 4.1 * Colorado 93.2 96.7 3.5 * Connecticut 95.5 96.1 0.6 Delaware 94.3 96.2 2.0 * District of Columbia 94.9 94.5 -0.4 Florida 88.7 93.2 4.5 * Georgia 86.2 92.4 6.3 * Hawaii 93.5 95.7 2.2 * Idaho 90.7 94.5 3.8 * Illinois 94.2 92.5 -1.7 # Indiana 91.6 93.9 2.4 * Iowa 96.2 97.1 0.9 Kansas 94.3 94.2 -0.1 Kentucky 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1102.pdf  
- 97.8 3.4 * Connecticut 95.5 97.0 1.5 Delaware 95.0 96.8 1.8 District of Columbia 94.7 95.0 0.3 Florida 85.5 94.8 9.3 * Georgia 88.9 92.4 3.5 * Hawaii 94.6 96.9 2.3 Idaho 89.5 95.6 6.1 * Illinois 95.0 93.0 -2.0 Indiana 90.3 93.2 2.9 Iowa 95.4 97.1 1.7 Kansas 94.9 95.1 0.2 Kentucky 86.9 94.7 7.8 * Louisiana 88.9 93.0 4.1 * Maine 90.7 98.3 7.6 * Maryland 96.3 96.6 0.3 Massachusetts 94.3 96.7 2.4 * Michigan 93.8 93.2 -0.6 Minnesota 96.4 97.4 1.1 Mississippi 82.4 91.7 9.3 * Missouri 92.1 96.8 4.7 * Montana 92.8 93.2 0.4 Nebraska 94.0 95.8 1.8 Nevada 89.4 95.2 5.8 * New Hampshire 95.0 97.2 2.3 New Jersey 94.1 97.3 3.2 * New Mexico 85.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1103.pdf  
- Kansas 94.3 95.9 1.5 Kentucky 88.1 94.6 6.4 * Louisiana 89.7 93.2 3.5 * Maine 93.4 97.8 4.3 * Maryland 95.7 97.7 2.0 * Massachusetts 95.9 97.6 1.7 * Michigan 92.8 94.3 1.5 * Minnesota 95.8 96.9 1.0 Mississippi 82.4 91.7 9.3 * Missouri 91.5 95.9 4.4 * Montana 91.0 93.2 2.3 * Nebraska 95.7 96.0 0.3 Nevada 90.4 94.5 4.1 * New Hampshire 94.3 97.6 3.3 * New Jersey 94.8 96.3 1.5 * New Mexico 82.0 91.7 9.6 * New York 91.8 95.2 3.4 * North Carolina 88.3 94.1 5.8 * North Dakota 94.6 94.1 -0.5 Ohio 92.4 96.3 3.8 * Oklahoma 90.3 91.6 1.3 Oregon 90.6 96.5 5.9 * Pennsylvania 94.9 97.0 2.2 * Rhode Island 93.6 96.9 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1104.pdf  
- 3.8% * Alaska 86.5 95.6 9.1 * Arizona 86.9 91.8 4.9 * Arkansas 86.6 88.6 2.0 California 92.5 96.0 3.5 * Colorado 93.2 95.8 2.6 * Connecticut 95.5 95.5 0.0 Delaware 94.3 96.0 1.8 * District of Columbia 94.9 91.9 -3.0 # Florida 88.7 93.4 4.7 * Georgia 86.2 91.2 5.0 * Hawaii 93.5 95.4 1.8 * Idaho 90.7 94.8 4.1 * Illinois 94.2 90.1 -4.1 # Indiana 91.6 91.8 0.3 Iowa 96.2 95.4 -0.8 Kansas 94.3 94.8 0.4 Kentucky 88.1 91.4 3.3 * Louisiana 89.7 90.9 1.3 Maine 93.4 96.6 3.2 * Maryland 95.7 93.4 -2.3 # Massachusetts 95.9 96.4 0.5 Michigan 92.8 93.7 0.9 Minnesota 95.8 97.1 1.3 Mississippi 82.4 89.6 7.2 * Missouri 91.5 93.7 2.2 * Montana 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1196.pdf  
- North Carolina 88.3 93.5 5.2 * North Dakota 94.6 96.3 1.7 Ohio 92.4 94.5 2.1 * Oklahoma 90.3 91.3 1.1 Oregon 90.6 96.0 5.4 * Pennsylvania 94.9 96.9 2.1 * Rhode Island 93.6 95.7 2.1 * South Carolina 83.7 91.3 7.6 * South Dakota 93.2 93.3 0.1 Tennessee 88.5 94.0 5.5 * Texas 88.4 91.0 2.6 * Utah 92.5 96.7 4.1 * Vermont 92.3 95.9 3.7 * Virginia 93.1 94.9 1.8 Washington 93.0 94.5 1.5 West Virginia 87.7 92.9 5.2 * Wisconsin 95.2 97.0 1.8 Wyoming 89.9 95.0 5.2 * Total United States 91.6 93.9 2.3 * * Increase is statistically significant at the 95% confidence level. Details may not appear to add due to rounding. 7 Chart 2 Chart 2 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1197.pdf  
- Table 2 Telephone Penetration by State (Annual Average Percentage of Households with Telephone Service) State 1984 1997 Change Alabama 88.4% 92.3% 3.9% * Alaska 86.5 94.5 8.0 * Arizona 86.9 91.6 4.7 * Arkansas 86.6 89.8 3.2 California 92.5 94.3 1.8 * Colorado 93.2 95.9 2.6 * Connecticut 95.5 94.2 -1.3 Delaware 94.3 95.7 1.5 District of Columbia 94.9 90.8 -4.1 ** Florida 88.7 92.8 4.1 * Georgia 86.2 92.0 5.8 * Hawaii 93.5 94.5 0.9 Idaho 90.7 94.0 3.3 * Illinois 94.2 92.2 -2.0 ** Indiana 91.6 93.8 2.2 * Iowa 96.2 96.7 0.5 Kansas 94.3 94.0 -0.4 Kentucky 88.1 93.2 5.0 * Louisiana 89.7 91.0 1.4 Maine 93.4 96.1 2.7 * Maryland 95.7 95.7 0.0 Massachusetts 95.9 95.4 -0.5 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/subs1199.pdf  
- 90.7 93.8 3.1 * Illinois 94.2 91.8 -2.4 ** Indiana 91.6 93.8 2.3 * Iowa 96.2 95.8 -0.4 Kansas 94.3 93.8 -0.5 Kentucky 88.1 92.8 4.6 * Louisiana 89.7 91.5 1.9 Maine 93.4 97.2 3.8 * Maryland 95.7 95.3 -0.4 Massachusetts 95.9 95.4 -0.5 Michigan 92.8 94.2 1.3 Minnesota 95.8 96.9 1.1 Mississippi 82.4 88.0 5.6 * Missouri 91.5 95.6 4.1 * Montana 91.0 95.3 4.3 * Nebraska 95.7 95.9 0.2 Nevada 90.4 93.1 2.8 New Hampshire 94.3 97.0 2.7 * New Jersey 94.8 93.9 -0.8 New Mexico 82.0 89.8 7.8 * New York 91.8 95.3 3.5 * North Carolina 88.3 93.9 5.6 * North Dakota 94.6 97.3 2.6 * Ohio 92.4 94.7 2.3 * Oklahoma 90.3 91.2 0.9 Oregon 90.6 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev-98.pdf  
- Providers FCC 457 Line # IntrastateInterstate Total IntrastateInterstate Total IntrastateInterstate Total IntrastateInterstate Total Universal Service Worksheet Data: * Per-minute access $8,533.6$9,348.2$17,881.8 $320.2 $43.6 $363.8 * * $8,853.8$9,391.8$18,245.6 Other local service revenue 61,616.218,384.080,000.9 1,676.7 675.6 2,353.5 752.2 137.2 889.4 64,045.119,196.883,243.8 Local service revenue 70,149.827,732.197,882.7 1,996.9 719.2 2,717.3 752.2 137.2 889.4 72,898.928,588.5101,489.4 Mobile service revenue 427.6 1.1 428.7 35.1 3.0 38.2 462.7 4.1 466.9 Toll service revenue 9,039.6 363.2 9,402.1 312.1 918.1 1,228.9 133.9 16.7 150.7 9,485.6 1,298.010,781.7 Total telecommunications revenue 79,617.128,096.5107,713.6 2,344.1 1,640.3 3,984.4 886.1 154.0 1,040.1 82,847.329,890.8112,738.1 included on universal service worksheets TRS Worksheet Data (estimated): * Revenues reported by service providers that filed TRS worksheets but not universal service worksheets: Per-minute access 349.8 16.0 0.0 365.8 Other local service revenue 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev01.pdf  
- Regional Bell Operating Companies $3,513 $3,461 $3,408 $3,344 1.9% $3,365 $3,300 1.9% Other Incumbent Local Exchange Carriers (ILECs) 405 410 421 415 1.3 424 418 1.4 Total ILECs 3,918 3,871 3,829 3,759 1.8 3,788 3,718 1.9 Competitive Access Providers (CAPs) and Competitive Local Exchange Carriers (CLECs) 919 1,006 1,053 1,020 3.2 1,096 1,058 3.4 Local Resellers 52 57 59 56 4.1 61 58 4.5 Private Service Providers * 5 5 5 2.0 5 5 2.0 Shared-Tenant Service Providers 3 3 3 2 7.2 3 2 7.2 Other Local Service Providers 3 3 3 3 6.7 4 3 7.8 Total Local Competitors 977 1,074 1,122 1,086 3.2 1,167 1,127 3.5 Total Fixed Local Service Providers 4,895 4,945 4,951 4,845 2.2 4,956 4,844 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/telrev02.pdf  
- SMR Telephony Carriers Paging & Messaging Service Providers 40.5 226.6 32.4 29.9 -7.7 28.6 -4.2 Specialized Mobile Radio (SMR) Dispatch * 55.1 13.5 13.1 -2.6 12.7 -3.0 Wireless Data and Other Mobile Service Providers 1.1 18.2 11.1 10.5 -5.4 10.2 -2.6 Wireless Service Providers 1,301.1 22,008.1 5,090.6 5,306.6 4.2 5,149.8 -3.0 Interexchange Carriers (IXCs) 3,405.5 12,126.0 8,117.1 7,407.4 -8.7 7,100.8 -4.1 Operator Service Providers (OSPs) 9.9 121.0 47.1 42.8 -9.0 36.9 -13.8 Prepaid Calling Card Providers 5.6 164.0 143.4 146.4 2.1 145.8 -0.5 Satellite Service Providers 31.3 29.8 26.5 24.5 -7.5 24.4 -0.4 Toll Resellers 696.6 2,713.1 1,820.0 1,570.2 -13.7 1,471.3 -6.3 Other Toll Carriers 494.3 107.7 77.8 71.2 -8.5 64.7 -9.2 Toll Service Providers 4,643.2 15,261.5 10,232.0 9,262.6 -9.5 8,843.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend100.pdf  
- COMPLAINTS...........................................................................................................................3-1 TABLE 3.1 WRITTEN COMPLAINTS PROCESSED.......................................................................3-3 TABLE 3.2 COMPLAINT INDICES FOR IXCS SERVED 20 OR MORE COMPLAINTS......................3-4 TABLE 3.3 COMPLAINT INDICES FOR LECS SERVED 20 OR MORE COMPLAINTS.....................3-6 TABLE 3.4 BILLING AGENTS SERVED MORE THAN 20 COMPLAINTS.......................................3-6 TABLE 3.5 SLAMMING COMPLAINTS: INDICES FOR IXCS SERVED 40 OR MORE.....................3-7 TABLE 3.6 COMPANIES SERVED 20 OR MORE CRAMMING COMPLAINTS.................................3-9 CONSUMER EXPENDITURES..............................................................................................4-1 TABLE 4.1 HOUSEHOLD EXPENDITURES FOR TELEPHONE SERVICE.........................................4-3 CHART 4.1 MONTHLY TELEPHONE SERVICE EXPENDITURES...................................................4-3 TABLE 4.2 HOUSEHOLD TELECOMMUNICATIONS EXPENDITURES BY TYPE OF PROVIDER........4-4 EMPLOYMENT AND LABOR PRODUCTIVITY...............................................................5-1 TABLE 5.1 ANNUAL AVERAGE NUMBER OF EMPLOYEES IN THE TELEPHONE COMMUNICATIONS INDUSTRY.................................................................................5-3 CHART 5.1 ANNUAL AVERAGE NUMBER OF EMPLOYEES IN THE TELEPHONE COMMUNICATIONS INDUSTRY................................................................................5-3 TABLE 5.2 LABOR PRODUCTIVITY INDEX FOR THE TELEPHONE COMMUNICATIONS MEASURED IN OUTPUT 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend199.pdf  
- Table 2.1 Cellular Telephone Subscribers..........................2 - 3 Table 2.2 Cellular Telephone Service: Survey Results.................2 - 4 COMPLAINTS...................................................3 - 1 Table 3.1 Written Complaints Processed January 1, 1998 Through June 30, 1998............................................3 - 3 Table 3.2 Companies Served 40 or More Slamming Complaints..........3 - 4 Table 3.3 Companies Served 20 or More Cramming Complaints..........3 - 5 CONSUMER EXPENDITURES.......................................4 - 1 Table 4.1 Telephone Service Expenditures..........................4 - 3 EMPLOYMENT AND LABOR PRODUCTIVITY..........................5 - 1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry.............................5 - 3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour....................5 - 4 EQUAL ACCESS.................................................6 - 1 Table 6.1 Central Offices Converted to Equal Access..................6 - 3 INTERNATIONAL TELEPHONE SERVICE..............................7 - 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend200.pdf  
- Access Charges by Carrier......................................................1-8 Advanced Telecommunications....................................................................2-1 Table 2.1 High-Speed Lines.....................................................................................................2-3 Table 2.2 Advanced Services Lines..........................................................................................2-3 Table 2.3 Residential and Small Business High-Speed Lines......................................................2-3 Table 2.4 High-Speed Lines by Technology..............................................................................2-4 Consumer Expenditures...............................................................................3-1 Table 3.1 Household Expenditures for Telephone Service.........................................................3-3 Chart 3.1 Monthly Telephone Service Expenditures..................................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures for Local Exchange and Long Distance Carriers.................................................................3-4 Earnings.......................................................................................................4-1 Table 4.1 Interstate Rate of Return Summary............................................................................4-3 Employment and Labor Productivity...........................................................5-1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour.............................................................................5-4 Chart 5.2 Telephone Communications Industry (SIC 481) Labor Productivity Index..................5-4 Table 5.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend298.pdf  
- Results........................ 9 COMPLAINTS........................................................... 10 Table 3.1 Carriers Served with More Than 50 Complaints in 1997.............. 12 Table 3.2 Local Exchange Carriers Served with More Than 50 Complaints in 1997...................................................... 13 Table 3.3 Billing Agents Served with More Than 50 Complaints in 1997......... 13 Table 3.4 Other Companies Served with More Than 50 Complaints in 1997....... 14 CONSUMER EXPENDITURES............................................. 15 Table 4.1 Telephone Service Expenditures................................ 16 EMPLOYMENT.......................................................... 17 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry.................................... 18 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour.......................... 19 EQUAL ACCESS......................................................... 20 Table 6.1 Development of Equal Access.................................. 21 Table 6.2 Central Offices Converted to Equal Access........................ 22 INTERNATIONAL TELEPHONE SERVICE................................... 23 Table 7.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend299.pdf  
- Table 2.1 Cellular Telephone Subscribers..........................2 - 3 Table 2.2 Cellular Telephone Service: Survey Results.................2 - 4 COMPLAINTS...................................................3 - 1 Table 3.1 Written Complaints Processed January 1, 1998 Through June 30, 1998............................................3 - 3 Table 3.2 Companies Served 40 or More Slamming Complaints..........3 - 4 Table 3.3 Companies Served 20 or More Cramming Complaints..........3 - 5 CONSUMER EXPENDITURES.......................................4 - 1 Table 4.1 Telephone Service Expenditures..........................4 - 3 Chart 4.1 Monthly Telephone Service Expenditures...................4 - 3 EMPLOYMENT AND LABOR PRODUCTIVITY..........................5 - 1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry.............................5 - 3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry.............................5 - 3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend502.pdf  
- 2.1 High-Speed Lines..................................................................................................2-3 Table 2.2 Advanced Services Lines.......................................................................................2-3 Table 2.3 Residential and Small Business High-Speed Lines...............................................2-4 Table 2.4 Residential and Small Business Advanced Services Lines...................................2-4 Table 2.5 High-Speed Lines by Technology.........................................................................2-5 Consumer Expenditures......................................................................................3-1 Table 3.1 Household Expenditures for Telephone Service...................................................3-3 Chart 3.1 Monthly Telephone Service Expenditures.............................................................3-3 Table 3.2 Average Monthly Household Telecommunications To Local and Long Distance Providers..................................................................3-4 Earnings................................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary.......................................................................4-3 Employment and Labor Productivity................................................................5-1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry......................................................................................5-3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry......................................................................................5-3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour..................................................................5-4 Chart 5.2 Telephone Communications Industry (SIC 481) Labor Productivity Index..........5-4 Table 5.3 Number of 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend504.pdf  
- 2.8 Residential and Small Business Advanced Services Lines by Technology..........2-6 Table 2.5 High-Speed Lines by Technology as of June 30, 2003.........................................2-8 Table 2.6 High-Speed Lines by State....................................................................................2-9 Consumer Expenditures......................................................................................3-1 Table 3.1 Household Expenditures for Telephone Service...................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures By Type of Provider...............................................................................................3-4 Chart 3.1 Average Monthly Household Telecommunications Expenditures By Type of Provider...............................................................................................3-4 Earnings................................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary Years 1997 through 2003.............................4-3 Employment and Labor Productivity................................................................5-1 Table 5.1 Annual Average Number of Employees in the Telecommunications Industry.....5-3 Chart 5.1 Annual Average Number of Employees in the Telecommunications Industry.....5-3 Table 5.2 Labor Productivity Index for the Wired and Wireless Telecommunications Industry Measured in Output per Hour (OPH)....................5-4 Chart 5.2 Wired and Wireless Telecommunications Carriers (NAICS 5171 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend605.pdf  
- of U.S. Households with Computers, Internet Access, And High-Speed Access.....................................................................................2-10 Table 2.7 Percent of U.S. Households with Internet and High-Speed Access: Rural versus Urban...........................................................................................2-11 Chart 2.10 Percent of U.S. Households with Internet and High-Speed Access: Rural versus Urban...........................................................................................2-11 Consumer Expenditures......................................................................................3-1 Table 3.1 Household Expenditures for Telephone Service...................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures By Type of Provider.............................................................................................3-4 Earnings................................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary Years 1997 through 2003.............................4-3 Employment and Labor Productivity................................................................5-1 Table 5.1 Annual Average Number of Employees in the Telecommunications Industry.....5-3 Chart 5.1 Annual Average Number of Employees in the Telecommunications Industry.....5-3 Table 5.2 Labor Productivity Index for the Wired and Wireless ii Telecommunications Industry Measured in Output per Hour (OPH)...................5-4 Chart 5.2 Wired and Wireless Telecommunications Carriers (NAICS 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend801.pdf  
- 1.4 Interstate Per-Minute Access Charges by Carrier......................................................1-8 Advanced Telecommunications....................................................................2-1 Table 2.1 High-Speed Lines.....................................................................................................2-3 Table 2.2 Advanced Services Lines..........................................................................................2-3 Table 2.3 Residential and Small Business High-Speed Lines......................................................2-3 Table 2.4 High-Speed Lines by Technology..............................................................................2-4 Consumer Expenditures...............................................................................3-1 Table 3.1 Household Expenditures for Telephone Service.........................................................3-3 Chart 3.1 Monthly Telephone Service Expenditures..................................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures by Type of Provider.........................................................................................................3-4 Earnings.......................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary...........................................................................4-3 Employment and Labor Productivity...........................................................5-1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry................................................................................................5-3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour.............................................................................5-4 Chart 5.2 Telephone Communications Industry (SIC 481) Labor Productivity Index..................5-4 Table 5.3 Number of 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trend803.pdf  
- Residential and Small Business High-Speed Lines...............................................2-4 Table 2.4 Residential and Small Business Advanced Services Lines...................................2-4 Table 2.5 High-Speed Lines by Technology as of December 31, 2002................................2-5 Table 2.6 High-Speed Lines by State....................................................................................2-6 Consumer Expenditures......................................................................................3-1 Table 3.1 Household Expenditures for Telephone Service...................................................3-3 Chart 3.1 Monthly Telephone Service Expenditures.............................................................3-3 Table 3.2 Average Monthly Household Telecommunications Expenditures By Type of Provider...............................................................................................3-4 Earnings................................................................................................................4-1 Table 4.1 Interstate Rate-of-Return Summary.......................................................................4-3 Employment and Labor Productivity................................................................5-1 Table 5.1 Annual Average Number of Employees in the Telephone Communications Industry......................................................................................5-3 Chart 5.1 Annual Average Number of Employees in the Telephone Communications Industry.....................................................................................5-3 Table 5.2 Labor Productivity Index for the Telephone Communications Industry Measured in Output per Hour.................................................................5-4 Chart 5.2 Telephone Communications Industry (SIC 481) Labor Productivity Index..........5-4 Table 5.3 Number of 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trsrv-95.pdf  
- Intrastate Access $79.1 0.4 $7.7 0.0 $86.7 0.1 8.8 Total Access Revenues $79.1 0.4 $81.5 0.1 $160.6 0.2 50.8 Operator Service, Pay Telephone & Card $2,672.5 14.6 $6,842.8 11.7 $9,515.3 12.4 71.9 Non-Operator Switched Toll Service $12,989.8 70.7 $41,289.8 70.6 $54,279.6 70.6 76.1 Long Distance Private Line Service $1,644.0 9.0 $7,166.6 12.3 $8,810.5 11.5 81.3 All Other Long Distance $754.2 4.1 $3,059.6 5.2 $3,813.8 5.0 80.2 Total Toll Revenues $18,060.5 98.3 $58,358.8 99.8 $76,419.3 99.5 76.4 Total Carrier Revenue $18,366.8 100.0 $58,465.7 100.0 $76,832.5 100.0 76.1 Figures may not add due to rounding and amounts that have been withheld to preserve confidentiality of individual carrier data. Telecommunications Industry Table 6 Revenue: Interexchange Carriers (IXCs) (Dollar amounts shown in millions) TRS Fund 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trsrv-96.pdf  
- Percentage Change in Revenue From 1995 to 1996 (All Carriers Reporting Interstate Revenues) Intrastate Interstate Intrastate + Interstate Local Exchange Service 7.7% 84.2% 7.8% Local Private Line Service 23.1 2391.7 31.8 Cellular, PCS, Paging & Other Mobile 39.6 27.0 38.9 Other Local 0.3 7.2 1.1 Total Local Revenues 14.7 22.2 15.0 Interstate Access n.a. 5.2 5.4 Intrastate Access 4.2 n.a. 4.1 Total Access Revenues 5.0 5.1 5.1 Operator Service, Pay Telephone & Card 5.4 -6.2 -1.7 Non-operator Switched Toll Service 11.0 10.9 10.9 Long Distance Private Line Service 13.5 8.4 9.7 All Other Long Distance 57.1 51.4 52.8 Total Toll Revenues 12.0 10.8 11.2 Total Carrier Revenue 13.1 9.4 11.5 Telecommunications Industry Table 5 Revenue: Toll Carriers: IXCs, OSPs, Toll Resellers, 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/trsrv-97.pdf  
- Provider Category Local Mobile Toll Intrastate Interstate Total Local Mobile Toll Intrastate Interstate Total Regional Bell Operating Companies $68,992.8 $317.3 $7,547.2 $57,475.1 $19,382.4 $76,857.5 Other Incumbent Local Exchange $493.3 $0.5 $26.6 $512.7 $7.7 $520.4 25,354.6 273.6 2,668.1 20,601.2 7,695.0 28,296.2 Carriers (ILECs) All ILECs 493.3 0.5 26.6 512.7 7.7 520.4 94,347.4 590.9 10,215.3 78,076.2 27,077.3 105,153.5 Pay Telephone Service Providers 4.1 0.3 56.3 51.5 9.2 60.6 624.4 0.3 308.7 816.2 117.3 933.5 Competitive Access Providers (CAPs) and Competitive Local Exchange Carriers (CLECs) 48.6 0.8 48.6 0.8 49.4 1,580.9 2.2 335.9 1,303.0 616.0 1,919.0 Local Resellers 75.2 117.3 13.3 180.9 24.9 205.8 Private Carriers * * * 15.5 6.9 90.0 27.5 84.9 112.4 Shared Tenent Services Providers 30.1 * 56.9 38.1 48.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2000.pdf  
- 18.1 37 0.8 29 0.6 81 1.8 27 0.6 3,558 78.1 4,553 Ohio 16,305 39.5 1,013 2.5 1,551 3.8 1,057 2.6 533 1.3 20,862 50.5 41,321 Oklahoma 4,004 28.6 936 6.7 274 2.0 268 1.9 180 1.3 8,342 59.6 14,005 Oregon 6,110 45.1 112 0.8 191 1.4 343 2.5 179 1.3 6,617 48.8 13,552 Pennsylvania 17,518 35.8 705 1.4 1,988 4.1 805 1.6 240 0.5 27,692 56.6 48,948 Rhode Island 1,972 38.0 30 0.6 144 2.8 71 1.4 52 1.0 2,921 56.3 5,190 South Carolina 5,264 37.9 244 1.8 842 6.1 399 2.9 283 2.0 6,858 49.4 13,890 South Dakota 902 18.9 18 0.4 35 0.7 90 1.9 50 1.0 3,687 77.1 4,781 Tennessee 7,386 37.9 128 0.7 1,211 6.2 527 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2001.pdf  
- 1.6 832 4.4 273 1.5 7,773 41.5 18,722 Connecticut 5,549 38.7 884 6.2 122 0.9 318 2.2 177 1.2 7,278 50.8 14,328 Delaware 1,701 38.2 33 0.7 74 1.7 92 2.1 56 1.3 2,500 56.1 4,458 District of Columbia 2,916 56.0 61 1.2 406 7.8 224 4.3 35 0.7 1,561 30.0 5,204 Florida 28,914 45.7 2,954 4.7 920 1.5 2,605 4.1 927 1.5 26,892 42.5 63,212 Georgia 14,715 43.6 2,114 6.3 811 2.4 1,245 3.7 378 1.1 14,484 42.9 33,748 Guam 61 43.6 3 2.1 2 1.4 2 1.4 1 0.7 71 50.7 140 Hawaii 2,236 48.2 79 1.7 8 0.2 175 3.8 61 1.3 2,080 44.8 4,638 Idaho 2,134 37.8 17 0.3 44 0.8 125 2.2 92 1.6 3,239 57.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2002.pdf  
- 321 2.1 245 1.6 7,345 47.4 15,480 South Dakota 1,039 20.4 17 0.3 115 2.3 75 1.5 25 0.5 3,825 75.1 5,095 Tennessee 8,585 37.5 1,330 5.8 130 0.6 602 2.6 192 0.8 12,043 52.6 22,882 Texas 35,499 38.2 2,761 3.0 778 0.8 2,566 2.8 2,319 2.5 48,935 52.7 92,859 US Virgin Is. 129 44.2 10 3.4 30 10.3 12 4.1 2 0.7 109 37.3 292 Utah 4,630 44.6 46 0.4 91 0.9 341 3.3 96 0.9 5,166 49.8 10,370 Vermont 991 21.1 3 0.1 55 1.2 28 0.6 128 2.7 3,501 74.4 4,706 Virginia 14,096 51.3 161 0.6 446 1.6 700 2.5 235 0.9 11,822 43.1 27,460 Washington 9,986 43.5 620 2.7 318 1.4 659 2.9 267 1.2 11,117 48.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationdec2003.pdf  
- 4.4 Oregon 132 6,400 2.1 170 2,432 7.0 Pennsylvania 688 23,783 2.9 598 8,826 6.8 Puerto Rico 0 972 0.0 62 1,723 3.6 Rhode Island 41 2,010 2.0 73 853 8.6 South Carolina 51 5,045 1.0 129 2,804 4.6 South Dakota 0 0 NM 0 0 NM Tennessee 104 7,778 1.3 133 3,936 3.4 Texas 515 49,244 1.0 615 15,048 4.1 Utah 235 4,809 4.9 55 1,786 3.1 Vermont 47 1,094 4.3 55 258 21.3 Virgin Islands 0 0 NM 0 0 NM Virginia 478 14,064 3.4 603 6,589 9.2 Washington 213 13,376 1.6 158 5,072 3.1 West Virginia 46 1,330 3.5 33 885 3.7 Wisconsin 39 5,531 0.7 62 3,225 1.9 Wyoming 0 0 NM 0 0 NM 0 0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationjun2003.pdf  
- 4.2 New York 1,089 39,013 2.8 1,068 14,824 7.2 North Carolina 189 12,509 1.5 138 5,687 2.4 North Dakota 0 0 NM 0 0 NM Northern Marianas 0 0 NM 0 0 NM Ohio 104 14,141 0.7 86 8,337 1.0 Oklahoma 103 4,985 2.1 58 2,267 2.6 Oregon 127 7,307 1.7 68 2,770 2.5 Pennsylvania 512 26,502 1.9 384 9,313 4.1 Puerto Rico 0 60 0.0 0 21 0.0 Rhode Island 43 2,840 1.5 45 892 5.0 South Carolina 27 4,723 0.6 50 2,489 2.0 South Dakota 0 0 NM 0 0 NM Tennessee 43 4,928 0.9 60 2,420 2.5 Texas 350 39,882 0.9 262 12,515 2.1 Utah 122 5,209 2.3 14 1,782 0.8 Vermont 32 1,266 2.5 41 314 13.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/IAD/utilizationjun2004.pdf  
- 2,670 2.7 95 890 10.7 South Carolina 72 5,970 1.2 204 3,482 5.9 South Dakota 3 420 0.7 1 229 0.4 Tennessee 202 8,321 2.4 199 4,682 4.3 Texas 1,019 43,418 2.3 1,094 16,750 6.5 Utah 199 4,982 4.0 84 1,966 4.3 Vermont 55 1,825 3.0 68 305 22.3 Virgin Islands 0 0 NM 0 0 NM Virginia 587 14,260 4.1 680 6,112 11.1 Washington 246 12,818 1.9 264 5,289 5.0 West Virginia 107 2,076 5.2 58 1,059 5.5 Wisconsin 96 7,275 1.3 85 3,173 2.7 Wyoming 2 344 0.6 4 265 1.5 0 0 Totals 16,774 550,121 3.0% 21,158 246,541 8.6% Source: Pooling data provided by NeuStar. Numbering Resource Utilization/Forecast forms filed with NeuStar, Inc. as of October 10, 2004. 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-96.pdf  
- Total Percent share by carrier revenues 1 2 3 4 Other from PTT 1 2 3 4 Other from PTT 1 2 3 4 Other Minutes 1 2 3 4 Other Andorra $312,27236.018.938.7 0.0 6.3 $30,08598.6 0.0 0.0 0.0 1.4 $0 614,06938.816.930.8 0.013.4 Austria $41,084,18166.218.313.9 0.2 1.3 $6,702,12940.433.326.3 0.0 0.1 $640,568100.0 0.0 0.0 0.0 0.0 78,468,44845.025.926.2 0.3 2.6 Belgium $84,981,48261.321.112.9 4.1 0.6 $12,973,51748.128.917.2 5.8 0.0 $2,428,36766.925.5 2.3 0.0 5.3 156,690,80745.726.319.8 6.7 1.5 Cyprus $8,653,92663.423.110.3 0.0 3.2 $3,220,36954.932.113.0 0.0 0.0 $607,35457.935.3 6.8 0.0 0.0 13,638,36254.328.213.9 0.0 3.6 Denmark $43,009,23157.722.511.1 7.9 0.8 $7,370,74149.925.517.4 7.2 0.0 $986,36135.854.010.2 0.0 0.0 88,916,02842.323.620.611.8 1.8 Finland $22,523,77570.816.9 9.2 2.2 0.9 $4,512,42650.923.622.3 3.1 0.0 $255,67151.020.414.5 0.014.1 43,682,36350.124.119.4 4.3 2.1 France $274,284,44462.121.310.8 5.1 0.7 $40,499,39245.332.414.8 6.3 1.2 $5,378,68167.824.9 7.4 0.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-97.pdf  
- 344,298,76934.918.311.810.025.1 Turkey $66,287,94762.426.4 8.1 1.8 1.3 $12,257,34764.222.813.0 0.0 0.0 $816,32214.985.1 0.0 0.0 0.0 87,517,98659.823.810.9 3.0 2.5 United Kingdom $761,409,94558.628.0 8.8 1.7 2.8 $161,271,28049.718.612.1 9.510.1 $26,459,08150.224.7 6.7 0.018.4 2,499,834,10650.321.512.4 7.4 8.4 Western Europe $2,943,131,80358.727.4 8.2 2.6 3.1 $410,785,68047.620.512.311.9 7.6 $87,930,90659.518.0 5.0 0.017.4 7,468,744,28046.223.511.8 8.510.0 Algeria $6,352,69862.126.2 2.0 6.6 3.1 $2,813,44753.646.4 0.0 0.0 0.0 $635,70195.3 4.7 0.0 0.0 0.0 9,098,63159.128.1 1.6 7.2 4.1 Angola $3,096,65359.321.2 8.4 3.2 7.9 $577,543100.0 0.0 0.0 0.0 0.0 $255,219100.0 0.0 0.0 0.0 0.0 3,122,53263.212.0 6.4 4.414.0 Benin $3,849,32240.719.429.4 6.7 3.7 $174,79253.446.6 0.0 0.0 0.0 $454100.0 0.0 0.0 0.0 0.0 4,658,93234.524.125.511.3 4.6 Botswana $1,804,39363.226.2 9.1 0.1 1.5 $420,58399.9 0.0 0.0 0.0 0.1 $39,586100.0 0.0 0.0 0.0 0.0 2,689,90776.915.0 5.7 0.1 2.2 Burkina $2,165,33642.634.8 8.1 1.413.2 $131,00153.446.6 0.0 0.0 0.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-98.pdf  
- 9.714.9 Mexico $1,796,297,90550.8 0.237.1 8.8 3.1 $424,595,81051.8 0.038.2 9.8 0.2 $9,856,88367.0 0.026.4 6.2 0.4 4,106,881,65048.1 0.336.3 9.2 6.2 Nicaragua $57,461,07658.4 1.027.211.0 2.5 $3,454,89656.5 0.034.2 8.8 0.5 $751,10777.1 0.021.4 1.2 0.3 70,557,39953.5 2.028.910.4 5.2 Panama $62,393,86160.2 0.728.5 8.7 2.0 $10,837,01949.2 0.040.6 8.9 1.2 $653,68176.3 0.019.2 4.3 0.2 88,526,03147.4 1.039.6 9.5 2.5 Saint Pierre and Miquelon $359,206 0.1 0.0 1.7 0.098.1 $169 4.1 0.034.3 0.061.5 $61 0.0 0.0100.0 0.0 0.0 624,432 0.1 0.0 0.6 0.099.4 Alaska $23,813 0.0 0.014.9 0.085.1 $8,630 0.0 0.0100.0 0.0 0.0 $0 147,468 0.0 0.026.1 0.073.9 United States (conterminous) $10,923,378 0.0 0.011.542.446.1 $2,365,059 0.0 0.086.6 0.013.4 $265,062 0.0 0.0100.0 0.0 0.0 74,698,171 0.0 0.027.240.032.8 North and Central America $3,612,220,42453.5 0.333.8 9.4 3.0 $674,553,37650.6 0.033.815.2 0.4 $30,380,39277.8 0.019.1 2.7 0.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f00.pdf  
- from PTT 1 2 3 4 Other from PTT 1 2 3 4 Other Minutes 1 2 3 4 Other Andorra $23,00022.0 9.5 2.932.033.7 $2,875 0.0 0.0 0.0 0.0100.0 $422100.0 0.0 0.0 0.0 0.0 139,406 9.1 4.0 0.917.069.1 Austria $36,032,41453.630.9 0.511.9 3.1 $1,546,07223.322.4 0.015.538.7 $580,35623.275.6 0.0 1.2 0.0 103,818,17331.131.7 0.623.712.9 Belgium $49,284,25243.935.4 0.615.9 4.3 $3,106,97536.248.4 0.0 7.9 7.5 $914,20185.410.5 0.0 4.1 0.0 134,674,21329.132.1 0.420.717.8 Cyprus $8,885,34943.244.0 2.5 8.4 1.9 $574,31628.152.3 0.012.7 6.9 $169,86594.4 2.7 0.0 2.8 0.0 21,005,07734.138.8 1.916.8 8.4 Denmark $31,775,42551.731.9 0.4 7.6 8.4 $2,408,84133.925.3 0.010.030.8 $332,50287.211.0 0.0 1.8 0.0 97,723,96834.131.7 0.410.023.9 Finland $14,471,46643.043.6 0.212.3 0.9 $1,674,26749.433.3 0.012.2 5.0 $248,70166.524.4 0.0 9.1 0.0 40,752,76237.635.8 0.219.4 7.0 France $222,125,50753.227.1 0.511.9 7.3 $13,915,86251.723.5 0.012.412.3 $7,669,11178.016.9 0.0 5.0 0.0 783,604,44936.624.1 0.415.023.9 Germany $410,439,31965.817.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f01.pdf  
- 88,362,036 0.024.622.739.313.4 Finland $18,453,473 0.057.415.724.2 2.7 $1,417,570 0.026.712.155.1 6.2 $88,923 0.066.4 4.828.7 0.0 72,847,849 0.033.230.127.8 8.9 France $239,196,022 0.057.315.314.213.2 $10,038,799 0.025.512.945.416.2 $2,827,276 0.040.3 5.254.5 0.0 957,070,000 0.031.518.326.823.4 Germany $340,287,887 0.074.912.3 7.8 5.0 $16,293,146 0.031.322.434.411.9 $711,846 0.051.6 2.445.3 0.7 1,364,023,805 0.048.615.723.612.0 Gibraltar $411,262 0.076.310.011.1 2.5 $47,681 0.063.0 0.0 0.037.0 $32,220 0.0100.0 0.0 0.0 0.0 1,394,007 0.042.721.6 5.030.7 Greece $64,683,100 0.061.5 8.326.1 4.1 $3,910,890 0.015.7 6.361.416.6 $275,751 0.044.2 3.950.7 1.2 307,405,103 0.050.2 9.229.211.5 Greenland $51,318 0.0 8.920.354.516.2 $2,110 0.0 0.0 0.0 0.0100.0 $895 0.0 0.6 0.0 0.099.4 170,161 0.0 5.816.945.531.9 Iceland $4,516,315 0.068.114.315.8 1.8 $653,440 0.015.432.847.9 3.9 $121,625 0.089.4 1.8 8.8 0.0 26,398,499 0.039.431.025.3 4.2 Ireland $57,848,166 0.065.012.619.8 2.5 $4,911,711 0.031.8 9.314.244.7 $236,286 0.050.4 4.342.6 2.8 277,384,656 0.032.414.738.114.8 Italy $231,055,002 0.045.115.436.5 3.0 $6,260,094 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f02.pdf  
- 0.153.3 9.5 $16,991,03813.4 0.2 0.3 1.584.5 627,313,01534.710.0 2.841.910.6 Norway $21,921,39937.210.7 0.428.223.5 $1,147,89142.232.0 0.025.4 0.4 $72,439 0.0 6.279.912.6 1.3 139,693,80027.414.7 1.126.830.0 Portugal $32,218,96771.2 2.8 2.917.8 5.3 $892,94347.6 7.9 0.044.5 0.0 $346,87146.515.537.7 0.3 0.0 156,426,61151.0 2.0 6.324.616.2 Spain $87,156,58029.419.1 4.021.326.2 $4,290,19029.4 8.2 0.114.248.1 $27,227,803 0.5 3.1 0.5 0.395.6 511,822,71530.720.6 5.520.422.9 Sweden $48,400,31161.014.2 0.321.2 3.3 $6,176,23134.528.8 0.036.7 0.0 $65,27329.110.457.1 1.1 2.2 380,860,20830.419.9 0.844.7 4.1 Switzerland $48,065,94657.016.5 0.521.6 4.4 $2,835,82739.416.8 0.043.5 0.3 $841,56363.3 3.5 7.411.714.1 395,645,84130.411.2 1.253.4 3.8 Turkey $51,736,82639.818.4 0.634.1 7.1 $629,80343.218.9 0.036.8 1.1 $344,67163.735.8 0.4 0.1 0.0 263,422,32223.218.1 0.948.0 9.8 United Kingdom $423,949,28957.418.5 1.219.2 3.7 $55,181,83341.015.8 0.135.5 7.5 $116,993,965 2.0 0.0 0.4 0.197.6 3,549,661,26732.114.3 2.540.810.3 Western Europe $1,650,515,03555.415.4 1.122.6 5.5 $124,720,83741.617.7 0.134.2 6.4 $202,838,460 5.3 0.8 1.0 0.892.1 11,071,344,04334.016.4 2.435.911.3 Algeria $7,687,14973.3 7.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/4361-f99.pdf  
- 6.176.6 $1 0.0 0.0 0.0 0.0100.0 $0 254,522 1.0 0.019.3 8.171.6 Luxembourg $9,730,32459.325.412.5 0.4 2.4 $982,75148.627.923.4 0.0 0.0 $233,32313.6 2.783.7 0.0 0.0 24,232,17841.021.330.1 1.8 5.8 Malta $3,925,84470.624.6 1.1 0.9 2.8 $263,98661.937.8 0.0 0.0 0.3 $44,59698.6 1.4 0.0 0.0 0.0 10,368,36377.613.7 1.3 2.6 4.7 Netherlands $134,875,08347.432.710.0 1.1 8.7 $8,722,62239.141.0 7.8 0.311.8 $18,831,74271.6 2.4 0.025.9 0.0 444,997,06334.528.710.5 5.920.4 Norway $39,040,51955.732.4 7.1 0.7 4.1 $3,593,67040.631.6 7.5 0.020.3 $2,381,09597.5 0.3 2.2 0.0 0.0 122,907,95540.030.5 8.7 3.916.9 Portugal $53,472,82851.136.1 7.7 0.6 4.4 $2,906,64853.029.017.8 0.0 0.2 $891,44365.034.3 0.7 0.0 0.0 106,664,11948.126.916.7 1.9 6.4 Spain $207,169,79348.537.4 7.1 0.4 6.5 $8,703,95547.523.710.6 0.018.2 $4,138,05994.9 4.6 0.5 0.0 0.0 414,251,58138.827.514.6 1.717.4 Sweden $68,631,92258.427.5 8.3 1.2 4.5 $7,533,59226.235.311.2 0.227.1 $13,587,11526.1 1.8 0.072.0 0.0 318,637,46033.232.810.5 5.717.9 Switzerland $102,743,85661.525.4 8.8 1.5 2.8 $10,128,47839.843.111.6 0.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/crepor03.pdf  
- 27.0 49.9 2.6 $0 $0 600,560 11.9 0.9 49.4 35.4 2.4 Iceland $5,869,402 72.6 1.0 21.6 3.1 1.8 $574,093 53.1 0.0 23.9 23.0 0.0 $24,025 0.0 0.0 20.3 79.7 0.0 28,161,329 50.3 1.5 26.5 16.5 5.1 Ireland $59,790,898 45.3 5.1 13.9 34.3 1.4 $3,157,046 64.9 2.2 22.0 10.6 0.2 $1,060,832 0.1 99.5 0.4 0.1 0.0 393,513,974 32.3 15.2 20.1 28.3 4.1 Italy $196,009,374 65.1 1.5 16.9 13.9 2.6 $6,350,304 50.6 0.2 20.5 27.6 1.1 $11,130,708 3.9 93.7 0.0 2.4 0.0 965,784,266 33.4 2.5 19.8 27.7 16.7 Liechtenstein $471,637 23.9 1.5 6.8 59.2 8.7 $0 $0 7,270,691 8.2 1.6 59.0 21.2 10.0 Luxembourg $5,118,046 69.1 1.2 15.5 12.6 1.7 $225,587 56.1 0.0 20.4 22.6 0.8 $74,766 1.8 0.0 0.8 97.4 0.0 33,435,294 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itltrd98.pdf  
- 1995 Table 1. International and Domestic Toll Service Revenues, 1950 to 1996 (Revenue in millions) Total International Service 1/ International Private Line Resale Total Total Total as % of Telephone Telex Telegraph TelephoneRecord Miscellaneous 2/ International Domestic Toll 3/ Total Toll 1950 $9.0 $39.3 $0.2 $1.1 $49.5 $1,195 $1,245 4.0 % 1951 12.1 $0.2 $42.6 0.3 1.9 57.2 1,346 1,403 4.1 1952 15.4 0.4 41.3 0.3 2.8 60.3 1,475 1,535 3.9 1953 13.1 0.7 42.5 0.3 3.7 60.2 1,582 1,642 3.7 1954 13.7 0.8 45.0 0.2 4.3 64.0 1,732 1,796 3.6 1955 15.7 1.2 46.6 0.2 4.8 68.6 1,980 2,049 3.3 1956 18.7 1.9 49.8 0.3 5.3 76.0 2,201 2,277 3.3 1957 22.7 2.8 50.3 0.6 6.0 82.4 2,443 2,525 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itltrd99.pdf  
- Data Table 1. International and Domestic Toll Service Revenues, 1950 to 1997 (Revenue in millions) Total International Service 1/ International Private Line Resale Total Total Total as % of Telephone Telex Telegraph TelephoneRecord Miscellaneous 2/ International Domestic Toll 3/ Total Toll 1950 $9.0 $39.3 $0.2 $1.1 $49.5 $1,195 $1,245 4.0 % 1951 12.1 $0.2 $42.6 0.3 1.9 57.2 1,346 1,403 4.1 1952 15.4 0.4 41.3 0.3 2.8 60.3 1,475 1,535 3.9 1953 13.1 0.7 42.5 0.3 3.7 60.2 1,582 1,642 3.7 1954 13.7 0.8 45.0 0.2 4.3 64.0 1,732 1,796 3.6 1955 15.7 1.2 46.6 0.2 4.8 68.6 1,980 2,049 3.3 1956 18.7 1.9 49.8 0.3 5.3 76.0 2,201 2,277 3.3 1957 22.7 2.8 50.3 0.6 6.0 82.4 2,443 2,525 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itrnd00.pdf  
- Service Revenues (Revenue Amounts Shown in Millions) International Service Domestic Total Toll International Revenues 1/ Service Revenues 3/ as % of Revenues Total Toll Revenues Telephone Private Line Miscellaneous Total Facilities-Based, Pure Telephone Record Telex TelegraphOther Facilities-Resale, Resale and ISR 2/ 1950 $9.0 $0.2 $1.1 $39.3 $49.5 $1,195 $1,245 4.0 % 1951 12.1 0.3 1.9 $0.2 42.6 57.2 1,346 1,403 4.1 1952 15.4 0.3 2.8 0.4 41.3 60.3 1,475 1,535 3.9 1953 13.1 0.3 3.7 0.7 42.5 60.2 1,582 1,642 3.7 1954 13.7 0.2 4.3 0.8 45.0 64.0 1,732 1,796 3.6 1955 15.7 0.2 4.8 1.2 46.6 68.6 1,980 2,049 3.3 1956 18.7 0.3 5.3 1.9 49.8 76.0 2,201 2,277 3.3 1957 22.7 0.6 6.0 2.8 50.3 82.4 2,443 2,525 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Intl/itrnd01.pdf  
- Miscellaneous Total International Total Toll Facilities- Based, Facilities- Pure Telephone Record TelexTelegraphOther End Carrier's End Carrier's EndCarrier's Resale, and Resale User Carrier & User Carrier & UserCarrier & ISR 3/ 3/ 4/ End User 4/ End User 4/ End User 4/ 1950 $9.0 $0.2 $1.1 $39.3 $49.5 $49.5 $1,245 4.0 % 1951 12.1 0.3 1.9 $0.2 42.6 54.9 57.2 1,403 4.1 1952 15.4 0.3 2.8 0.4 41.3 57.2 60.3 1,535 3.9 1953 13.1 0.3 3.7 0.7 42.5 56.2 60.2 1,642 3.7 1954 13.7 0.2 4.3 0.8 45.0 59.5 64.0 1,796 3.6 1955 15.7 0.2 4.8 1.2 46.6 63.6 68.6 2,049 3.3 1956 18.7 0.3 5.3 1.9 49.8 70.4 76.0 2,277 3.3 1957 22.7 0.6 6.0 2.8 50.3 75.8 82.4 2,525 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/m96-indx.pdf  
- Terminating Non-Premium ....................... Table 4.12 3 Index of Tables and Charts Minutes of Use - Interstate Access - Terminating Premium ............................... Table 4.9 Minutes of Use - Interstate Access - Tier 1 ........................................................ Table 4.2 Minutes of Use - Interstate Access - Total - Annual .......................................... Table 4.14 Minutes of Use - Interstate Access - Total - Monthly ........................................ Table 4.1 Minutes of Use - Interstate Access - Total - Quarterly ....................................... Table 4.4 Minutes of Use - Interstate Access - Total Non-Premium .................................. Table 4.13 Minutes of Use - Interstate Access - Total Premium .......................................... Table 4.10 Non-operating Items - Total ................................................................................ Table 6.10 Non-Traffic Sensitive Revenue Requirement - Unseparated - by Company ....... Table 3.11 Non-Traffic Sensitive Revenue Requirement 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-4.pdf  
- letter. The remaining 2,666 applications represent potentially fundable applications. USAC also reports that it informed 1,384 that their funding commitment letters would be delayed pending further review and investigation, including site visits in some cases, because of concerns regarding certain aspects of their applications.7 As of May 29, 2003, USAC had committed $2.182 billion, and disbursed over 3 See Tables 4.1 and 4.2 for details. 4 Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2003, at 26. 5 Universal Service Administrative Company, Federal Universal Service Support Mechanisms Fund Size Projections for the Third Quarter 2003, at 26. 6 See Tables 4.1 and 4.2 for details. 7 Universal Service Administrative Company, Federal Universal Service 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-6.pdf  
- Carolina 88.3 94.3 6.0 * North Dakota 94.6 94.9 0.2 Ohio 92.4 95.9 3.5 * Oklahoma 90.3 93.1 2.9 * Oregon 90.6 97.2 6.6 * Pennsylvania 94.9 98.0 3.2 * Rhode Island 93.6 96.1 2.4 * South Carolina 83.7 94.3 10.6 * South Dakota 93.2 95.1 1.9 Tennessee 88.5 93.6 5.1 * Texas 88.4 94.2 5.8 * Utah 92.5 96.7 4.1 * Vermont 92.3 97.6 5.4 * Virginia 93.1 96.2 3.1 * Washington 93.0 96.4 3.4 * West Virginia 87.7 94.5 6.8 * Wisconsin 95.2 96.1 0.9 Wyoming 89.9 94.0 4.2 * Total United States 91.6 95.3 3.7 * * Increase is statistically significant at the 95% confidence level. # Decrease is statistically significant at the 95% confidence level. Differences may 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-7.pdf  
- 11. 1936 - 2002 1990 - 2002 CPI All Items 4.0% 2.5% CPI All Services 4.4 3.4 CPI Telephone Services ** 1.9 0.8 CPI Major Categories: - Food & Beverages * 2.4 - Housing * 2.8 - Apparel 2.7 -0.3 - Transportation 3.7 1.6 - Medical Care 5.2 4.6 - Recreation *** * 1.7 - Other Goods & Services * 4.1 CPI Public Transportation 4.9 2.3 CPI Utility Natural Gas Service 3.8 3.2 CPI Electricity 2.3 1.2 CPI Sewer & Water Maintenance * 4.0 CPI Postage 4.2 3.6 Note:All figures represent average annual rates of change in the December index values. ****** Source: Bureau of Labor Statistics. Chart 7.1 The CPI telephone service index was revised in December of 1997. Series 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-9.pdf  
- Event in Thousands 766.9 218.7 644.9 171.9 2,900.1 483.1 163.6 859.8 1,896.0 Outage Line-Minutes per 1,000 Access Lines 1,102.5 585.7 841.9 79.7 2,085.8 720.1 99.5 2,137.6 16,925.4 For Scheduled Downtime More Than 2 Minutes Number of Occurrences or Events 4 51 58 0 7 3 3 1 64 Events per Hundred Switches 0.2 3.8 4.0 0.0 0.4 0.2 0.2 0.0 4.1 Events per Million Access Lines 0.17 3.25 3.03 0.00 0.46 0.17 0.14 0.06 8.05 Average Outage Duration in Minutes 5.1 4.0 24.8 NA 14.3 10.7 2.3 NA 32.4 Avg. Lines Affected per Event in Thousands 8.5 11.2 18.5 NA 52.3 20.8 23.6 NA 9.9 Outage Line-Minutes per Event in Thousands 28.1 53.3 539.9 NA 243.6 203.9 55.6 NA 364.7 Outage 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr03-intro.pdf  
- by State ................................... Table 5.3 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care - Service Speeds Acquired .............................................. Table 5.2 Safety Net Additive Support Payment Projections by Jurisdiction .................... Table 3.9 Safety Net Additive Support Payment Projections by Study Area ..................... Table 3.24 Schools and Libraries Commitments & Disbursements by State & Applicant Type Table 4.1 Schools and Libraries Commitments & Disbursements by State & Service Type ...Table 4.2 Schools and Libraries Commitments per Student ......................................... Table 4.4 Schools and Libraries Disbursements by Service Provider Type .......................... Table 4.3 Schools and Libraries Disbursements per Student ........................................Table 4.5 5 Index of Tables and Charts State Code Reference ............................................................................................... Table 8.13 Subscribership on American Indian Reservations and Trust 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-4.pdf  
- One funds (telecommunications services and Internet access) have been requested. It also estimates that Priority Two requests falling within the 90 percent discount level total $1.3 billion. USAC supplies the Commission with funding commitments and disbursements information for the Schools and Libraries mechanism for all active funding years. USAC provided the Commission with data as of May 6, 2004. Table 4.1 summarizes commitments and disbursements by applicant type and by service type for each funding year. Because of the appeals process, funding commitments and disbursements can be made after the end of the program year. Also, disbursements may continue beyond the end of the program year in the event of delayed internal connections installation. Thus, disbursements for the two most recent 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-6.pdf  
- Kansas 94.3 95.9 1.5 Kentucky 88.1 94.6 6.4 * Louisiana 89.7 93.2 3.5 * Maine 93.4 97.8 4.3 * Maryland 95.7 97.7 2.0 * Massachusetts 95.9 97.6 1.7 * Michigan 92.8 94.3 1.5 * Minnesota 95.8 96.9 1.0 Mississippi 82.4 91.7 9.3 * Missouri 91.5 95.9 4.4 * Montana 91.0 93.2 2.3 * Nebraska 95.7 96.0 0.3 Nevada 90.4 94.5 4.1 * New Hampshire 94.3 97.6 3.3 * New Jersey 94.8 96.3 1.5 * New Mexico 82.0 91.7 9.6 * New York 91.8 95.2 3.4 * North Carolina 88.3 94.1 5.8 * North Dakota 94.6 94.1 -0.5 Ohio 92.4 96.3 3.8 * Oklahoma 90.3 91.6 1.3 Oregon 90.6 96.5 5.9 * Pennsylvania 94.9 97.0 2.2 * Rhode Island 93.6 96.9 3.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-7.pdf  
- 80.0 100.0 120.0 140.0 160.0 180.0 200.0 1923 1928 1933 1938 19431948 1953 1958 1963 1968 1973 19781983 1988 1993 1998 2003 CPI All Items CPI Telephone Services 7 - 6 1978 5.6% 9.0% 0.9% 1979 3.2 13.3 0.7 1980 -0.2 12.5 4.6 1981 2.5 8.9 11.7 1982 -1.9 3.8 7.2 1983 4.5 3.8 3.6 1984 7.2 3.9 9.2 1985 4.1 3.8 4.7 1986 3.5 1.1 2.7 1987 3.4 4.4 -1.3 1988 4.1 4.4 1.3 1989 3.5 4.6 -0.3 1990 1.9 6.1 -0.4 1991 -0.2 3.1 3.5 1992 3.3 2.9 -0.3 1993 2.7 2.7 1.8 1994 4.0 2.7 0.7 1995 2.5 2.5 1.2 1996 3.7 3.3 2.1 1997 4.5 1.7 0.2 1998 4.2 1.6 0.3* 1999 4.5 2.7 0.4 2000 3.7 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr04-intro.pdf  
- Rural Health Care Funding Commitments and Disbursements by State .................. Table 5.2 Rural Health Care Funding Disbursements by Funding Year .............................. Table 5.1 Safety Net Additive Support Payment Projections by State or Jurisdiction ........... Table 3.7 Safety Net Additive Support Payment Projections by Study Area ..................... Table 3.23 Schools & Libraries Commitments & Disbursements by Applicant & Service Type Table 4.1 Schools & Libraries Commitments & Disbursements by State & Applicant Type .. Table 4.2 Schools & Libraries Commitments & Disbursements by State & Service Type .....Table 4.3 Schools & Libraries Commitments & Disbursements per Student by State ..........Table 4.5 Schools & Libraries Commitments per Student ........................................... Table 4.6 Schools & Libraries Disbursements by Service Provider Type .............................Table 4.4 Schools & 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-0.pdf  
- of Use - Interstate Access - Terminating Non-Premium ....................... Table 4.12 Minutes of Use - Interstate Access - Terminating Premium ............................... Table 4.9 Minutes of Use - Interstate Access - Tier 1 ........................................................ Table 4.2 Minutes of Use - Interstate Access - Total - Annual .......................................... Table 4.14 Minutes of Use - Interstate Access - Total - Monthly ........................................ Table 4.1 Minutes of Use - Interstate Access - Total - Quarterly ....................................... Table 4.4 Minutes of Use - Interstate Access - Total Non-Premium .................................. Table 4.13 Minutes of Use - Interstate Access - Total Premium .......................................... Table 4.10 Non-operating Items - Total ................................................................................ Table 6.10 Non-Traffic Sensitive Revenue Requirement - Unseparated - by Company ....... Table 3.11 Non-Traffic Sensitive Revenue Requirement 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-1.pdf  
- North Carolina 88.3 93.5 5.2 * North Dakota 94.6 96.3 1.7 Ohio 92.4 94.5 2.1 * Oklahoma 90.3 91.3 1.1 Oregon 90.6 96.0 5.4 * Pennsylvania 94.9 96.9 2.1 * Rhode Island 93.6 95.7 2.1 * South Carolina 83.7 91.3 7.6 * South Dakota 93.2 93.3 0.1 Tennessee 88.5 94.0 5.5 * Texas 88.4 91.0 2.6 * Utah 92.5 96.7 4.1 * Vermont 92.3 95.9 3.7 * Virginia 93.1 94.9 1.8 Washington 93.0 94.5 1.5 West Virginia 87.7 92.9 5.2 * Wisconsin 95.2 97.0 1.8 Wyoming 89.9 95.0 5.2 * Total United States 91.6 93.9 2.3 * * Increase is statistically significant at the 95% confidence level. Changes may not appear to be the same as calculated differences due to rounding. 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr97-4.pdf  
- presubscribed lines by study area. The data reported in this section include new data for 1995 and revisions of the data that were contained in our previous reports. This report includes monthly data on switched interstate telephone traffic as reflected in the NECA calculations of carrier common line (CCL) access minutes of use from January 1994 through December 1996. Table 4.1 shows the latest available figures on minutes of use for interstate traffic for the total industry as reported by NECA, derived from the Common Line earned revenues. Tables 4.2 and 4.3 show the figures for large (Tier 1) and small (non-Tier 1) companies, respectively. These 1 figures do not include the minutes from the closed end of WATS or 800/888 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-1.pdf  
- Revised 10/22/98 Data filed on TRS worksheets All Telecommunications Service Providers ** by Carriers that did not also file USF worksheets (Gross Revenue) Local Mobile TollIntrastateInterstate Total Local Mobile Toll Intrastate Interstate Total $68,992.8 $317.3 $7,547.2 $57,475.1$19,382.4$76,857.5 $493.3 $0.5 $26.6 $304.3r $216.1r $520.4 25,354.6 273.6 2,668.1 20,392.8 7,903.4 28,296.2 493.3 0.5 26.6 304.3r 216.1r 520.4 94,347.4 590.9 10,215.3 77,867.8 27,285.7105,153.5 4.1 0.3 56.3 50.5r 10.1r 60.6 624.4 0.3 308.7 815.2 118.2 933.4 48.6 0.8 15.4r 34.0r 49.4 1,580.9 2.2 335.9 1,269.8 649.2 1,919.0 75.2 117.3 13.3 180.9 24.9 205.8 * * * 15.5 6.9 90.0 27.5 84.9 112.4 30.1 * 56.9 38.1 48.9 87.0 0.6 0.0 0.6r 0.6 102.7 0.1 53.9 104.1 52.6 156.7 49.2 0.0 0.8 5.3r 44.7r 50.0 1,804.4 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-6.pdf  
- - 8 Table 6.2 Telephone Penetration by State (Percentage of Households with Telephone Service) State November 1983 July 1998 Change Alabama 87.9% 93.2% 5.3% * Alaska 83.8 94.4 10.7 * Arizona 88.8 91.0 2.2 Arkansas 88.2 88.2 0.1 California 91.7 95.3 3.6 * Colorado 94.4 95.8 1.4 Connecticut 95.5 96.2 0.7 Delaware 95.0 96.8 1.8 District of Columbia 94.7 90.6 -4.1 ** Florida 85.5 92.2 6.7 * Georgia 88.9 92.2 3.3 Hawaii 94.6 96.1 1.5 Idaho 89.5 93.4 3.9 Illinois 95.0 93.3 -1.7 Indiana 90.3 94.5 4.2 * Iowa 95.4 97.3 1.9 Kansas 94.9 93.2 -1.7 Kentucky 86.9 93.6 6.7 * Louisiana 88.9 91.7 2.7 Maine 90.7 97.7 7.0 * Maryland 96.3 96.9 0.6 Massachusetts 94.3 94.0 -0.3 Michigan 93.8 95.3 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-7.pdf  
- - food & beverages * 3.3 - housing * 3.1 - apparel & upkeep 2.9 1.6 - transportation 3.7 2.9 - medical care 5.1 5.9 - recreation ** * 2.3 - other goods & services * 5.7 CPI public transportation 4.9 4.4 CPI piped gas 3.6 2.3 CPI electricity 2.2 1.6 CPI sewer & water maintenance * 5.2 CPI postage 4.1 3.8 Source: Bureau of Labor Statistics. * Series not established until after 1935. ** Series not established until 1992. Figure reflects annual change between 1992 and 1997. 0 50 100 150 200 1920192519301935194019451950195519601965197019751980198519901995 CPI All Items CPI Telephone Services CPI All Items and CPI Telephone Services 1982 - 1984 = 100 7 - 5 TABLE 7.2 ANNUAL CHANGES IN MAJOR 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mr98-9.pdf  
- 98.6 99.7 98.7 97.6 99.1 99.2 97.3 98.1 98.9 Residence 99.1 99.7 98.8 98.5 99.2 99.3 97.8 98.5 99.1 Business 96.7 99.4 98.3 95.7 98.9 98.6 94.6 95.9 97.9 Average Installation Interval (days) 3.0 1.6 NA 6.7 2.7 1.4 1.9 3.1 2.9 Residence 2.6 1.4 NA 5.4 2.3 1.3 1.3 2.9 2.5 Business 4.2 3.3 NA 7.4 4.2 1.7 3.4 4.1 4.9 Initial Trouble Reports per Thousand Lines 226.4 242.1 289.1 323.6 156.8 214.3 184.8 198.0 242.7 Total MSA 224.6 245.6 284.4 335.5 155.6 218.3 183.5 187.0 NA Total Non MSA 245.6 200.1 308.2 247.2 181.9 222.1 189.3 226.2 NA Total Residence 279.2 280.5 322.2 373.0 194.5 258.7 208.4 214.6 NA Total Business 119.9 173.0 209.0 209.7 92.1 127.1 126.4 152.9 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-0.pdf  
- Care Funding Commitments ................................................................Table 5.2 Rural Health Care Funding Commitments by State ..................................................Table 5.1 Rural Health Care Funding Commitments by Type of Provider ..............................Table 5.3 Rural Health Care Funding Commitments by Type of Service Provider ..................Table 5.4 Schools and Libraries Fund Disbursements by Service Provider Type .....................Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant .........Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ............Table 4.2 Schools and Libraries Mechanism - Net Revenue by State ......................................Table 4.4 State Code Reference .............................................................................................Table 8.2 Study Area Waiver Limitations  USF  Applied in 2000 .................................Table 3.4 Study Area Waiver Limitations  USF  Ended in 2000 ..................................Table 3.3 Subscribership  Effect of Do Not Disconnect 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-4.pdf  
- library consortia), schools, school districts, and other consortia. USAC submitted the list of schools and libraries to which SLD issued funding commitment letters as of October 25, 1999. As of that date, SLD had issued funding letters committing $1.722 billion of support. (As of November 22, 1999, $1.927 billion had been committed, but the underlying data used to generate tables 4.1 and 4.2 were not immediately available.)6 Table 4.1a summarizes the first funding period commitments (January 1, 1998 through June 30, 1999) by state and by type of applicant. Table 4.1b summarizes the second funding period commitments (July 1, 1999 through June 30, 2000) by state and by type of applicant. The complete lists of funding commitments are too lengthy to 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-6.pdf  
- 90.7 93.8 3.1 * Illinois 94.2 91.8 -2.4 ** Indiana 91.6 93.8 2.3 * Iowa 96.2 95.8 -0.4 Kansas 94.3 93.8 -0.5 Kentucky 88.1 92.8 4.6 * Louisiana 89.7 91.5 1.9 Maine 93.4 97.2 3.8 * Maryland 95.7 95.3 -0.4 Massachusetts 95.9 95.4 -0.5 Michigan 92.8 94.2 1.3 Minnesota 95.8 96.9 1.1 Mississippi 82.4 88.0 5.6 * Missouri 91.5 95.6 4.1 * Montana 91.0 95.3 4.3 * Nebraska 95.7 95.9 0.2 Nevada 90.4 93.1 2.8 New Hampshire 94.3 97.0 2.7 * New Jersey 94.8 93.9 -0.8 New Mexico 82.0 89.8 7.8 * New York 91.8 95.3 3.5 * North Carolina 88.3 93.9 5.6 * North Dakota 94.6 97.3 2.6 * Ohio 92.4 94.7 2.3 * Oklahoma 90.3 91.2 0.9 Oregon 90.6 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-7.pdf  
- 1998 CPI all items 4.0% 3.1% CPI all services 4.5 3.8 CPI telephone services*** 2.0 0.9 CPI major categories: - food & beverages * 3.0 - housing * 3.0 - apparel & upkeep 3.0 1.0 - transportation 3.7 2.4 - medical care 5.2 5.8 - recreation ** * 2.5 - other goods & services * 5.9 CPI public transportation 4.9 4.1 CPI piped gas 3.5 1.9 CPI electricity 2.2 1.3 CPI sewer & water maintenance * 4.9 CPI postage 4.1 2.8 Source: Bureau of Labor Statistics. * Series not established until after 1935. ** Series not established until 1998. Figure reflects annual change between 1992 and 1997. *** The CPI telephone service index was revised in December of 1997 CHART 7.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrd99-9.pdf  
- 9 - 12 Table 9.1(b): Company Comparison -- Installation, Maintenance, & Customer Complaints -- 1997 Company Ameritech Bell Atlantic BellSouth NYNEX Pacific SBC US West GTE Sprint ACCESS SERVICES PROVIDED TO CARRIERS -- SWITCHED ACCESS Percent Installation Commitments Met 51.5 82.4 99.0 97.3 75.5 82.3 90.9 94.6 96.9 Average Installation Interval (days) 50.3 34.6 22.0 16.3 30.1 34.0 33.1 30.3 4.1 Average Repair Interval (hours) 10.8 6.8 1.3 107.9 14.0 2.9 17.0 13.4 24.3 ACCESS SERVICES PROVIDED TO CARRIERS -- SPECIAL ACCESS Percent Installation Commitments Met 92.5 93.4 88.5 98.6 89.4 80.1 86.7 89.7 97.8 Average Installation Interval (days) 13.4 14.8 13.9 11.8 20.8 NA 22.1 12.9 7.1 Average Repair Interval (hours) 3.1 2.4 3.3 3.1 5.2 2.0 3.4 7.3 11.7 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-0.pdf  
- Revenue per Minute ............................................................................................ Table 7.12 Revenues and Other Operating Items .................................................................. Table 11.1 Revenues - Net .............................................................................................. Table 11.7 Rural Health Care Funding Commitments .......................................................... Table 5.1 Schools and Libraries Fund Disbursements by Service Provider Type................Table 4.3 Schools and Libraries Fund Disbursements to Service Providers by Type..........Table 4.4 Schools and Libraries Funding Commitments by State and Type of Applicant..Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service......Table 4.2 Schools and Libraries Mechanism - Net Revenue by State..................................Table 4.6 Schools and Libraries Program Fund Size Projections.........................................Table 4.5 State Code Reference........................................................................................... Table 8.21 Subscribership - United States ............................................................................ Table 6.1 Switch Downtime and Trunk Blocking ............................................................... Table 9.2 Switch Downtime Causes .................................................................................... Table 9.3 Switching Systems ............................................................................................. Table 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-1.pdf  
- FCC 457 Line # IntrastateInterstate Total IntrastateInterstate Total IntrastateInterstate Total IntrastateInterstate Total Universal Service Worksheet Data: * Per minute access $8,533.6$9,348.2$17,881.8 $320.2 $43.6 $363.8 * * $8,853.9$9,391.7$18,245.6 Other local service revenue 61,616.218,384.080,000.9 1,676.7 675.6 2,353.5 752.2 137.2 889.4 64,045.519,202.383,247.8 Local service revenue 70,149.827,732.197,882.7 1,996.9 719.2 2,717.3 752.2 137.2 889.4 72,899.328,594.1101,493.4 Mobile service revenue 427.6 1.1 428.7 35.1 3.0 38.2 462.6 4.1 466.7 Toll service revenue 9,039.6 363.2 9,402.1 312.1 918.1 1,228.9 133.9 16.7 150.7 9,485.4 1,292.510,777.9 Total telecommunications revenue 79,617.128,096.5107,713.6 2,344.1 1,640.3 3,984.4 886.1 154.0 1,040.1 82,847.329,890.7112,738.0 included on Universal Service Worksheets TRS Worksheet Data: ESTIMATED* Revenues reported by service providers that filed TRS Worksheets but not Universal Service Worksheets: Per minute access 349.8 16.0 0.0 365.8 Other local service revenue 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-4.pdf  
- $930 million is for telecommunications and Internet access. The Schools and Libraries Division supplied information regarding their funding commitments for the first funding period (January 1, 1998 through June 30, 1999) as of May 10, 1999. The complete list of schools and libraries that received funding commitments as of May 10, 1999 is available at the FCC's web site.3 Table 4.1 summarizes the Schools and Libraries commitments by state and by type of applicant. There were four types of applicants: libraries (or library consortia), schools, school districts, and other consortia. Table 4.1 also shows, by state, the number of funding commitments made to each type of applicant. Table 4.2 is based on the same data as table 4.1, and shows, on 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-7.pdf  
- 1998 CPI all items 4.0% 3.1% CPI all services 4.5 3.8 CPI telephone services*** 2.0 0.9 CPI major categories: - food & beverages * 3.0 - housing * 3.0 - apparel & upkeep 3.0 1.0 - transportation 3.7 2.4 - medical care 5.2 5.8 - recreation ** * 2.5 - other goods & services * 5.9 CPI public transportation 4.9 4.1 CPI piped gas 3.5 1.9 CPI electricity 2.2 1.3 CPI sewer & water maintenance * 4.9 CPI postage 4.1 2.8 Source: Bureau of Labor Statistics. * Series not established until after 1935. ** Series not established until 1998. Figure reflects annual change between 1992 and 1997. *** The CPI telephone service index was revised in December of 1997 CHART 7.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrj99-9.pdf  
- 3.7 3.3 4.7 2.2 4.6 7.9 6.9 LOCAL SERVICES PROVIDED TO RESIDENTIAL AND BUSINESS CUSTOMERS Percent Installation Commitments Met 98.7 98.2 73.0 98.2 98.7 98.8 98.2 98.0 98.4 Residence 98.8 98.7 98.6 98.3 98.8 98.9 98.5 98.3 98.5 Business 97.8 95.0 96.8 97.4 97.9 98.1 96.4 95.7 97.6 Average Installation Interval (days) 2.3 2.4 0.6 1.2 2.4 0.7 1.6 3.0 4.1 Residence 2.2 2.2 0.7 1.1 2.2 0.7 1.3 2.8 3.9 Business 2.9 3.4 1.4 1.6 3.8 0.8 3.1 4.3 5.4 Initial Trouble Reports per Thousand Lines 216.9 154.6 286.5 190.7 155.7 223.9 196.0 201.7 240.7 Total MSA 213.2 155.0 262.5 190.6 NA 195.3 192.9 0.2 234.7 Total Non MSA 266.1 149.4 375.2 191.6 NA 375.4 207.3 0.2 253.2 Total Residence 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs00-0.pdf  
- Other Operating Items ......................................................................Table 11.1 Revenues - Net .....................................................................................................Table 11.7 Revenue - Total ...............................................................................Table 1.7 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care  Net Revenue by State ....................................................Table 5.2 Schools and Libraries Fund Disbursements by Service Provider Type ................... Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant ..... Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ......... Table 4.2 Schools and Libraries Mechanism - Net Revenue by State .....................................Table 4.4 State Code Reference ...............................................................................................Table 8.13 Study Area Waiver Limitations - HCL - Applied to 2000 .............................. Table 3.4 Study Area Waiver Limitations - HCL - Ended in 2000 ............................... Table 3.3 Subscribership - Effect of 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs01-0.pdf  
- Average...............................................................................Table 7.13 Revenues and Other Operating Items ......................................................................Table 11.1 Revenues - Total Operating .................................................................................Table 11.7 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care - Net Revenue by State ....................................................Table 5.2 Schools and Libraries Fund Disbursements by Service Provider Type ................... Table 4.3 Schools and Libraries Funding Commitments by State and Type of Applicant ..... Table 4.1 Schools and Libraries Funding Commitments by State and Type of Service ......... Table 4.2 Schools and Libraries Mechanism - Net Revenue by State ..................................... Table 4.4 State Code Reference ...............................................................................................Table 8.13 Subscribership - United States ................................................................................Table 6.1 Switch Downtime and Trunk Blocking ................................................................... Table 9.2 Switch Downtime Causes .......................................................................................Table 9.3 Switching Systems ..................................................................................................Table 10.1 Taxes ................................................................................................................Table 11.11 Telecommunications Revenues by 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/Monitor/mrs02-0.pdf  
- Total Operating ................................................................................. Table 11.7 Rural Health Care Funding Commitments by State ................................................ Table 5.1 Rural Health Care - Net Dollar Flow by State ............................................... Table 5.3 Rural Health Care - Service Speeds Acquired .............................................. Table 5.2 Schools and Libraries Disbursements by Service Provider Type .......................... Table 4.3 Schools and Libraries Commitments & Disbursements by State & Applicant Type Table 4.1 Schools and Libraries Commitments & Disbursements by State & Service Type ...Table 4.2 5 Index of Tables and Charts Schools and Libraries Commitments & Disbursements per Student by State ........ Table 4.4 Schools and Libraries Mechanism - Net Dollar Flow by State ................................Table 4.5 State Code Reference ............................................................................................... Table 8.13 Subscribership - United States ................................................................................ Table 6.1 Switch Downtime and 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual00.pdf  
- (Using Company Provided Composites) 1996 1997 1998 1999 2000 BellSouth 5.2 5.7 6.8 9.2 12.8 Qwest 9.5 4.9 4.9 7.3 7.4 SBC Ameritech 3.5 5.4 7.6 7.7 16.4 SBC Pacific 3.1 4.2 7.2 10.8 13.5 SBC Southwestern 5.8 5.5 5.0 5.7 6.8 Verizon GTE 7.5 7.8 7.4 7.4 4.4 Verizon North 14.1 (Combined with Verizon South) Verizon South 8.5 7.2 4.1 5.3 5.2 0 5 10 15 Years Percent Dissatisfied 1996 1997 1998 1999 2000 Composite Verizon Bell South SBC Qwest Residential Installation Dissatisfaction Incumbent BOCs Chart 4 Percent Installation Commitments Met -- Residential Services (Using Company Provided Composites) 1996 1997 1998 1999 2000 BellSouth 99.0 98.9 98.6 97.8 100.0 Qwest 98.3 98.1 98.5 98.5 98.9 SBC Ameritech 98.4 98.6 98.8 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual01.pdf  
- 1999 2000 2001 BellSouth 5.2 5.7 6.8 9.2 12.8 11.2 Qwest 9.5 4.9 4.9 7.3 7.4 6.4 SBC Ameritech 3.5 5.4 7.6 7.7 16.4 15.5 SBC Pacific 3.1 4.2 7.2 10.8 13.5 8.8 SBC Southwestern 5.8 5.5 5.0 5.7 6.8 8.0 Verizon GTE 7.5 7.8 7.4 7.4 4.4 4.8 Verizon North 14.1 (Combined with Verizon South) Verizon South 8.5 7.2 4.1 5.3 5.2 4.8 Chart 3 Percent Dissatisfied -- Residential Installations (Using Company Provided Composites) Residential Installation Dissatisfaction Incumbent BOCs 0.0 2.0 4.0 6.0 8.0 10.0 12.0 14.0 1996 1997 1998 1999 2000 2001 Years Percent Dissa tisf ied Composite Verizon BellSouth SBC Qwest 10 1996 1997 1998 1999 2000 2001 BellSouth 99.0 98.9 98.6 97.8 100.0 100.0 Qwest 98.3 98.1 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual02.pdf  
- Avg. Qwest Sprint Weighted Composite* 9 ARMIS 43-06 Report 1997 1998 1999 2000 2001 2002 BellSouth 5.7 6.8 9.2 12.8 11.2 10.3 Qwest 4.9 4.9 7.3 7.4 6.4 7.0 SBC Ameritech 5.4 7.6 7.7 16.4 15.5 10.7 SBC Pacific 4.2 7.2 10.8 13.5 8.8 6.4 SBC Southwestern 5.5 5.0 5.7 6.8 8.0 8.1 Verizon GTE 7.8 7.4 7.4 4.4 4.8 4.1 Verizon North (Combined with Verizon South) Verizon South 7.2 4.1 5.3 5.2 4.8 5.2 Weighted Composite* 6.0 5.9 7.4 9.2 8.2 7.2 * Industry weighted composite is calculated using access line counts. Percent Dissatisfied -- BOC Residential Installations (Using Company Provided Composites) Chart 3 Residential Installation Dissatisfaction BOCs 0.0 2.0 4.0 6.0 8.0 10.0 12.0 14.0 1997 1998 1999 2000 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual03.pdf  
- ARMIS 43-06 Report 1998 1999 2000 2001 2002 2003 BellSouth 6.8 9.2 12.8 11.2 10.3 6.7 Qwest 4.9 7.3 7.4 6.4 7.0 5.5 SBC Ameritech 7.6 7.7 16.4 15.5 10.7 8.1 SBC Pacific 7.2 10.8 13.5 8.8 6.4 6.1 SBC Southwestern 5.0 5.7 6.8 8.0 8.1 7.9 SBC SNET 14.2 11.6 8.3 7.3 7.6 Verizon GTE 7.4 7.4 4.4 4.8 4.1 3.5 Verizon North (Combined with Verizon South) Verizon South 4.1 5.3 5.2 4.8 5.2 6.2 Weighted BOC Composite* 5.8 7.5 9.2 8.2 7.2 6.3 *Weighted composite is calculated using access line counts. (Calculated From Company Provided Composites) (Using Company Provided Composites) Chart 3 Residential Installation Dissatisfaction BOCs 0.0 2.0 4.0 6.0 8.0 10.0 12.0 14.0 1998 1999 2000 2001 2002 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/QualSvc/qual98.pdf  
- and data qualifications Table 2(a): Company Comparison -- Installation, Maintenance, & Customer Complaints -- 1997 Company Ameritech Bell Atlantic BellSouth NYNEX Pacific SBC US West GTE Sprint ACCESS SERVICES PROVIDED TO CARRIERS -- SWITCHED ACCESS Percent Installation Commitments Met 51.5 82.4 99.0 97.3 75.5 82.3 90.9 94.6 96.9 Average Installation Interval (days) 50.3 34.6 22.0 16.3 30.1 34.0 33.1 30.3 4.1 Average Repair Interval (hours) 10.8 6.8 1.3 107.9 14.0 2.9 17.0 13.4 24.3 ACCESS SERVICES PROVIDED TO CARRIERS -- SPECIAL ACCESS Percent Installation Commitments Met 92.5 93.4 88.5 98.6 89.4 80.1 86.7 89.7 97.8 Average Installation Interval (days) 13.4 14.8 13.9 11.8 20.8 NA 22.1 12.9 7.1 Average Repair Interval (hours) 3.1 2.4 3.3 3.1 5.2 2.0 3.4 7.3 11.7 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/00socc.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186 Part 4. Historical Financial, Operational, and Rate Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/01socc.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . . . .165 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2001. . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/02socc.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . . 169 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2002. . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/03socc.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . . . . . . 163 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2003. . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/95socc.pdf  
- . . . . . . . . . . 199 TABLE 3.4-INCOME STATEMENT AND BALANCE SHEET OF TELEGRAPH CARRIERS FOR THE YEAR ENDED DECEMBER 31, 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . 200 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/96socc.pdf  
- 186 TABLE 3.3-SELECTED FACILITY DATA OF COMSAT CORPORATION FOR THE YEARS 1996 AND 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/97socc.pdf  
- 3.3-SELECTED FACILITY DATA OF COMSAT CORPORATION - INTELSAT FOR THE YEARS 1997 AND 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1997. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/98SOCC.PDF  
- ENDED DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/99socc.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 184 Part 4. Historical Financial, Economic, and Rate Tables Table 4.1 - Local Service Revenues, 1950 -1999. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/prelim02socc.pdf  
- MS Missouri 2,098.8 255.0 1,843.8 1,267.7 576.1 198.5 59.1 288.2 545.8 30.3 MO Montana 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 MT Nebraska 210.0 30.9 179.2 138.1 41.1 19.1 8.4 12.4 39.9 1.3 NE Nevada 723.3 82.4 640.9 413.8 227.2 98.5 40.0 78.7 217.2 10.0 NV New Hampshire 463.7 16.1 447.6 283.3 164.2 63.9 24.5 71.9 160.3 4.1 NH New Jersey 3,872.9 241.3 3,631.6 2,313.5 1,318.1 520.6 148.8 621.8 1,291.2 27.0 NJ New Mexico 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 NM New York 8,146.9 337.7 7,809.2 5,413.9 2,395.3 960.8 251.3 1,124.2 2,336.3 59.1 NY North Carolina 3,182.2 275.3 2,906.8 2,052.6 854.2 397.2 102.5 325.0 824.7 29.5 NC North Dakota 0.0 0.0 0.0 0.0 0.0 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc00idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186 Part 4. Historical Financial, Operational, and Rate Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc01idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1955 - 2001. . . . . . . . . . . . . . . .165 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2001. . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc02idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2002. . . . . . . . . . . . . . . 169 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2002. . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc03idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2003. . . . . . . . . . . . . . . . . 163 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2003. . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc04idx.pdf  
- Year Ending December 31, 2003. . . . . . . . . . 109 Table 3.3 -2003 U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . .111 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1960 - 2004. . . . . . . . . . . . . . . . . 115 Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2004. . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc05idx.pdf  
- . . . . . . . . . Table 3.3 -2005 U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1965 - 2006 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2006. . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc06_07idx.pdf  
- . . . . 201 207 Table 3.3 -U.S. Billed Revenues for Facilities-Based and Facilities-Resale Service. . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . 202 208 Part 4. Historical Financial and Operating Statistics Tables Table 4.1 - Local Service Revenues of Reporting Incumbent Local Exchange Carriers, 1970 - 2008 . . . . . . . . . . . . . . . . . . . . . . . Table 4.2 - Access Revenues of Reporting Incumbent Local Exchange Carriers, 1984 - 2008. . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc93idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . 179 TABLE 3.4-INCOME STATEMENT AND BALANCE SHEET OF TELEGRAPH CARRIERS FOR THE YEAR ENDED DECEMBER 31, 1993. . . . . . . . . . . . 180 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR 1993. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183 TABLE 4.2-INTERNATIONAL MESSAGE TELEGRAPH SERVICE OF THE DOMESTIC UNITED STATES FOR 1993. . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc94idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . .211 TABLE 3.4-INCOME STATEMENT AND BALANCE SHEET OF TELEGRAPH CARRIERS FOR THE YEAR ENDED DECEMBER 31, 1994. . . . . . . . . . . . 212 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1994. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc95idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . .199 TABLE 3.4-INCOME STATEMENT AND BALANCE SHEET OF TELEGRAPH CARRIERS FOR THE YEAR ENDED DECEMBER 31, 1995. . . . . . . . . . . . 200 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc96idx.pdf  
- . . . . . 186 TABLE 3.3-SELECTED FACILITY DATA OF COMSAT CORPORATION FOR THE YEARS 1996 AND 1995. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1996. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc97idx.pdf  
- . . . . . . . . . . . . . 186 TABLE 3.3-SELECTED FACILITY DATA OF COMSAT CORPORATION - INTELSAT FOR THE YEARS 1997 AND 1996. . . . . . . . . . . . . . . . . . . . . . . . . . 187 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1997. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc98idx.pdf  
- . . . . . . 185 TABLE 3.2-INCOME STATEMENT OF COMSAT CORPORATION--YEAR ENDED DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186 PART 4. INTERNATIONAL TELECOMMUNICATIONS TABLE 4.1-INTERNATIONAL MESSAGE TELEPHONE SERVICE OF THE DOMESTIC UNITED STATES FOR THE YEAR ENDING DECEMBER 31, 1998. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Common_Carrier/Reports/FCC-State_Link/SOCC/scc99idx.pdf  
- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 184 Part 4. Historical Financial, Economic, and Rate Tables Table 4.1 - Local Service Revenues, 1950 -1999. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Documents/bulletins/oet56/oet56e4.pdf  
- bytheNCRP,ANSI/IEEEandICNIRP.Becauseofdifferencesininternationalstandards,the WorldHealthOrganization(WHO),aspartofitsEMFProject(discussedearlier),has initiatedaprogramtotryanddevelopaninternationalframeworkforRFsafetystandards. FCCExposureGuidelines In1985,theFCCadoptedthe1982ANSIguidelinesforpurposesofevaluating exposureduetoRFtransmitterslicensedandauthorizedbytheFCC.Thisdecisionwasin responsetoprovisionsoftheNationalEnvironmentalPolicyActof1969requiringallFederal Governmentagenciestoevaluatetheimpactoftheiractionsonthe"qualityofthehuman environment."5In1992,ANSIadoptedthe1991IEEEstandardasanAmericanNational Standard(arevisionofits1982standard)anddesignateditANSI/IEEEC95.1-1992.6 In1993,theFCCproposedtoupdateitsrulesandadoptthenewANSI/IEEE guidelines.Afteralengthyperiodtoallowforthefilingofcommentsandfordeliberation theFCCdecided,in1996,toadoptamodifiedversionofitsoriginalproposal.7TheFCC's 5 TheNationalEnvironmentalPolicyActof1969,42USCSection4321,etseq. 6ANSI/IEEEC95.1-1992(originallyissuedasIEEEC95.1-1991),"IEEEStandardforSafetyLevelswith RespecttoHumanExposuretoRadioFrequencyElectromagneticFields,3kHzto300GHz,"(Reference3). 7 SeeReportandOrderandSecondMemorandumOpinionandOrderandNoticeofProposedRulemaking, ETDocket93-62,(References55and56).In1997,theFCCreleasedatechnicalbulletinentitled,"Evaluating CompliancewithFCCGuidelinesforHumanExposuretoRadiofrequencyElectromagneticFields,"OETBulletin65 (Reference57)thatcontainsdetailedinformationonmethodsforcompliancewithFCCguidelines.Thesedocuments canbeaccessedattheFCC'sWebsite:http://www.fcc.gov/oet/rfsafety. 11 actionalsofulfilledrequirementsoftheTelecommunicationsActof1996foradoptingnew RFexposureguidelines.8 TheFCCconsideredalargenumberofcommentssubmittedbyindustry,government agenciesandthepublic.Inparticular,theFCCconsideredcommentssubmittedbytheEPA, FDA,NIOSHandOSHA,whichhaveprimaryresponsibilityforhealthandsafetyinthe FederalGovernment.TheguidelinestheFCCadoptedwerebasedontherecommendationsof thoseagencies,andtheyhavesentletterstotheFCCsupportingitsdecisionandendorsing theFCC'sguidelinesasprotectiveofpublichealth. Inits1996Order,theFCCnotedthatresearchandanalysisrelatingtoRFsafetyand healthisongoingandchangesinrecommendedexposurelimitsmayoccurinthefutureas knowledgeincreasesinthisfield.Inthatregard,theFCCwillcontinuetocooperatewith industryandwithexpertagenciesandorganizationswithresponsibilitiesforhealthandsafety inordertoensurethattheFCC'sguidelinescontinuetobeappropriateandscientifically valid. TheFCC'sguidelinesarebasedonrecommendedexposurecriteriaissuedbythe NCRPandANSI/IEEE.TheNCRPexposureguidelinesaresimilartotheANSI/IEEE1992 guidelinesexceptfordifferencesinrecommendedexposurelevelsatthelowerfrequencies andhigherfrequenciesoftheRFspectrum.BothANSI/IEEEandNCRPrecommendtwo differenttiersofexposurelimits.TheNCRPdesignatesonetierforoccupationalexposure andtheotherforexposureofthegeneralpopulationwhileANSI/IEEEdesignatesexposure tiersintermsof"environments,"onefor"controlled"environmentsandtheotherfor "uncontrolled"environments.Overabroadrangeoffrequencies,NCRPexposurelimitsfor thepublicaregenerallyone-fifththoseforworkersintermsofpowerdensity.9 TheNCRPandANSI/IEEEexposurecriteriaidentifythesamethresholdlevelat whichharmfulbiologicaleffectsmayoccur,andthevaluesforMaximumPermissible Exposure(MPE)recommendedforelectricandmagneticfieldstrengthandpowerdensityin 8TheTelecommunicationsActof1996,enactedonFebruary8,1996,requiredthat:"Within180daysafterthe enactmentofthisAct,theCommissionshallcompleteactioninETDocket93-62toprescribeandmakeeffective rulesregardingtheenvironmentaleffectsofradiofrequencyemissions."SeeSection704(b)ofthe TelecommunicationsActof1996,Pub.L.No.104-104,110Stat.56(1996). 9 TheFCCadoptedlimitsforfieldstrengthandpowerdensitythatarebasedonSections17.4.1and17.4.2, andthetime-averagingprovisionsofSections17.4.1.1and17.4.3,of"BiologicalEffectsandExposureCriteriafor RadiofrequencyElectromagneticFields,"NCRPReportNo.86,forfrequenciesbetween300kHzand100GHz (Reference34).Withtheexceptionoflimitsonexposuretopowerdensityabove1500MHz,andlimitsforexposure tolowerfrequencymagneticfields,theseMPElimitsarealsobasedontheguidelinesdevelopedbytheIEEEand adoptedbyANSI.SeeSection4.1ofANSI/IEEEC95.1-1992,"SafetyLevelswithRespecttoHumanExposureto RadioFrequencyElectromagneticFields,3kHzto300GHz"(Reference3). 12 bothdocumentsarebasedonthisthresholdlevel.10Inaddition,boththeANSI/IEEEand NCRPguidelinesarefrequencydependent,basedonfindings(discussedearlier)thatwhole- bodyhumanabsorptionofRFenergyvarieswiththefrequencyoftheRFsignal.Themost restrictivelimitsonexposureareinthefrequencyrangeof30-300MHzwherethehuman bodyabsorbsRFenergymostefficientlywhenexposedinthefarfieldofanRFtransmitting source.AlthoughtheANSI/IEEEandNCRPguidelinesdifferathigherandlower frequencies,atfrequenciesusedbythemajorityofFCClicenseestheMPElimitsare essentiallythesameregardlessofwhetherANSI/IEEEorNCRPguidelinesareused. Mostradiofrequencysafetylimitsaredefinedintermsoftheelectricandmagnetic fieldstrengthsaswellasintermsofpowerdensity.Forlowerfrequencies,limitsaremore meaningfullyexpressedintermsofelectricandmagneticfieldstrengthvalues,andthe indicatedpowerdensitiesareactually"far-fieldequivalent"powerdensityvalues.Thelatter arelistedforcomparisonpurposesandbecausesomeinstrumentationusedformeasuringRF fieldsiscalibratedintermsoffar-fieldorplane-waveequivalentpowerdensity.Athigher frequencies,andwhenoneisactuallyinthe"farfield"ofaradiationsource,itisusuallyonly necessarytoevaluatepowerdensity.InthefarfieldofanRFtransmitterpowerdensityand fieldstrengtharerelatedbystandardmathematicalequations.11 TheexposurelimitsadoptedbytheFCCin1996expressedintermsofelectricand magneticfieldstrengthandpowerdensityfortransmittersoperatingatfrequenciesfrom300 kHzto100GHzareshowninTable1.TheFCCalsoadoptedlimitsforlocalized("partial body")absorptionintermsofSAR,showninTable2,thatapplytocertainportable transmittingdevicessuchashand-heldcellulartelephones.12 10 Theseexposurelimitsarebasedoncriteriaquantifiedintermsofspecificabsorptionrate(SAR).SARisa measureoftherateatwhichthebodyabsorbsRFenergy.BoththeANSI/IEEEandNCRPexposurecriteriaare basedonadeterminationthatpotentiallyharmfulbiologicaleffectscanoccuratanSARlevelof4W/kgasaveraged overthewhole-body.Appropriatesafetyfactorshavebeenincorporatedtoarriveatlimitsforbothwhole-body exposure(0.4W/kgfor"controlled"or"occupational"exposureand0.08W/kgfor"uncontrolled"or"general population"exposure,respectively)andforpartial-body(localizedSAR),suchasmightoccurintheheadoftheuser ofahand-heldcellulartelephone.ThenewMPElimitsaremoreconservativeinsomecasesthanthelimitsspecified byANSIin1982.However,thesemoreconservativelimitsdonotarisefromafundamentalchangeintheSAR thresholdforharm,butfromaprecautionarydesiretoaddanadditionalmarginofsafetyforexposureofthepublic orexposurein"uncontrolled'environments. 11 SeeOETBulletin65(Reference57)fordetails. 12TheseguidelinesarebasedonthoserecommendedbyANSI/IEEEandNCRP.SeeSections4.2.1and4.2.2 ofANSI/IEEEC95.1-1992andSection17.4.5ofNCRPReportNo.86.Forpurposesofevaluation,theFCChas designatedthesedevicesaseither"portable"or"mobile"dependingonhowtheyaretobeused.Portabledevicesare normallythoseusedwithin20centimetersofthebodyandmustbeevaluatedwithrespecttoSARlimits.Mobile devicesarenormallyused20centimetersormoreawayfromthebodyandcanbeevaluatedintermsofeitherSAR orfieldintensity.DetailedinformationonFCCrequirementsforevaluatingportableandmobiledevicescanbe foundinOETBulletin65andintheFCC'sRulesandRegulations,47CFR2.1091and2.1093. 13 TimeAveragingofExposure TheNCRPandANSI/IEEEexposurecriteriaandmostotherstandardsspecify "time-averaged"MPElimits.Thismeansthatitispermissibletoexceedtherecommended limitsforshortperiodsoftimeaslongastheaverageexposure(overtheappropriateperiod specified)doesnotexceedthelimit.Forexample,Table1showsthatforafrequencyof100 MHztherecommendedpowerdensitylimitis1mW/cm2withanaveragingtimeofsix minutes(anysix-minuteperiod)foroccupational/controlledexposure. Thetime-averagingconceptcanbeillustratedasfollowsforexposureinaworkplace environment.Thesumoftheproduct(orproducts)oftheactualexposurelevel(s)multiplied bytheactualtime(s)ofexposuremustnotbegreaterthantheallowed(average)exposure limittimesthespecifiedaveragingtime.Therefore,for100MHz,exposureat2mW/cm2 wouldbepermittedforthreeminutesinanysix-minuteperiodaslongasduringthe remainingthreeminutesofthesix-minuteperiodtheexposurewasatornear"zero"levelof exposure.Therefore,inthisexample: (2mW/cm2)X(3min.)+(0mW/cm2)X(3min.)=(1mW/cm2)X(6min.) 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.txt  http://www.fcc.gov/Bureaus/Engineering_Technology/News_Releases/1998/et8002a.wp  
- 190.3 927.0 25044 12593 24863 12621 1.0 0.8 98.2 CA LOS ANGELES 34 35 73.5 896.0 21708 12379 21279 12427 0.6 1.0 98.3 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Notices/1996/fcc96317.pdf  
- 0.1 33.0 3096 27 771 25 0.0 0.0 100.0 AK KETCHIKAN 9 17 436.5 366.0 22177 17 22184 17 0.0 0.0 100.0 AK NORTH POLE 4 28 436.5 485.0 30801 79 30801 79 0.0 0.0 100.0 AK SITKA 13 4 0.1 47.2 2148 8 1132 8 0.0 0.0 100.0 AL ANNISTON 40 32 50.0 268.0 11669 378 10175 341 6.9 4.1 99.4 AL BESSEMER 17 28 50.0 266.0 11776 230 11231 217 2.4 1.1 100.0 AL BIRMINGHAM 6 50 3259.4 420.0 36695 1617 34673 1552 0.0 0.0 96.9 AL BIRMINGHAM 10 11 6.7 404.0 29996 1453 28693 1431 0.3 0.3 98.3 AL BIRMINGHAM 13 55 1543.3 408.0 33313 1557 29388 1466 0.0 0.0 100.0 AL BIRMINGHAM 42 30 127.6 421.0 22518 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1996/fcc96326.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1996/fcc96326.txt  
- exception of the limits on exposure to power density above 1500 MHz and the limits for exposure to lower frequency magnetic fields, these MPE limits are also generally based on the guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronic Engineers, Inc. (IEEE) and adopted by the American National Standards Institute (ANSI). See Section 4.1 of ANSI/IEEE C95.1-1992, "Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz". These guidelines are based on those recommended by ANSI/IEEE and NCRP. See Sections 4.2.1 and 4.2.2 2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 2 V.CONCLUSION.......................................................169 VI.ORDERING CLAUSES............................................170-172 VII.PROCEDURAL MATTERS............................................173 Final Regulatory Flexibility Analysis ..................................Appendix A 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fc97115a.wp  
- 0.4 0.0 100.0 ILPEORIA 47 46 50.0 216.0 12924 553 12880 553 2.0 0.3 100.0 ILPEORIA 59 39 50.0 178.0 6421 409 6393 409 0.4 0.5 100.0 ILQUINCY 10 54 1000.0 238.0 26233 313 23635 294 0.0 0.0 100.0 ILQUINCY 16 32 50.0 302.0 15205 198 15084 197 0.0 0.0 100.0 ILQUINCY 27 34 50.0 173.0 4121 103 4109 102 4.1 1.1 100.0 ILROCKISLAND 4 58 1000.0 408.0 38568 1191 31886 1005 0.0 0.0 100.0 ILROCKFORD 13 54 1000.0 216.0 24307 1515 18743 913 0.0 0.0 100.0 ILROCKFORD 17 16 187.6 203.0 15256 886 13542 775 1.5 1.0 100.0 ILROCKFORD 39 42 50.0 176.0 11496 691 11331 686 1.1 1.0 100.0 ILSPRINGFIELD 20 42 72.0 436.0 23640 680 21749 607 0.6 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.txt  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1997/fcc97303.wp  
- time-averaging provisions recommended in Sections 17.4.1.1 and 17.4.3, of "Biological Effects and Exposure Criteria for Radiofrequency Electromagnetic Fields," NCRP Report No. 86 (1986). With the exception of the limits on exposure to power density above 1500 MHz and the limits for exposure to lower frequency magnetic fields, these MPE limits are also generally based on the guidelines contained in Section 4.1 of ANSI/IEEE C95.1-1992. We also adopted limits for localized ("partial body") absorption for certain portable transmitting devices based on Sections 4.2.1 and 4.2.2 of ANSI/IEEE C95.1-1992 and Section 17.4.5 of NCRP Report No. 86. 8 Federal Communications Commission FCC 97-303 20. The Electromagnetic Energy Association (EEA), U S WEST, Inc. and the Department of Defense (DOD) ask us to reconsider 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.txt  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fc98024a.wp  
- 190.3 927.0 25044 12593 24863 12621 1.0 0.8 98.2 CA LOS ANGELES 34 35 73.5 896.0 21708 12379 21279 12427 0.6 1.0 98.3 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.txt  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1998/fcc98338.wp  
- the same thing. 73 See 47 C.F.R. § 2.907(b) (equipment marketed by a grantee must be identical to the sample tested). 74 See SEA comments at 5-6. 75 See TIA comments at 6. 76 See Motorola comments at 9. 77 See ACIL comments at 2. 78 A TCB is required to make its services available to all applicants. See clause 4.1.2 of Guide 65. 19 needed for compliance.71 In proposing this requirement, we intended that TCBs use the same standards that we currently use in certifying equipment (i.e., the sample of the equipment for which certification is being obtained must be representative of what will actually be marketed). In the event modifications to a sample are required during compliance testing72 to 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/1999/da992743.pdf  
- 1047C.F.R.§2.104.Thesechangesincludedeletingpermittedservicefromthecategoryofservicesand deletingreferencetotheUnionofSovietSocialistRepublicsinthedefinitionofRegions1and3.(WRC-95 changedallpermittedservicestoprimaryservices.) 11Thenoteimmediatelyafterthe"InternationalFootnote"headingin§2.106isrevisedtoreadasfollows: "TheInternationalTelecommunicationUnionhasrecentlyre-numberedinternationalfootnotesusingthe"S" numberingschemeandhassubstantivelyrevisedthetextofcertainoftheseinternationalfootnotes.These internationalfootnotesshallbelistedimmediatelybelowthisnoteinI.UntilsuchtimeastheCommissionhas consideredthesubstantivelyrevisedinternationalfootnotesthathavepreviouslybeenadopteddomestically,the oldinternationalfootnotesshallapplyintheUnitedStates.Thesefootnotesappearimmediatelyafterfootnote S5.565inII." 12SeeAppendixA.FootnotesthathavebeensubstantivelyrevisedbyapriorWRCwillbeaddressedinan implementationrulemaking.Seenote5,supra. 13Henceforth,wewillusetheadjectives"Federalgovernment"and"non-Federalgovernment"insteadof "Government"and"non-Government."WearemakingthischangebecausetheCommissionhasregulatory authorityforallnon-Federalgovernmentradioservices,includingthoseoperatedbyStateandlocalgovernment licensees. 1447C.F.R.§2.105.Aspreviouslynoted,theITUhasdeletedpermittedservicesfromthecategoryof services.TherearenopermittedservicesallocatedintheUnitedStates.SeeAppendixat§2.105,wherein permittedservicesaredeletedfromthecategoryofservices.Wearealsoupdating§2.105toreflectthefactthat theislandsofQuitaSuenoBank,RoncadorBank,SerrenaBank,andSerranillaBankarenolongerunderUnited Statesjurisdiction.TheseislandsweretransferredtoColombia,effectiveSeptember17,1981.Wewillalsolist JohnstonIslandandPalmyraIslandasJohnstonAtollandPalmyraAtoll,whichconformstohowtheyare describedbytheDepartmentofState. 15See47C.F.R.§2.105(d)(2),re-numberedhereinas(d)(3).TheFederalGovernmentTableisbasedon NTIA'sManualofRegulationsandProceduresforFederalRadioFrequencyManagement,September1995 Edition,RevisionsforSeptember1996,JanuaryandMay1997,Chapter4("NTIAManual")andvarious CommissionallocationordersthatwereapprovedbytheIRACbutwhichhavenotyetbeenaddedtotheNTIA Manual. 3 FederalCommunicationsCommission DA99-2743 rulepart(s)crossreferences,16andthespecial-usefrequenciesareincludedintheCommission's Rulesforinformationalpurposesonly.Wefindthatthespecial-usefrequenciescolumn(column 7)doesnotlistanyinformationnotalreadycontainedinthepertinentservicerulesandtherefore deletecolumn7fromtheTableanddeleteitsdescriptionfrom§2.105(d)(6).17Weclarifythat theUnitedStatesTableconsistsonlyoftheFederalandNon-FederalGovernmentTables;i.e., therulepartcrossreferencesarenolongerconsideredpartoftheUnitedStatesTable.18 4.Inordertomakeiteasiertounderstandhowsharedspectrum19isallocated,wehave mergedtheFederalandNon-FederalGovernmentTablesforthosefrequencybandsthathave exactlythesameallocationsandfootnotes.Webelievethatthisactionalsohighlightsdifferences insharedspectrumbetweentheFederalandNon-FederalGovernmentTables,i.e.,theremustbe somedifferencebetweentheFederalandNon-FederalGovernmentTablesortheywouldhave beenmerged.Weareshowingallrulepartcrossreferencesincolumn6innormalcharacters becausewebelievethatthisactionwillhighlightprimaryservices,whichwillbetheonly materialprintedincapitals.Wearemergingfrequencyboxesincolumn6inordertomore clearlyshowthespanoffrequenciesthatarelistedintheservicerules.20 16See47C.F.R.§2.105(d)(5),re-numberedhereinas(d)(6).Wealsoaddedthefollowingsentenceto47 C.F.R.§2.105(d)(6):"Thiscolumnalsomaycontainexplanatorynotesforinformationalpurposesonly."Inthe Table,wehaveaddedexplanatorynotesconcerningtheFederalgovernmenttransferbandsandtwoNTIAactions thathavenotyetbeenconsideredbytheCommission. 17Asaconsequenceofdeletingcolumn7,weareaddingcrossreferencestoPart18(Industrial,Scientific, andMedical("ISM")Equipment)fortheISMbandsthatwerepreviouslylistedinthespecial-usefrequencies column.Alsoasaconsequenceofdeletingcolumn7,weareparallelingtheInternationalTablebyplacing standardfrequenciesinparenthesistotherightofthestandardfrequencyandtimesignalserviceallocations.For example,the19.95-20.05kHzbandisallocatedtotheFederalandnon-Federalgovernmentstandardfrequency andtimesignalserviceand"20kHzStandardfrequency"wasaddedtothespecial-usefrequenciescolumn.We areparallelingtheworldwideallocationbyaddingthephrase"(20kHz)"totherightoftheallocation. 18Inordertoemphasizethisfact,wehaveplacedadoublelineintheTablebetweentheNon-Federal GovernmentTableandFCCRuleParts.(WehavepreviouslyusedadoublelineonlybetweentheInternational TableandtheUnitedStatesTable.)ThisactionalignstheCommission'sUnitedStatesTablemorecloselyto NTIA'sNationalTable.SeeNTIAManual,Chapter4,paragraph4.1.2. 19IntheUnitedStates,radiospectrummaybeallocatedtoeitherFederalgovernmentornon-Federal governmentuseexclusively,orforshareduse.Inthecaseofshareduse,thetypeofservice(s)permittedneed notbethesame[e.g.,FederalgovernmentFIXED,non-FederalgovernmentMOBILE].See47C.F.R.§ 2.105(b). 20Also,areviewoftheCommission'sservicerulesfoundthatthefollowingrulepartcrossreferenceswere missingorincorrectlyshownandwetakethisopportunitytocorrecttheseerrors: Thebandscomprising405-435kHzaremergedtoindicatethatfrequencieswithinthisfrequencyrange havebeenaddedtoboththeaviationandmaritimeservicerules.Thisactionistakenbecausethefrequency410 kHzcanbeusedonasecondarybasisforthetransmissionofradiodeterminationinformationandfortransmitting byradiotelegraphradiodeterminationrelatedmessagestodirection-findingstations.See47C.F.R.§80.357(b). 4 FederalCommunicationsCommission DA99-2743 5.WeareadoptingtheITU'splacementoffootnotereferencesintheUnitedStates Table.21Thus,footnotereferenceswhichappearintheTablebelowtheallocatedserviceor servicesapplytothewholeoftheallocationconcerned.Footnotereferenceswhichappeartothe rightofthenameofaserviceareapplicableonlytothatparticularservice.Previously,we generallyplacedallfootnotesatthebottomofafrequencybandbox.Webelievethatassociating afootnotereferencewithitsservicewillassistreadersinmoreeasilyunderstandingthe restrictionsand/oradditionalinformationconcerningthatallocation.Generally,wherean internationalfootnoteisapplicable,withoutmodification,totheUnitedStatesTable,thefootnote appearsintheUnitedStatesTable(columns4and5)anddenotesastipulationaffectingboth Federalgovernmentandnon-Federalgovernmentserviceallocations. If,however,an internationalfootnotepertainstoaserviceallocatedonlyforFederalgovernmentornon-Federal governmentuse,wenowstipulatethattheinternationalfootnotewillbeplacedonlyinthe affectedTable.22Forexample,"AMATEURS5.142"willbeshownonlyintheNon-Federal GovernmentTable. Inthe160-190kHzand18168-18780kHzbands,themaritimeservicerulecrossreferenceisremoved becausethebandsarenotallocatedtothemaritimemobileserviceinthenon-FederalGovernmentTable.The bandscomprising190-405kHzaremergedtoindicatethatfrequencieswithinthisfrequencyrangehavebeen addedtotheaviationservicerules;see47C.F.R.§87.173(b).Inthe1705-1800kHzband,therulepartcross referencefor"Disaster(99)"isremovedbecausePart99hasbeendeletedfromtheCommission'sRules;public safetyuseofthisbandisnowfoundinPart90.Inthe149.9-150.5MHzband,acrossreferencetothesatellite communicationservicerulesisadded;see47C.F.R.§25.202(a)(3).Inthe2450-2500MHzband,across referencetoPart90isadded. TheCommissionhasrecentlyestablishedanewrulepart,Part101,whichisentitledFixedMicrowave Services.Part101replacesallofPart94andmostofPart21,exceptfortheMultipointDistributionService ("MDS"),whichremainsinPart21.(TheMDSfrequenciesare2150-2162,2596-2644,2650-2656,2662-2668, 2674-2680,18580-18820and18920-19160MHzbands;see47C.F.R.§§21.901(a)and21.901(e).)See ReorganizationandRevisionofParts1,2,21,and94oftheRuletoEstablishaNewPart101Governing TerrestrialMicrowaveFixedServices,etc.,WTDocketNo.94-148,ReportandOrder,FCC96-51,61FR26670 (May28,1996).Accordingly,inthe2450-2483.5MHzband,acrossreferencetoPart101isadded;see47 C.F.R.§101.147(f).Inthe2483.5-2500MHzband,thecrossreferencetoPart21isupdatedtoPart101.Inthe 3700-4200MHz,5925-6875MHz,and22.55-23.6GHzbands,thecrossreferencestoParts21and94are replacedbyPart101.Inthe6875-7075MHzband,thecrossreferencetoPart21isremoved.Inthe12.2-13.25 GHzband,thecrossreferencetoPart94isreplacedbyPart101.Inthe37-38.6GHzband,thecrossreferences toParts21and94areremovedbecausethisbandhasnotbeenaddedtoPart101. Inthe3700-4200MHz,5925-6425MHz,and10.7-11.7GHzbands,crossreferencestotheInternational FixedPublicRadiocommunicationServices(Part23)areadded.See47C.F.R.§2.106,footnoteNG41. 21See1998RadioRegulations,S5.50andS5.51. 22Inordertoimplementthispolicy,thefollowingfootnotereferencesaredeletedfromthenon-Federal GovernmentTable:448in14-19.95kHz,20.05-59kHz,61-70kHz,and70-90kHzbands;627inthe216-220 MHz,220-222MHz,and222-225MHzbands;and717inthe2700-2900MHzband.Also,thefollowing footnotereferencesaredeletedfromtheFederalGovernmentTable:480inthe1625-1705kHzband;S5.142in the7100-7300kHzband;510inthe144-146MHzband;664inthe420-450MHz,1240-1300MHz,2417-2450 MHz(footnote664previouslyre-numberedasS5.282),3300-3500MHz,and5650-5850MHzbands;808inthe 5650-5925MHzband;839inthe11.7-12.2GHzand12.2-12.7GHzbands;and915inthe119.98-120.02GHz band. 5 
 
- http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.doc  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.pdf  http://www.fcc.gov/Bureaus/Engineering_Technology/Orders/2000/fcc00418.txt  
- antenna G/T dB 14.5 14.5 14.5 14.5 C/I for other assignments in the BSS Plan dB 20.0 20.0 20.0 20.0 Clear-sky feeder link C/(N+I) dB 26.2 26.2 26.2 26.2 Clear-sky carrier-to-noise plus interference ratio dB 10.7 13.6 8.9 13.7 Required C/(N+I) for operating threshold dB 6.1 6.1 6.1 6.1 Link margin dB 4.6 7.5 2.8 7.7 Rain margin dB 1.82 4.1 0.93 4.22 Rain intensity exceeded for 0.01% of an average year mm/h 30.3 48.2 36.1 95.7 Satellite link availability for an average year % 99.98 99.92 99.71 99.59 Satellite link unavailability for an average year % 0.0207 0.0843 0.2873 0.4120 Total link unavailable time for an average year minutes 108.8 443.1 1510 2165.5 10% of the unavailable time in an 
 
- http://www.fcc.gov/Bureaus/International/Orders/1999/fcc99313.doc  
- Electronic Surveillance conducted in violation of Federal or state law or regulation; (iii) access to or disclosure of Subscriber Information in violation of Federal or state law or regulation or this Agreement; or (iv) improper access to or disclosure of Classified Information or Sensitive Information by the Company or any Affiliate. ARTICLE IV DISPUTES AND NON-IMPACT ON OTHER GOVERNMENT ACTIONS 4.1 Dispute Resolution The Parties shall use their best efforts to resolve any disagreements that may arise under this Agreement. Disagreements will be addressed, in the first instance, at the staff level by the Parties' designated representatives. Any disagreement that has not been resolved at that level shall be submitted promptly to higher authorized officials, unless the DoD, the DoJ or 
 
- http://www.fcc.gov/Bureaus/International/Orders/1999/fcc99344.doc  
- Compliance. TMI agrees that it is obligated to comply with the Communications Assistance for Law Enforcement Act (47 U.S.C. § 1001 et seq.) and will timely modify the switch employed at the TMI U.S. POP or other TMI U.S. facility to provide the capabilities and capacity required for compliance with the Act. ARTICLE IV REPORTING, ASSISTANCE, AND ACCESS TO INFORMATION 4.1 Access to Information. In response to reasonable requests made by the DoJ or the FBI, TMI, itself or through its contractors or agents, shall provide access to appropriate information concerning technical, physical, management, or other measures and other reasonably available information needed by the DoJ or the FBI to assess TMI's compliance with this Agreement and the Implementation Plan and 
 
- http://www.fcc.gov/Bureaus/International/Orders/2001/fcc01142.pdf  
- 9 Response to Supplemental Information Request at 17-18. 80 Id. at 16. The preferred shares DT holds differ from common shares primarily in that the preferred shares have a liquidation preference and receive dividends based on the number of common shares that DT would hold if it converted the preferred shares to common. See VoiceStream Wireless Corporation, Form 8-K, Exh. 4.1, Certificate and Designation of the Powers, Preferences and Relative, Participating, Optional and Other Special Rights and Qualifications, Limitations and Restrictions Thereof of Convertible Voting Preferred Stock of VoiceStream Wireless (continued....) Federal Communications Commission FCC 01-142 17 stake is no different, on a share-for-share basis, from any other shareholder of VoiceStream.81 Furthermore, VoiceStream, unlike the corporations at issue in Fox I 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8231.pdf  
- 56.50 dBW 5925.0000 - 6425.0000 MHz 1M80G7D DIGITAL, QPSK 57.18 dBW 3700.0000 - 4200.0000 MHz 1M54G7D DIGITAL, QPSK 3700.0000 - 4200.0000 MHz 1M80G7D DIGITAL, QPSK E980334 DIVERSIFIED COMMUNICATIONS, INC. Class of Station: Fixed Earth Stations SES-LIC-19980724-00963 Application for Authority Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Page 1 of 5 New application for authority to operate a 4.1-meter C-band transmit/receive fixed earth station to provide analog and digital TV with associated audio/data service via ALSAT and INTELSAT (for international service only) on a non-common carrier basis. LOCATION: 77 ° 0 ' 43.70 " W LONG. 38 ° 51 ' 53.00 " N LAT. SITE ID: 1 WASHINGTON, DC ANTENNA ID: 4.1 meters 1 OFFSAT COMTECH 5925.0000 - 6425.0000 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8254.pdf  
- of Station: Fixed Earth Stations SES-MOD-19981008-01419 PENINSULA COMMUNICATIONS, INC. Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to change assigned frequencies and to add points of communication. LOCATION: 151 ° 37 ' 51.00 " W LONG. 59 ° 41 ' 3.00 " N LAT. SITE ID: 1 66140 DIAMOND RIDGE ROAD, HOMER, KENAI PENINSULA, HOMER, AK ANTENNA ID: 4.1 meters A-1 847130-G2 "18FT" COMTECH ANT CORP 6108.5500 - 6241.4400 MHz 230KG7W TRANSMIT/DIGITAL AUDIO 58.90 dBW 6271.6400 - 6300.7400 MHz 230KG7W TRANSMIT/DIGITAL AUDIO 58.90 dBW 6330.9400 - 6360.0400 MHz 230KG7W TRANSMIT/DIGTIAL AUDIO 58.90 dBW 6390.2400 - 6425.0000 MHz 230KG7W TRANSMIT/DIGITAL AUDIO 58.90 dBW 3700.0000 - 4200.0000 MHz 23K0G7W RECEIVE/DIGITAL AUDIO 5925.0000 - 5959.7500 MHz 230KG7W TRANMIT/DIGITAL AUDIO 58.90 dBW 5989.9500 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8263.pdf  
- 6425.0000 MHz 13K3G1E 36.60 dBW 3700.0000 - 4200.0000 MHz 0.00 dBW Page 9 of 14 5925.0000 - 6425.0000 MHz 234KG7WDT QPSK 44.50 dBW E970097 Class of Station: Temporary Fixed Earth Station SES-MOD-19980903-01236 THE SATLINK CORPORATION Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to add new emission designators and change assigned frequency(ies). LOCATION: SITE ID: 1 ANTENNA ID: 4.1 meters 1 (OFFSAT) COMTECH "18FT" 5925.0000 - 6425.0000 MHz 8M30G7W 66.40 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 72.40 dBW 5925.0000 - 6425.0000 MHz 8M12G7W PM modulation digital video 51.20 dBW 5925.0000 - 6425.0000 MHz 6M06G7W PM modulation digital video 50.20 dBW 5925.0000 - 6425.0000 MHz 1M54G7W PM modulation voice and data 44.20 dBW 5925.0000 - 6425.0000 MHz 36M0F8W PM modulation 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8265.pdf  
- B-MAC ENCODED VIDEO 85.00 dBW 11700.0000 - 12200.0000 MHz 22M5F9F ANALOG & DIGITAL B-MAC ENCODED VIDEO 11700.0000 - 12200.0000 MHz 32M0F8F ANALOG & DIGITAL B-MAC ENCODED VIDEO E980462 Class of Station: Temporary Fixed Earth Station SES-LIC-19981007-01383 ALLEN HOLDINGS, INC., DBA: ALLEN COMMUNICATIONS Application for Authority Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service A new application for a 4.1-meter C-band Temporary-fixed earth station to provide analog, video with associated audio, and digital data via ALSAT, INTELSAT 701 at 180 W.L., TDRSS 5 at 174 W.L. and PANAMSAT 5 at 58 W.L. satellites on a non-common carrier basis. LOCATION: SITE ID: 1 ANTENNA ID: 4.1 meters 1 OFFSAT COMTECH 5925.0000 - 6425.0000 MHz 36M0F8F ANALOG, VIDEO/AUDIO 72.40 dBW 5925.0000 - 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8294.pdf  
- DATA 58.15 dBW 14000.0000 - 14500.0000 MHz 15M0G7F QPSK, VIDEO 58.15 dBW 11700.0000 - 12200.0000 MHz 307KG7D QPSK, DATA 11700.0000 - 12200.0000 MHz 1M85G7D QPSK, DATA 11700.0000 - 12200.0000 MHz 15M0G7F QPSK, VIDEO E980475 Class of Station: Temporary Fixed Earth Station SES-LIC-19981027-01496 INTERNATIONAL SOUND CORPORATION Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: SITE ID: 1 ANTENNA ID: 4.1 meters 1 "18FT" COMTECH (OFFSAT) 5925.0000 - 6425.0000 MHz 36M0F3F Standard Video 72.40 dBW 5925.0000 - 6425.0000 MHz 8M00G7F Compressed Digital Video 62.90 dBW 3700.0000 - 4200.0000 MHz 36M0F3F Standard Video 3700.0000 - 4200.0000 MHz 8M00G7F Compressed Digital Video E980483 Class of Station: Temporary Fixed Earth Station SES-LIC-19981029-01511 GAYLORD BROADCASTING COMPANY, L.P. Application for Authority Nature of Service:Domestic Fixed Satellite 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8304.pdf  
- 40 ° 23 ' 40.00 " N LAT. SITE ID: 1 200 Telegraph Hill Road, MONMOUTH, HOLMDEL, NJ ANTENNA ID: 11 meters 1 8840-A SCIENTIFIC ATLANTA 5925.0000 - 6425.0000 MHz 36M0F9W 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 3700.0000 - 4200.0000 MHz 36M0F9W 0.00 dBW 3700.0000 - 4200.0000 MHz 36M0F9W 0.00 dBW Page 7 of 9 ANTENNA ID: 4.1 meters 2 18 FT. "OFFSAT" COMTECH 5925.0000 - 6425.0000 MHz 36M0F9W 75.80 dBW 5925.0000 - 6425.0000 MHz 36M0F9W 72.40 dBW 3700.0000 - 4200.0000 MHz 36M0F9W 0.00 dBW 3700.0000 - 4200.0000 MHz 36M0F9W 0.00 dBW E910548 Class of Station: Fixed Earth Stations SES-MOD-19981109-01628 U.S. ELECTRODYNAMICS, INC. Application for Modification Modification application to change INTELSAT 513 at 183 E.L. to New Skies 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1998/pnin8309.pdf  
- applications accepted for filing will be assigned callsigns, or other unique station identifiers. However, these assignments are for administrative purposes only and do not in any way prejudice Commission action. E980488 Class of Station: Temporary Fixed Earth Station SES-LIC-19981112-01666 MOBILE UPLINK, INC. Application for Authority Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service A new application for a 4.1-meter C-band temporary-fixed earth station to provide analog video service via ALSAT, ANIK E2, SOLIDARIDAD F-1 and F-2, and PANAMSAT 2R satellites on a non-common carrier basis. LOCATION: SITE ID: 1 ANTENNA ID: 4.1 meters 1 OFFSAT COMTECH 5925.0000 - 6425.0000 MHz 36M0F3F ANALOG-VIDEO FM 72.40 dBW E980492 Class of Station: Fixed Earth Stations SES-LIC-19981112-01679 ORIONNET, INC. Application for Authority Nature 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9005.pdf  
- VIDEO/DATA (6.73 MB/S) 72.40 dBW 3700.0000 - 4200.0000 MHz E990003 Class of Station: Temporary Fixed Earth Station SES-LIC-19981216-01888 EDUCATIONAL SERVICE DISTRICT 101 Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: 117 ° 26 ' 8.00 " W LONG. 47 ° 39 ' 54.00 " N LAT. SITE ID: 1 NORTH 910 ASH STREET, SPOKANE, SPOKANE, WA ANTENNA ID: 4.1 meters ESD2 C60551 COMTECH ANTENNA CORP. 5925.0000 - 6425.0000 MHz 36M0F8F QPSK, VIDEO/DATA (6.73 MB/S) 72.40 dBW 3700.0000 - 4200.0000 MHz E990008 Class of Station: Temporary Fixed Earth Station SES-LIC-19981217-01918 PROTEL ENTERPRISES, INC. Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: SITE ID: 1 ANTENNA ID: 2.4 meters 1 ESA26VSM-KU ANDREW 14000.0000 - 14500.0000 MHz 36M0F3F ANALOG TV 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9010.pdf  
- SIGNAL 80.30 dBW 3700.0000 - 4200.0000 MHz 1M50F3X ENERGY DISPERSED FM TEST SIGNAL 3700.0000 - 4200.0000 MHz 800KGXD TELEMETRY SIGNAL ANALOG RANGING SIGNAL E970430 Class of Station: Temporary Fixed Earth Station SES-MOD-19980903-01240 THE SATLINK CORPORATION Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" for a C-band Transportable to add new emission designators. LOCATION: SITE ID: 1 ANTENNA ID: 4.1 meters 1 OFFSAT COMTECH ANT. CORP. 5924.0000 - 6425.0000 MHz 36M0F8W 72.40 dBW 5924.0000 - 6425.0000 MHz 8M60G7D 70.20 dBW 3700.0000 - 4200.0000 MHz 0.00 dBW 5924.0000 - 6425.0000 MHz 8M12G7W PM modulation digital video 51.20 dBW 5924.0000 - 6425.0000 MHz 6M06G7W PM modulation digital video 50.20 dBW 5924.0000 - 6425.0000 MHz 1M54G7W PM modulation voice and data 44.20 dBW 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9025.pdf  
- AND CONTROL 3700.0000 - 4200.0000 MHz E990026 SES-LIC-19990106-00050 VIDEOCOM SATELLITE ASSOCIATES, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service LOCATION: 42 ° 13 ' 58.00 " N LAT. SITE ID: 1 502 SPRAGUE STREET, NORFOLK, DEDHAM, MA 71 ° 8 ' 25.00 " W LONG. "18FT" OFFSAT COMTECH ANT CORP ANTENNA ID:1 4.1 meters 51K2G7D- QPSK DIGITAL, 1/2, 3/4 FEC, 64 KBPS 54.30 dBW 5925.0000 - 6425.0000 MHz 36M0G7D QPSK DIGITAL, 1/2, 3/4 FEC, 1544 KBPS 72.90 dBW 5925.0000 - 6425.0000 MHz 4M00G7F- COMPRESSED DIGITAL VIDEO 69.90 dBW 5925.0000 - 6425.0000 MHz 8M00G7F COMPRESSED DIGITAL VIDEO 72.90 dBW 5925.0000 - 6425.0000 MHz 51K2G7D- QPSK DIGITAL, 1/2, 3/4 FEC, 64 KBPS 3700.0000 - 4200.0000 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9069.pdf  
- Temporary Fixed Earth Station Application for Modification Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Modification application to change INTELSAT 513, 803, 806 and K to New Skies Satellites N.V. 513, 803, 806 and K. LOCATION: SITE ID: 1 ESA45A ANDREW ANTENNA ID:1 4.5 meters 36M0F9W 71.53 dBW 5925.0000 - 6425.0000 MHz "18 FT." OFFSAT COMTECH ANTENNA ID:2 4.1 meters 36M0F9W 71.53 dBW 5925.0000 - 6425.0000 MHz E910628 SES-MOD-19990301-00282 H.G.M. COMMUNICATIONS INC. Class of Station: Temporary Fixed Earth Station Application for Modification Nature of Service:Domestic Fixed Satellite Service Modification application to add SATMEX 5 (Mexican licensed), to change regulatory status from common carrier to non-common carrier. LOCATION: SITE ID: 1 ESA45A ANDREW ANTENNA ID:1 4.5 meters 36M0F9W 78.49 dBW 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9070.pdf  
- of Station(s) listed:1 Application for Consent to Assignment E8047 SES-LIC-19990112-00031 CLEAR CHANNEL BROADCASTING, INC. Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: 33 ° 28 ' 57.00 " N LAT. SITE ID: 1 1004 N. JACKSON STREET, OKTIBBEHA, STARKVILLE, MS 88 ° 48 ' 51.00 " W LONG. 0S-4 MICRODYNE ANTENNA ID:1 4.1 meters 50K0F3E ANALOG 52.00 dBW 5925.0000 - 6425.0000 MHz 50K0F3E ANALOG 3700.0000 - 4200.0000 MHz E990093 SES-LIC-19990225-00278 PAMAMSAT LICENSEE CORPORATION Class of Station: Fixed Earth Stations Application for Authority Page 1 of 4 Nature of Service:Domestic Fixed Satellite Service LOCATION: 25 ° 28 ' 14.00 " N LAT. SITE ID: PAS HOMESTEAD 143 NORTH FLAGER AVE, DADE, HOMESTEAD, FL 80 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9080.pdf  
- Satellite Service LOCATION: SITE ID: 1 OFFSAT COMTECH ANTENNA SYSTEMS, INC. ANTENNA ID:1 2.4 meters 8M60G7F COMPRESSED DIGITAL/VIDEO 10.75 MBPS 65.50 dBW 5925.0000 - 6425.0000 MHz E990132 SES-LIC-19990317-00432 MOBILE SATELLITE CONNECTION, L.L.C. Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: SITE ID: 1 OFFSAT COMTECH ANTENNA SYSTEMS, INC. ANTENNA ID:MOBILE 1 4.1 meters 36M0F8F STANDARD VIDEO WITH ASSOCIATED AUDIO SUBCARRIERS 72.40 dBW 5925.0000 - 6425.0000 MHz 8M60G7F COMPRESSED DIGITAL/VIDEO 10.75 MBPS 3/4 FEC 70.20 dBW 5925.0000 - 6425.0000 MHz E990144 SES-LIC-19990317-00490 UNIVERSITY OF CENTRAL OKLAHOMA Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: 35 ° 39 ' 25.00 " N LAT. SITE ID: 1 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9083.pdf  
- Station Application for Modification Nature of Service:Domestic Fixed Satellite Service Page 1 of 2 "Modification" to change the regulatory status from common carrier to non-common carrier, and to add SatMex-5 and Solidaridad satellites as points of communication. LOCATION: SITE ID: 1 ESA45A ANDREW ANTENNA ID:1 4.5 meters 36M0F9W 71.53 dBW 5925.0000 - 6425.0000 MHz "18 FT." OFFSAT COMTECH ANTENNA ID:2 4.1 meters 36M0F9W 71.53 dBW 5925.0000 - 6425.0000 MHz E990130 SES-REG-19990326-00430 COMCAST CABLEVISION OF LITTLE ROCK, INC. Class of Station: Fixed Earth Stations Registration Nature of Service:Domestic Fixed Satellite Service LOCATION: 34 ° 45 ' 0.70 " N LAT. SITE ID: 1 301 GILL STREET, PULASKI, LITTLE ROCK, AR 92 ° 17 ' 33.00 " W LONG. 8345 SCIENTIFIC ATLANTA ANTENNA 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9124.pdf  
- to add antenna for digital video services on a non-common carrier. LOCATION: 25 ° 54 ' 49.00 " N LAT. SITE ID: 1 DADE, MIAMI, FL 80 ° 9 ' 33.00 " W LONG. MODEL ESA93-46 ANDREW CORPORATION ANTENNA ID:1 9.3 meters 36M0F8W 83.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 0.00 dBW 3700.0000 - 4200.0000 MHz OFFSAT COMTECH ANTENNA ID:2 4.1 meters 3M00G7F- DIGITAL VIDEO 63.00 dBW 6067.4000 - 6243.0000 MHz 36M0G7F DIGITAL VIDEO 71.90 dBW 6359.0000 - 6425.0000 MHz 3M00G7F- DIGITAL VIDEO 63.00 dBW 6359.0000 - 6425.0000 MHz 36M0G7F DIGITAL VIDEO 71.90 dBW 6359.0000 - 6425.0000 MHz 3M00G7F DIGITAL VIDEO 3600.0000 - 4200.0000 MHz 36M0G7F DIGITAL VIDEO 3700.0000 - 4200.0000 MHz E940044 SES-MOD-19990315-00381 SPOKANE TELEVISION, INC. ( d/b/a KXLY-TV ) 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9138.pdf  
- Fixed Satellite Service Modification filed to replace MORELOS 2 satellite with SATMEX-5 satellite as point of communication to communicate between the U.S. and Mexico. Page 8 of 11 LOCATION: 33 ° 48 ' 25.00 " N LAT. SITE ID: 1 1802 BRIARCLIFF ROAD, DEKALB, ATLANTA, GA 84 ° 20 ' 28.00 " W LONG. 18 FT. "OFFSAT" COMTECH ANTENNA ID:1 4.1 meters 1M77F1D 55.00 dBW 5925.0000 - 6425.0000 MHz 300KF3E 50.30 dBW 5925.0000 - 6425.0000 MHz 0.00 dBW 3700.0000 - 4200.0000 MHz E850041 SES-MOD-19990401-00544 WILLIAMS COMMUNICATIONS, INC. Class of Station: Fixed Earth Stations Application for Modification Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Modification filed to SATMEX-5 satellite as point of communications to communicate between the U.S. and 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9145.pdf  
- U.S.C. & 309(b). All applications accepted for filing will be assigned call signs, or other unique station identifiers. However, these assignments are for administrative purposes only and do not in any way prejudice Commission action. E990253 SES-LIC-19990430-00996 INTERNATIONALE SHOPPING ALLIANCE Class of Station: Fixed Earth Stations Application for Authority Nature of Service:International Fixed Satellite Service A new application for a 4.1-meter C-band transmit/receive earth station to provide video with associated subcarriers digital video service via ALSAT satellite on a non-common carrier basis. LOCATION: 36 ° 1 ' 27.00 " N LAT. SITE ID: 1 6626 CENTRAL AVENUE PIKE, KNOX, KNOXVILLE, TN 83 ° 59 ' 13.00 " W LONG. OFFSAT COMTECH ANTENNA ID:1 5.5 meters 36M0F8F STANDARD VIDEO WITH ASSOCIATED AUDIO 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9219.pdf  
- 49.00 " W LONG. SERIES 1194 PRODELIN ANTENNA ID:1 1.8 meters 614KG7D DIGITAL DATA, BPSK, FEC 1/2 48.50 dBW 14000.0000 - 14500.0000 MHz DIGITAL DATA, BPSK, FEC 1/2 11700.0000 - 12200.0000 MHz E8165 SES-MOD-19990624-01802 VIDEOCOM, INC. Class of Station: Fixed Earth Stations Application for Modification Nature of Service:Domestic Fixed Satellite Service Modification to replace existing 4.5-meter Andrew antenna with a 4.1-meter Comtech antenna, and to change emission designator. LOCATION: SITE ID: 1 VARIOUS OFFSAT COMTECH ANTENNA ID:D2 4.1 meters 25M0F8W ANALOG/DIGITAL QPSK 75.90 dBW 5925.0000 - 6425.0000 MHz 25M0F8W ANALOG/DIGITAL QPSK 3700.0000 - 4200.0000 MHz KA312 SES-MOD-19990709-01203 COMSAT CORPORATION/COMSAT MOBILE COMMUNICATIONS Class of Station: Fixed Earth Stations Application for Modification Nature of Service:International Fixed Satellite Service "MOD" to add additional emission 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9228.pdf  
- 618KD7W- 16 QAM 1/2 TO 7/8 FEC DIGITAL 67.30 dBW 5925.0000 - 6425.0000 MHz 20M3D7W 16 QAM 1/2 TO 7/8 FEC DIGITAL 72.40 dBW 5925.0000 - 6425.0000 MHz 618KD7W- 3700.0000 - 4200.0000 MHz 20M3D7W 3700.0000 - 4200.0000 MHz 35M9G7W 45 MB/S 3/4 FEC 72.40 dBW 5925.0000 - 6425.0000 MHz 35M9G7W 3700.0000 - 4200.0000 MHz "18 FT" OFFSAT COMTECH ANTENNA ID:4 4.1 meters 18M0F8F- 78.40 dBW 5925.0000 - 6425.0000 MHz 36M0F8F 78.40 dBW 5925.0000 - 6425.0000 MHz 9M00G1F 78.40 dBW 5925.0000 - 6425.0000 MHz 24M0G7F 78.40 dBW 5925.0000 - 6425.0000 MHz 200KF3E 62.90 dBW 5925.0000 - 6425.0000 MHz 38K4G7E 59.50 dBW 5925.0000 - 6425.0000 MHz 54K6G7W- 60.50 dBW 5925.0000 - 6425.0000 MHz 6M84G7W 78.40 dBW 5925.0000 - 6425.0000 MHz 81K9G7W- 61.40 dBW 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9231.pdf  
- MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F8W 72.30 dBW 5925.0000 - 6425.0000 MHz 9M00G7W 72.30 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 9M00G7W 3700.0000 - 4200.0000 MHz 43K0G7D- 66.10 dBW 5925.0000 - 6425.0000 MHz 36M0G7D 82.80 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 82.80 dBW 5925.0000 - 6425.0000 MHz 3700.0000 - 4200.0000 MHz "18"FT OFFSAT COMTECH ANTENNA ID:2 4.1 meters 36M0F3F 74.90 dBW 5925.0000 - 6425.0000 MHz 36M0F3F 3700.0000 - 4200.0000 MHz 36M0F8W 72.30 dBW 5925.0000 - 6425.0000 MHz 9M00G7W 72.30 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 3700.0000 - 4200.0000 MHz 9M00G7W 3700.0000 - 4200.0000 MHz 43K0G7D- 66.10 dBW 5925.0000 - 6425.0000 MHz 36M0G7D 82.80 dBW 5925.0000 - 6425.0000 MHz 36M0F8W 82.80 dBW 5925.0000 - 6425.0000 MHz 3700.0000 - 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/1999/pnin9238.pdf  
- SUBCARRIERS 65.00 dBW 5925.0000 - 6425.0000 MHz Page 5 of 9 E990518 SES-LIC-19991112-02046 ATLANTIC TELECOMMUNICATIONS SERVICES CORPORATION Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: 42 ° 37 ' 30.10 " N LAT. SITE ID: 1 SR99, EATON, DIMONDALE, MI 84 ° 37 ' 29.90 " W LONG. OFFSAT COMTECH ANTENNA ID:1 4.1 meters 8M60G1F COMPRESSED DIGITAL VIDEO 72.40 dBW 5925.0000 - 6425.0000 MHz 8M60G1F COMPRESSED DIGITAL VIDEO 3700.0000 - 4200.0000 MHz E990500 SES-LIC-19991115-01969 WANG RECOVERY SERVICES Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: SITE ID: Wang Recovery Servic 300 CONCORD ROAD, BILLERICA, MA 1184-500 PRODELIN ANTENNA ID:1 1.8 meters 1M60F7D Digital QPSK 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0002.pdf  
- E990361 SES-ASG-19991116-02077 WJXX LICENSEE, INC. TO: GANNETT RIVER STATES PUBLISHING CORPORATION C/O GANNETT CO., INC. WJXX LICENSEE, INC. FROM: No. of Station(s) listed:1 Application for Consent to Assignment E990548 SES-LIC-19991012-02191 TRI-STATE CHRISTIAN TV, INC. Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service LOCATION: SITE ID: 1 VAROUS OFFSAT MN: 8947130 COMTECH ANTENNA ID:1 4.1 meters 3M50G7F COMPRESSED DIGITAL VIDEO/QPSK MOD 68.90 dBW 5925.0000 - 6425.0000 MHz E990552 SES-LIC-19991012-02222 TRIDOM CORPORATION Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite Service Page 1 of 5 LOCATION: 33 ° 55 ' 41.00 " N LAT. SITE ID: HUB M1 840 FRANKLIN COURT, COBB, MARIETTA, GA 84 ° 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0011.pdf  
- of Station: Fixed Earth Stations Application for Modification Nature of Service:Domestic Fixed Satellite Service "MOD" to change emission designator and related service, to relocate fixed station and to change assigned frequencies. 42 ° 41 ' 26.50 " N LAT. SITE ID: 1 600 W. CAVANAUGH, INGHAM, LANSING, MI 84 ° 33 ' 36.00 " W LONG. LOCATION: C60551,C40551 COMTECH 1 4.1 meters ANTENNA ID: 154KG7W 55.85 dBW 128 KB DIGITAL CODED SCPC VOICE 5925.0000 - 6241.4400 MHz 230KG7W 55.85 dBW 192 KB DIGITAL CODED SCPC VOICE 5925.0000 - 6241.4400 MHz 154KG7W 55.85 dBW 128 KB DIGITAL CODED SCPC VOICE 6271.6400 - 6300.8300 MHz 230KG7W 55.85 dBW 192 KB DIGITAL CODED SCPC VOICE 6271.6400 - 6300.8300 MHz 154KG7W 55.85 dBW 128 KB 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0021.pdf  
- of Station(s) listed:23 Application for Consent to Assignment E000046 SES-LIC-19991105-02349 TRI-STATE CHRISTIAN TV, INC. Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service 37 ° 45 ' 54.00 " N LAT. SITE ID: 1 111 AIRWAY DRIVE, WILLIAMSON, MARION, IL 88 ° 57 ' 3.00 " W LONG. LOCATION: OFFSAT MN: 847130 COMTECH 1 4.1 meters ANTENNA ID: 3M50G7F 68.90 dBW COMPRESSED DIGITAL VIDEO/QPSK 5925.0000 - 6425.0000 MHz Points of Communication: 1 - ALSAT - (ALSAT) E000050 SES-LIC-19991110-02353 NEBRASKA EDUCATIONAL TELECOMMUNICATIONS COMMISSION Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service 40 ° 12 ' 31.60 " N LAT. SITE ID: 1 1205 EAST THIRD, RED WILLOW, MCCOOK, NE 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0046.pdf  
- T51 6.1 meters ANTENNA ID: 1M23G7W 66.30 dBW BPSK - DATA 14000.0000 - 14500.0000 MHz 404KG7W MSK - DATA 11700.0000 - 12200.0000 MHz Points of Communication: HUB T51 - ALSAT - (ALSAT) E000079 SES-LIC-20000208-00182 VIDEOCOM, INC. Class of Station: Temporary Fixed Earth Station Application for Authority Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: OFFSAT COMTECH 1 4.1 meters ANTENNA ID: 8M60G1D 76.50 dBW QPSK COMPRESSED DIGITAL VIDEO, ANALOG VIDEO 5925.0000 - 6425.0000 MHz 8M60G1D QPSK COMPRESSED DIGITAL VIDEO, ANALOG VIDEO 3700.0000 - 4200.0000 MHz Points of Communication: 1 - ALSAT - (ALSAT) Page 2 of 5 E000071 SES-LIC-20000209-00143 COMMUNITY BROADCASTING, INC. Class of Station: Fixed Earth Stations Application for Authority Nature of Service:Domestic Fixed Satellite Service 38 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0115.pdf  
- Points of Communication: 1 - INTELSAT 805 - (304.5 E.L.) E000167 SES-LIC-20000418-00591 CLEAR CHANNEL BROADCASTING LICENSES, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service 38 ° 11 ' 44.00 " N LAT. SITE ID: 1 4421 BISHOP LANE, JEFFERSON, LOUISVILLE, KY 85 ° 41 ' 8.00 " W LONG. LOCATION: COMSAT 1 4.1 meters ANTENNA ID: OFFSAT C60551 55.59 dBW QPSK - VOICE 5925.0000 - 6425.0000 MHz 320KG7W 49.58 dBW QPSK - VOICE 5925.0000 - 6425.0000 MHz 50K0F3E QPSK - VOICE 3700.0000 - 4200.0000 MHz 320KG7W QPSK - VOICE 3700.0000 - 4200.0000 MHz 50K0F3E Points of Communication: 1 - ALSAT - (ALSAT) E000203 SES-LIC-20000424-00670 SABIL UPLINK COMMUNICATIONS, LLC Application for Authority Class of 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0175.pdf  
- - (ALSAT) 1 - ANIK - 1 - MOR/SOL - 1 - SATMEX-5 - (116.8 W.L.) E970071 SES-MOD-20000628-01088 WCTV LICENSEE CORP. Application for Modification Class of Station: Temporary Fixed Earth Station Nature of Service:Domestic Fixed Satellite Service "MOD" to add new emission designator and related service and to increase EIRP and EIRP density. SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: "18FT" (OFFSAT) 72.40 dBW 5945.0000 - 6405.0000 MHz 36M0F3F Page 9 of 12 35.90 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 4M00G7W- 35.90 dBW HDTV SERVICES 5945.0000 - 6405.0000 MHz 36M0G7W Points of Communication: 1 - ALSAT - (ALSAT) E980367 SES-MOD-20000705-01101 THE RACING NETWORK, LLC Application for Modification Class of Station: Fixed Earth Stations Nature of Service:Domestic 
 
- http://www.fcc.gov/Bureaus/International/Public_Notices/2000/pnin0179.pdf  
- 3700.0000 - 4200.0000 MHz 43K9G7D DATA, QPSK, FEC 7/8, 12MB/S 3700.0000 - 4200.0000 MHz 8M00G7D Points of Communication: 1 - ALSAT - (ALSAT) 1 - SATMEX-5 - (116.8 W.L.) E000353 SES-LIC-20000713-01153 VIDEOCOM, INC. Application for Authority Class of Station: Temporary Fixed Earth Station Page 2 of 7 Nature of Service:Domestic Fixed Satellite Service SITE ID: 1 VARIOUS LOCATION: COMTECH 1 4.1 meters ANTENNA ID: OFFSAT 76.50 dBW QPSK COMPRESSED DIGITAL VIDEO, ANALOG VIDEO 5925.0000 - 6425.0000 MHz 8M60G1D QPSK COMPRESSED DIGITAL VIDEO, ANALOG VIDEO 3700.0000 - 4200.0000 MHz 8M60G1D Points of Communication: 1 - ALSAT - (ALSAT) E000355 SES-LIC-20000713-01158 COMSAT DIGITAL TELEPORT, INC. Application for Authority Class of Station: Fixed Earth Stations Nature of Service:Domestic Fixed Satellite Service, International Fixed Satellite 
 
- http://www.fcc.gov/Bureaus/MB/Orders/2002/fcc02113r.pdf  http://www.fcc.gov/Bureaus/MB/Orders/2002/fcc02113r.txt  
- While not clearly delineated, it appears from the Investment and Stockholder Agreements that the NBC-nominated members of Paxson's board are permitted to vote on all matters that come before the Paxson board. This includes the right to vote on certain extraordinary Paxson corporate matters for which NBC has a "veto right." These extraordinary matters are outlined in Article IV, Section 4.1 of the Investment Agreement and limit such actions as Paxson amending its corporate documents, increasing the size of its board of directors, or incurring large amounts of additional debt, without NBC's consent. The associated Certificate of Designations of the NBC Preferred Stock also include a covenant that limits Paxson's ability to incur additional indebtedness, a common shareholder protection provision. That 
 
- http://www.fcc.gov/Bureaus/Mass_Media/Notices/2000/da000142.doc  
- 298A for Channel 298C3 at West Rutland. This action is without prejudice to Dodge's timely appeal of the cancellation of construction permit BPH-851209MK or of the denial of application BPH-891229JP. Channel 298A can be allotted to West Rutland in compliance with the Commission's minimum distance separation requirements and at the transmitter site specified in Station WRUT's construction permit, which is 4.1 kilometers (2.6 miles) southeast of West Rutland. West Rutland is located within 320 kilometers (200 miles) of the U.S.-Canadian border. However, because this is a proposal to downgrade the allotment, notification but not prior approval of the Canadian government is required. 5. Accordingly, we seek comments on the proposed amendment of the FM Table of Allotments, Section 73.202(b) of the 
 
- http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.pdf  http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.txt  http://www.fcc.gov/Bureaus/Mass_Media/Orders/1998/fcc98315.wp  
- AREA PEOPLE AREA PEOPLE AREA PEOPLE MATCH (kW) (m) (Sq km) (thous) (Sq km) (thous) (% NL Area) (% NL Pop) (%) B-6 CA LOS ANGELES 58 41 58.2 875.0 21457 12504 20290 12096 0.2 0.5 99.6 CA MERCED 51 38 135.2 680.0 21599 1284 20953 1275 0.1 0.0 99.8 CA MODESTO 19 18 248.8 573.0 26528 2689 26692 2748 4.1 1.4 98.1 CA MONTEREY 46 32 50.0 771.0 15633 692 15629 705 0.3 0.2 97.7 CA MONTEREY 67 31 50.0 701.0 13402 790 12867 716 0.0 0.0 99.0 CA NOVATO 68 47 129.7 431.0 20011 4106 18713 3674 0.1 0.0 98.3 CA OAKLAND 2 56 1000.0 479.0 33796 5784 36057 5970 0.0 0.0 92.2 CA ONTARIO 46 47 73.0 927.0 
 
- http://www.fcc.gov/Bureaus/Mass_Media/Orders/2000/da001395.doc  
- retention at Tillamook will serve only the fourth allotment priority. In accordance with Section 1.420(i) of the Commission's Rules, we will also modify petitioner's license for Station KJUN to specify Scappoose as its community of license. 3. Channel 281C3 can be allotted to Scappoose in compliance with the Commission's minimum distance separation requirements with a site restriction of 6.5 kilometers (4.1 miles) northwest to accommodate petitioner's desired transmitter site. Canadian concurrence in the allotment has been obtained since Scappoose is located within 320 kilometers (200 miles) of the U.S.-Canadian border. 4. Accordingly, pursuant to the authority contained in Sections 4(i), 5(c)(1), 303(g) and (r) and 307(b) of the Communications Act of 1934, as amended, and Sections 0.61, 0.204(b) and 0.283 of 
 
- http://www.fcc.gov/Bureaus/Mass_Media/Public_Notices/da982306.pdf  
- such programming was 5.7 percent. ABC O&Os' overall preemption rate was influenced, in part, by higher west coast preemptions, and because they air one additional hour of children's programming. 19. We are pleased to report that it appears that ABC's O&Os experienced a relatively low average preemption rate (5.7 percent), which is only slightly higher than CBS's average preemption rate (4.1 percent) and significantly lower than NBC's average preemption rate (10.7 percent). We also note that ABC's relatively low average preemption rate is even more meaningful in light of the fact that ABC's O&Os reported broadcasting over 40 percent more core hours children's programming than NBC, and almost 50 percent more core hours than CBS.15 Overall, it appears that ABC's preemption 
 
- http://www.fcc.gov/Bureaus/Mass_Media/Public_Notices/da992709.doc  
- Haat: 100 M V Erp: 6.00 KW; V Haat: 100 M FM75 BPH -970717MF NEW Grenada MS George S. Flinn, Jr. REQ: 101.300 MHz; Channel No. 267A H Erp: 6. KW; H Haat: 100 M V Erp: 6. KW; V Haat: 100 M FM76 BPH -930208MA NEW Hattiesburg MS Abundant Life, Inc. REQ: 93.100 MHz; Channel No. 226A H Erp: 4.1 KW; H Haat: 121 M V Erp: 4.1 KW; V Haat: 121 M FM77 BPH -971203MC NEW Sardis MS George S. Flinn, Jr. REQ: 102.100 MHz; Channel No. 271A H Erp: 6.0 KW; H Haat: 68 M V Erp: 6.0 KW; V Haat: 68 M FM78 BPH -961118M7 NEW State College MS George S. Flinn, Jr. REQ: 104.500 MHz; Channel 
 
- http://www.fcc.gov/Bureaus/OPP/working_papers/oppwp35.pdf  
- Policy, other Commission Staff, or any Commissioner. Given the preliminary character of some titles, it is advisable to check with the authors before quoting or referencing these working papers in other publications. i Table of Contents EXECUTIVE SUMMARY.....................................................................................1 1. INTRODUCTION.........................................................................................7 2. METHODOLOGY - EXPERIMENTAL ECONOMICS..................................9 3. EXPERIMENTAL DESIGN.......................................................................14 3.1 Treatment Variables.......................................................................................................................14 3.2 Experiment Institution...................................................................................................................17 3.3 Performance Measures...................................................................................................................22 4.0 EXPERIMENT RESULTS.........................................................................26 4.1 Economic Efficiency........................................................................................................................27 4.2 Buyer's Bargaining Power.............................................................................................................28 4.3 Buyer Surplus..................................................................................................................................34 4.4 Seller Profits and Losses.................................................................................................................36 4.5 Regression Analysis  CAP MFN Treatment Data......................................................................40 5.0 CONCLUDING COMMENTS....................................................................49 APPENDIX A: ECONOMIC THEORY................................................................53 A.1 Traditional Oligopsony/Oligopoly Theory....................................................................................53 A.2 Some Solutions Based on Cooperative Game Theory..................................................................54 A.2.1 The "Nash Bargaining" Solution..............................................................................................56 A.2.2 The "Shapley Value" Solution..................................................................................................56 A.2.3 The "Core" Solution..................................................................................................................57 A.3 Illustration of the Cooperative 
 
- http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/mot-r.pdf  http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/mot-r.txt  
- to provide access within the limits of the "readily achievable" standard will be spent as efficiently as possible, thereby maximizing the potential to realize concrete gains in accessibility. As the TAAC,26 the Access Board,27 the FCC,28 and many commentors representing both the disability community29 and industry30 have recognized, access features can 25 NPRM ¶ 120. 26 TAAC Final Report § 4.1 - 15 - most easily and inexpensively be incorporated if considered at the outset of the product and design and development process. As a result, access features considered early in this process are more likely to be "readily achievable," and therefore required, than those considered later (through no fault of the manufacturer). In the NPRM, the FCC correctly recognizes that 
 
- http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/tia-r.pdf  http://www.fcc.gov/Bureaus/Wireless/Comments/fcc98055/tia-r.txt  
- therefore required than those considered later (through no fault of the manufacturer). In the NPRM, the FCC correctly recognizes that what is "readily achievable" is likely to change over time as technology and understanding of access issues and solutions advance.66 Where new access features become available, the FCC should, as it 61 NPRM ¶ 120. 62 TAAC Final Report § 4.1. 63 Access Board Guidelines § 1193.23. 64 NPRM ¶ 120. 65 See, e.g., CEMA Comments at 14; SBC Comments at 12; TDI Comments at 12; Trace Research and Development Center ("Trace") Comments at 7. 66 NPRM ¶ 120. - 36 - proposes, "take into account reasonable periods of time required to incorporate new accessibility solutions into products under development."67 What 
 
- http://www.fcc.gov/Bureaus/Wireless/Notices/2000/fcc00160.doc  
- supra, for a description of ARINC. FAA Revised Petition refers to a broadcast mode of delivery for FIS known as ``Flight Information Services-Broadcast (FIS-B),'' a concept currently under development. With FIS-B, an on-board server will be responsible for personalizing products to pilot's needs. See Aeronautical Spectrum Planning for 1997-2010, Doc. No. RTCA/DO-210 January 27, 1997, published by RTCA, Inc., Section 4.1.2.3. For this Notice, we will use the term FIS that appears to encompass FIS-B. We seek comments on the use of these terms. See para. 12 and note 73, infra. The FAA states that the original petition remains valid except as amended in its revision. FAA Revised Petition at 1. The FAA proposes a 25 kHz channeling plan for the 
 
- http://www.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.pdf  http://www.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.txt  http://www.fcc.gov/Bureaus/Wireless/Orders/1998/fcc98191.wp  
- or property. This conclusion is also supported by the fact that the statute defines services, not entities.162 67. In the United States, radio spectrum may be allocated exclusively or for shared use to either government (Federal government) or non-government (state/local governments and civilians). Spectrum in the FEDERAL COMMUNICATIONS COMMISSION FCC 98-191 163 See 47 C.F.R. § 2.106; NTIA Manual § 4.1.3. See also Reallocation Report and Order. 164 47 C.F.R. § 2.103. 165 If the Commission concurs with the licensee's request, the Federal entity's use of the non-Government spectrum must not cause harmful interference to non-Federal Government stations and must be in accordance with the Commission's service rules as well as any conditions agreed upon by the Commission and NTIA. 166 
 
- http://www.fcc.gov/Bureaus/Wireless/Orders/2000/da000660.doc  
- Amendment of Part 87 of the Commission's Rules to Establish Technical Standards and Licensing Procedures for Aircraft Earth Stations, Report and Order, PR Docket No. 90-315, 7 FCC Rcd 5895, 5896 n.12 (1992). However, contracting countries are not required to implement 8.33 kHz spacing if their current channel spacing standards provide an adequate number of frequencies. ISRP at 6, para. 4.1.2.1 (note). See Plan for the 8.33 kHz Channel Spacing Implementation in Europe (8.33 kHz Spacing Plan), Edition 2.0, European Civil Aviation Conference, Dec. 2, 1996 at 2. The implementing countries are Austria, Belgium, France, Germany, Luxembourg, Netherlands, Switzerland and the United Kingdom. Id. 47 C.F.R. § 87.39; see also 47 C.F.R. § 87.145 (requiring, with exceptions not relevant here, that 
 
- http://www.fcc.gov/Bureaus/Wireless/Orders/2000/fcc00047.doc  
- Resource Optimization Report indicates that number pooling techniques and LNP share a common technological architecture, and a number of state commissions noted that continued CMRS LNP implementation is necessary for CMRS participation in number pooling. See Number Resource Optimization Working Group Modified Report to the North American Numbering Council on Number Optimization Methods, October 21, 1998, at Executive Summary, §§ 4.1, 5.1.2 (1998 NANC Numbering Resource Optimization Report) (available at ). See also CMRS LNP Forbearance Order, 14 FCC Rcd at 3093, 3096-97, 3113 and n.120, ¶¶ 2, 8, 43. In the Extension Order, we specifically sought comment from wireless carriers and other interested parties on, among other things, whether it is appropriate from a legal, policy, or technical standpoint to 
 
- http://www.fcc.gov/Bureaus/Wireless/Orders/2000/fcc00264.doc  
- joint use should be encouraged. See PSWAC Final Report at 3-4. 47 C.F.R. §§ 90.179, 90.421. For example, licenses are issued for ten-year, renewable terms, and a federal entity can only use the 700 MHz band under a Section 2.103(b) agreement for as long as the state or local ally remains licensed. See 47 C.F.R. § 2.106; NTIA Manual § 4.1.3. See also Reallocation Report and Order. Section 337 of the Act required the Commission to consult with the Secretary of Commerce and the Attorney General in the reallocation of the 700 MHz band spectrum. See 47 U.S.C. § 337(a)(1). See First Report and Order, 14 FCC Rcd at 184 ¶ 62 (citing 47 U.S.C. § 305; 47 U.S.C. §§ 901-904 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8062.pdf  http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8062.wp  
- 097-57-30.3 W 0000000278 UNITED TELEPHONE MUTUAL AID CORPORATION CAVALIER ND RO KWT97106/11/1998 00152.54000 48-40-00.0 N 098-50-29.4 W 0000000278 UNITED TELEPHONE MUTUAL AID CORPORATION CAVALIER ND RO KWT97106/11/1998 00152.63000 48-40-00.0 N 098-50-29.4 W 0000000279 VILLISCA FARMERS TELEPHONE COMPANY VILLISCA IA RO KNKC88006/11/1998 00152.78000 40-56-01.9 N 094-58-36.9 W 0000000280 WHEAT STATE TELEPHONE COMPANY, INC. UDALL KS RO KBM514 06/11/1998 00152.54000 37-23-15.0 N 097-07-04.1 W 0000000280 WHEAT STATE TELEPHONE COMPANY, INC. UDALL KS RO KBM514 06/11/1998 00152.57000 37-23-15.0 N 097-07-04.1 W CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000000280 WHEAT STATE TELEPHONE COMPANY, INC. UDALL KS RO KBM514 06/11/1998 00152.69000 37-23-15.0 N 097-07-04.1 W 0000000281 WHEAT STATE TELEPHONE COMPANY, 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8087.pdf  
- 48-19-49.9 N 097-57-46.3 W 0000001150 POLAR COMMUNICATIONS MUTUAL AID CORPORATION LANKIN ND RM KAH671 06/30/1998 00152.60000 48-19-49.9 N 097-57-46.3 W 0000001150 POLAR COMMUNICATIONS MUTUAL AID CORPORATION LANKIN ND RM KAH671 06/30/1998 00152.69000 48-19-49.9 N 097-57-46.3 W 0000001151 TRI-COUNTY TELEPHONE COMPANY, INC. LAFAYETTE IN RM KNKP50006/30/1998 00152.78000 40-23-24.1 N 086-51-53.0 W 0000001151 TRI-COUNTY TELEPHONE COMPANY, INC. ROMNEY IN RM KNKP50006/30/1998 00152.78000 40-19-04.1 N 086-54-05.0 W 0000001151 TRI-COUNTY TELEPHONE COMPANY, INC. VEEDERSBURG IN RM KNKP50006/30/1998 00152.78000 40-09-23.1 N 087-12-34.0 W 0000001151 TRI-COUNTY TELEPHONE COMPANY, INC. WILLIAMSPORT IN RM KNKP50006/30/1998 00152.78000 40-19-17.1 N 087-19-09.0 W 0000001152 TRI-COUNTY TELEPHONE COMPANY, INC. CRAWFORDSVILLEIN RM KWH32806/30/1998 00152.78000 40-03-16.1 N 086-53-38.0 W 0000001152 TRI-COUNTY TELEPHONE COMPANY, INC. LINDEN IN RM KWH32806/30/1998 00454.45000 40-11-15.1 N 086-54-16.0 W 0000001153 TRI-COUNTY 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8103.pdf  
- SAN FERNANDO CA MD KNKE86205/19/1998 00931.78750 34-23-09.9 N 118-19-46.2 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN JACINTO CA MD KNKE86205/19/1998 00931.38750 33-49-49.0 N 116-57-14.0 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN LUIS OBISPO CA MD KNKE86205/19/1998 00931.18750 35-23-40.9 N 120-42-28.6 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN MARCOS CA MD KNKE86205/19/1998 00931.18750 33-06-55.1 N 117-09-04.1 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN MARCOS CA MD KNKE86205/19/1998 00931.31250 33-06-55.1 N 117-09-04.1 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN YSIDRO CA MD KNKE86205/19/1998 00931.38750 32-34-21.2 N 117-04-12.0 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN YSIDRO CA MD KNKE86205/19/1998 00931.46250 32-34-21.2 N 117-04-12.0 W 0000001505 PAGING NETWORK OF LOS ANGELES, INC SAN 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1998/pnwl8113.pdf  
- Content-Type: text/plain Content-Transfer-Encoding: 8bit CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000001667 SEA-JAY CORP. DBA: COASTAL COMMUNICATIONS BUCKSPORT ME MD KKB618 07/09/1998 00152.63000 44-34-50.0 N 068-53-43.0 W 0000001667 SEA-JAY CORP. DBA: COASTAL COMMUNICATIONS ROCKPORT ME MD KKB618 07/09/1998 00152.75000 44-12-40.2 N 069-09-04.1 W 0000001667 SEA-JAY CORP. DBA: COASTAL COMMUNICATIONS ROCKPORT ME MD KKB618 07/09/1998 00454.35000 44-12-40.2 N 069-09-04.1 W 0000001736 BARNETT, ROBERT & DEBORAH CEDAR HILL TX MD KNKO62005/26/1998 00931.36250 32-32-44.4 N 096-57-58.0 W 0000001736 BARNETT, ROBERT & DEBORAH DENTON TX MD KNKO62005/26/1998 00931.36250 33-12-24.4 N 097-08-01.0 W 0000001736 BARNETT, ROBERT & DEBORAH FORT WORTH TX MD KNKO62005/26/1998 00931.36250 32-45-01.4 N 097-20-04.0 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9000.pdf  
- SCHUYLKILL MOBILE FONE, INC. 00152.18000 40-47-07.3 N TREVORTON 0000001623 PA AM KGA589 12/31/1998 076-41-49.8 W SCHUYLKILL MOBILE FONE, INC. 00152.18000 40-47-07.3 N TREVORTON 0000001623 PA AM KGA589 12/30/1998 075-33-38.6 W SCHUYLKILL MOBILE FONE, INC. 00072.10000 41-42-16.2 N UNION DALE 0000001623 PA AM KGA589 12/31/1998 075-33-38.6 W SCHUYLKILL MOBILE FONE, INC. 00072.10000 41-42-16.2 N UNION DALE 0000001623 PA AM KGA589 12/30/1998 079-02-04.1 W SCHUYLKILL MOBILE FONE, INC. 00152.18000 41-54-09.2 N WARREN 0000001623 PA AM KGA589 12/31/1998 079-02-04.1 W SCHUYLKILL MOBILE FONE, INC. 00152.18000 41-54-09.2 N WARREN 0000001623 PA AM KGA589 12/30/1998 075-09-41.6 W SCHUYLKILL MOBILE FONE, INC. 00152.18000 40-15-10.3 N WARRINGTON 0000001623 PA AM KGA589 12/31/1998 075-09-41.6 W SCHUYLKILL MOBILE FONE, INC. 00152.18000 40-15-10.3 N WARRINGTON 0000001623 PA AM KGA589 12/30/1998 076-56-14.9 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9051.pdf  
- RO KMD99202/24/1999 00454.35000 34-14-12.0 N 117-19-00.1 W 0000004290 PAGING SYSTEMS, INC. GLENDORA CA RO KMD99202/24/1999 00454.35000 34-11-11.0 N 117-42-06.2 W 0000004290 PAGING SYSTEMS, INC. LA CRESCENTA CA RO KMD99202/24/1999 00454.35000 34-16-09.0 N 118-14-01.2 W 0000004290 PAGING SYSTEMS, INC. LONG BEACH CA RO KMD99202/24/1999 00454.22500 33-48-00.0 N 118-09-50.2 W 0000004290 PAGING SYSTEMS, INC. LOS ANGELES CA RO KMD99202/24/1999 00454.35000 33-51-01.0 N 117-39-04.1 W 0000004290 PAGING SYSTEMS, INC. LOS ANGELES CA RO KMD99202/24/1999 00454.35000 34-13-33.0 N 118-04-00.2 W 0000004290 PAGING SYSTEMS, INC. LOS ANGELES CA RO KMD99202/24/1999 00459.35000 34-13-33.0 N 118-04-00.2 W 0000004290 PAGING SYSTEMS, INC. NEWHALL CA RO KMD99202/24/1999 00454.35000 34-20-59.9 N 118-24-28.2 W 0000004290 PAGING SYSTEMS, INC. PALMDALE CA RO KMD99202/24/1999 00454.35000 34-32-49.9 N 118-12-46.2 W 0000004290 PAGING SYSTEMS, INC. POMONA 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9060.pdf  
- DBA: COOK PAGING HIGH POINT WA RO KNKP21903/03/1999 00931.13750 47-30-16.3 N 121-58-21.4 W 0000005531 COOK TELECOM, INC DBA: COOK PAGING KLAMATH FALLS OR RO KNKP21903/03/1999 00931.13750 42-08-42.5 N 121-46-19.0 W 0000005531 COOK TELECOM, INC DBA: COOK PAGING LEBANON OR RO KNKP21903/03/1999 00931.13750 44-30-17.4 N 122-57-36.3 W 0000005531 COOK TELECOM, INC DBA: COOK PAGING MEDFORD OR RO KNKP21903/03/1999 00931.13750 42-17-42.4 N 122-45-04.1 W 0000005531 COOK TELECOM, INC DBA: COOK PAGING NEWPORT OR RO KNKP21903/03/1999 00931.13750 44-45-22.4 N 124-02-53.4 W 0000005531 COOK TELECOM, INC DBA: COOK PAGING PORTLAND OR RO KNKP21903/03/1999 00931.13750 45-29-24.4 N 122-41-53.3 W Page 19 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000005531 COOK TELECOM, 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9066.pdf  
- OF TENNESSEE, INC. MIAMI FL RO KIR204 03/01/1999 00152.12000 25-46-34.3 N 080-11-19.1 W 0000005210 PAGING NETWORK OF TENNESSEE, INC. MIAMI FL RO KIR204 03/01/1999 00454.05000 25-46-34.3 N 080-11-19.1 W 0000005210 PAGING NETWORK OF TENNESSEE, INC. MIAMI FL RO KIR204 03/01/1999 00454.10000 25-46-34.3 N 080-11-19.1 W 0000005210 PAGING NETWORK OF TENNESSEE, INC. WEST PALM BEACHFL RO KIR204 03/01/1999 00152.12000 26-42-01.2 N 080-03-04.1 W 0000005211 PAGING NETWORK OF HOUSTON, INC.ALVIN TX RO KKA344 03/01/1999 00075.90000 29-24-01.8 N 095-12-13.7 W 0000005211 PAGING NETWORK OF HOUSTON, INC.ALVIN TX RO KKA344 03/01/1999 00454.10000 29-24-01.8 N 095-12-13.7 W 0000005211 PAGING NETWORK OF HOUSTON, INC.CONROE TX RO KKA344 03/01/1999 00075.90000 30-18-33.7 N 095-28-55.7 W 0000005211 PAGING NETWORK OF HOUSTON, INC.CONROE TX RO KKA344 03/01/1999 00454.10000 30-18-33.7 N 095-28-55.7 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9078.pdf  
- Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000008314 CEL AIR COMMUNICATIONS SPOKANE WA RM KNKM36403/19/1999 00931.46250 47-41-40.6 N 117-20-24.7 W 0000008315 CEL AIR COMMUNICATIONS SPOKANE WA RM KNKM47303/19/1999 00454.60000 47-41-40.6 N 117-20-04.7 W 0000008320 NORTHERN MONTANA COMMUNICATIONS HAVRE MT RM WXR93703/22/1999 00152.24000 48-32-50.9 N 109-42-17.7 W 0000008321 C&C COMMUNICATIONS OF NM CLAYTON NM RM KLB710 03/22/1999 00152.15000 36-00-04.1 N 103-27-17.8 W 0000008321 C&C COMMUNICATIONS OF NM CLAYTON NM RM KLB710 03/22/1999 00459.10000 36-00-04.1 N 103-27-17.8 W 0000008321 C&C COMMUNICATIONS OF NM CLAYTON NM RM KLB710 03/22/1999 00152.09000 36-27-29.0 N 103-11-17.7 W 0000008321 C&C COMMUNICATIONS OF NM CLAYTON NM RM KLB710 03/22/1999 00152.21000 36-27-29.0 N 103-11-17.7 W 0000008321 C&C COMMUNICATIONS OF NM CLAYTON NM RM KLB710 03/22/1999 00454.05000 36-27-29.0 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9081.pdf  
- CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000007107 METROCALL USA, INC. EUGENE OR RO KNKO95703/18/1999 00931.53750 44-11-16.4 N 122-59-16.3 W 0000007107 METROCALL USA, INC. KLAMATH FALLS OR RO KNKO95703/18/1999 00931.53750 42-12-55.5 N 121-48-00.0 W 0000007107 METROCALL USA, INC. MEDFORD OR RO KNKO95703/18/1999 00931.53750 42-17-42.4 N 122-45-04.1 W 0000007107 METROCALL USA, INC. MEDFORD OR RO KNKO95703/18/1999 00931.53750 42-17-42.4 N 122-45-04.1 W 0000007107 METROCALL USA, INC. PORTLAND OR RO KNKO95703/18/1999 00931.53750 45-29-24.4 N 122-41-53.3 W 0000007108 METROCALL USA, INC. CENTRAL ISLIP NY RO KNKO98303/18/1999 00473.21250 40-48-11.3 N 073-12-24.4 W 0000007109 METROCALL USA, INC. BOULDER CITY NV RO KNKP21203/18/1999 00931.53750 35-58-51.9 N 114-49-43.9 W 0000007109 METROCALL USA, INC. FERNLEY 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9101.pdf  
- 00152.21000 32-22-44.4 N 098-25-01.1 W Page 19 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000011364 MOBILE PHONE OF TEXAS, INC. HUCKABAY TX RO KLF556 03/30/1999 00459.17500 32-22-44.4 N 098-25-01.1 W 0000011364 MOBILE PHONE OF TEXAS, INC. MINERAL WELLS TX RO KLF556 03/30/1999 00459.17500 32-49-20.4 N 098-03-04.1 W 0000011364 MOBILE PHONE OF TEXAS, INC. MINERAL WELLS TX RO KLF556 03/30/1999 00072.42000 32-50-53.4 N 098-06-16.1 W 0000011364 MOBILE PHONE OF TEXAS, INC. MINERAL WELLS TX RO KLF556 03/30/1999 00152.21000 32-50-53.4 N 098-06-16.1 W 0000011364 MOBILE PHONE OF TEXAS, INC. MINERALS WELLS TX RO KLF556 03/30/1999 00152.12000 32-49-17.4 N 098-09-37.1 W 0000011364 MOBILE PHONE OF TEXAS, INC. MINERALS WELLS 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9120.pdf  
- INC. CORSICANA TX RO KNKD55803/30/1999 00158.10000 32-04-36.5 N 096-29-27.9 W 0000013181 TELETOUCH LICENSES, INC. GATESVILLE TX RO KNKD55803/30/1999 00158.10000 31-25-26.5 N 097-39-49.0 W 0000013181 TELETOUCH LICENSES, INC. HAMILTON TX RO KNKD55803/30/1999 00158.10000 31-41-54.5 N 098-06-27.1 W 0000013181 TELETOUCH LICENSES, INC. KILLEEN TX RO KNKD55803/30/1999 00158.10000 31-04-24.6 N 097-44-18.0 W 0000013181 TELETOUCH LICENSES, INC. LAMPASAS TX RO KNKD55803/30/1999 00158.10000 31-03-53.6 N 098-10-04.1 W 0000013181 TELETOUCH LICENSES, INC. MARLIN TX RO KNKD55803/30/1999 00158.10000 31-19-17.6 N 096-52-26.9 W 0000013181 TELETOUCH LICENSES, INC. MEXIA TX RO KNKD55803/30/1999 00075.46000 31-40-44.6 N 096-32-26.9 W 0000013181 TELETOUCH LICENSES, INC. MOODY TX RO KNKD55803/30/1999 00072.92000 31-17-54.6 N 097-19-12.0 W 0000013181 TELETOUCH LICENSES, INC. MOODY TX RO KNKD55803/30/1999 00158.10000 31-17-54.6 N 097-19-12.0 W 0000013181 TELETOUCH LICENSES, INC. TEMPLE TX RO 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9144.pdf  
- PAGING INC DWIGHT IL RO KNKB44503/29/1999 00454.07500 41-06-58.1 N 088-26-12.2 W 0000011683 ARCH PAGING INC ISABEL IL RO KNKB44503/29/1999 00454.07500 39-36-53.1 N 087-57-48.1 W 0000011683 ARCH PAGING INC LAFAYETTE IN RO KNKB44503/29/1999 00454.07500 40-23-26.1 N 086-51-47.0 W 0000011683 ARCH PAGING INC MELVIN IL RO KNKB44503/29/1999 00454.07500 40-34-36.1 N 088-14-35.1 W 0000011683 ARCH PAGING INC MT. VERNON IL RO KNKB44503/29/1999 00454.07500 38-21-04.1 N 088-45-06.2 W 0000011683 ARCH PAGING INC NORMAL IL RO KNKB44503/29/1999 00454.07500 40-33-01.1 N 088-59-41.2 W 0000011683 ARCH PAGING INC NORMAL IL RO KNKB44503/29/1999 00454.07500 40-33-01.1 N 088-59-41.2 W Page 2 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000011683 ARCH PAGING INC PARIS IL RO 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9158.pdf  
- 080-44-34.2 W 0000015974 SKYTEL CORP. CHARLOTTE VI RM KNKG78303/29/1999 00931.93750 18-21-31.0 N 064-58-21.0 W 0000015974 SKYTEL CORP. CHERRY HILL NJ RM KNKG78303/29/1999 00931.93750 39-54-45.4 N 074-58-30.6 W 0000015974 SKYTEL CORP. CHERRY HILL NJ RM KNKG78303/29/1999 00931.93750 39-55-32.4 N 075-03-01.6 W 0000015974 SKYTEL CORP. CHESAPEAKE VA RM KNKG78303/29/1999 00931.93750 36-48-38.5 N 076-16-55.7 W 0000015974 SKYTEL CORP. CLEVELAND OH RM KNKG78303/29/1999 00931.93750 41-30-04.1 N 081-41-39.4 W 0000015974 SKYTEL CORP. COLUMBIA SC RM KNKG78303/29/1999 00931.93750 34-00-04.5 N 081-02-04.3 W 0000015974 SKYTEL CORP. DALLAS TX RM KNKG78303/29/1999 00931.93750 32-55-46.4 N 096-44-40.9 W 0000015974 SKYTEL CORP. DEARBORN MI RM KNKG78303/29/1999 00931.93750 42-18-13.1 N 083-15-42.7 W 0000015974 SKYTEL CORP. DENVER CO RM KNKG78303/29/1999 00931.93750 39-44-27.9 N 104-59-22.9 W 0000015974 SKYTEL CORP. DURHAM NC RM KNKG78303/29/1999 00931.93750 36-00-55.5 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9171.pdf  
- RO KNKP36303/31/1999 00459.30000 40-41-51.7 N 115-54-16.2 W Page 2 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000016549 MICHAEL JENKINS DBA: PAGE ME ELKO NV RO KNKP36303/31/1999 00459.30000 40-41-51.7 N 115-54-16.2 W 0000016551 MICHAEL JENKINS DBA: PAGE ME NEW WELLS NV RO KNKP75303/31/1999 00158.10000 41-11-14.7 N 114-56-04.1 W 0000016551 MICHAEL JENKINS DBA: PAGE ME WELLS NV RO KNKP75303/31/1999 00158.10000 41-07-16.7 N 114-34-10.1 W CL - Cellular File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000014608 TEXAS/ILLINOIS CELLULAR LIMITED PARTNERSHIP SOUTHWESTERN BELL MOBILE SYSTEMS, INC. RIO BRAVO TX AM KNKA54207/15/1999 27-21-42.2 N 099-27-48.6 W 0000015493 N.E. COLORADO CELLULAR, INC. 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9186.pdf  
- 00152.84000 38-11-45.1 N 088-40-51.2 W 0000017204 WABASH TELEPHONE COOPERATIVEMT. VERNON IL RO KNKI63307/01/1998 00152.84000 38-19-55.1 N 088-54-35.2 W 0000017205 WABASH TELEPHONE COOPERATIVE, INC. CISNE IL RO KNKM71907/01/1998 00152.54000 38-30-58.1 N 088-26-11.1 W 0000017206 WABASH TELEPHONE COOPERATIVE, INC. EFFINGHAM IL RO KPD773 07/01/1998 00152.84000 39-07-02.1 N 088-32-05.1 W 0000017206 WABASH TELEPHONE COOPERATIVE, INC. GEFF IL RO KPD773 07/01/1998 00152.84000 38-24-14.1 N 088-22-04.1 W 0000017206 WABASH TELEPHONE COOPERATIVE, INC. GEFF IL RO KPD773 07/01/1998 00152.84000 38-24-14.1 N 088-22-04.1 W Page 2 CD - Paging and Radiotelephone File Number Applicant Name City State Purpose Call Sign Receipt Date Frequency (MHz) Latitude Longitude Area Op. 0000017206 WABASH TELEPHONE COOPERATIVE, INC. LOUISVILLE IL RO KPD773 07/01/1998 00072.12000 38-46-30.1 N 088-30-05.1 W 0000017206 WABASH TELEPHONE COOPERATIVE, INC. 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9244.pdf  
- 080-17-42.3 W 0000011041 TELESPECTRUM, INC. CLARKSBURG WV RM KNKL62903/31/1999 00454.52500 39-17-32.3 N 080-17-42.3 W 0000013220 MOBILE RADIO COMMUNICATIONS SERVICE, INC. DOLORES CO RM KUS400 03/30/1999 00152.24000 37-28-48.9 N 108-32-57.3 W 0000013220 MOBILE RADIO COMMUNICATIONS SERVICE, INC. DURANGO CO RM KUS400 03/30/1999 00152.24000 37-15-43.0 N 107-54-24.2 W 0000013220 MOBILE RADIO COMMUNICATIONS SERVICE, INC. PAGOSA CO RM KUS400 03/30/1999 00152.24000 37-16-35.0 N 107-04-04.1 W 0000013221 MOBILE RADIO COMMUNICATIONS SERVICE, INC. DURANGO CO RM KFL917 03/30/1999 00152.06000 37-15-43.0 N 107-54-24.2 W 0000013221 MOBILE RADIO COMMUNICATIONS SERVICE, INC. DURANGO CO RM KFL917 03/30/1999 00152.81000 37-15-43.0 N 107-54-24.2 W 0000013221 MOBILE RADIO COMMUNICATIONS SERVICE, INC. DURANGO CO RM KFL917 03/30/1999 00152.78000 37-22-00.0 N 107-47-04.2 W CF - Common Carrier Fixed Point to Point Microwave File Number 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9250.pdf  
- W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION JEFFERSON CITY 03/29/1999 00931.33750 38-33-56.1 N MO RM KNKO661 090-26-26.4 W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION KIRKWOOD 03/29/1999 00931.33750 38-34-29.1 N MO RM KNKO661 090-29-34.4 W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION LAKE WAPPAPELLO 03/29/1999 00931.33750 37-02-53.1 N MO RM KNKO661 090-17-45.4 W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION LAWRENCETON 03/29/1999 00931.33750 37-56-04.1 N MO RM KNKO661 090-32-25.4 W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION LOEHR 03/29/1999 00931.33750 38-37-24.1 N Page 12 CD - Paging and Radiotelephone State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City MO RM KNKO661 090-01-04.3 W 0000010543 CYBERTEL ST. LOUIS PAGING CORPORATION MARBLE HILL 03/29/1999 00931.33750 37-16-35.1 N MO RM 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9261.pdf  
- 00152.54000 ENGLISH, JOHN P 00152.66000 CAR-TEL COMMUNICATIONS, INC. 00072.02000 CAR-TEL COMMUNICATIONS, INC. 00454.17500 CAR-TEL COMMUNICATIONS, INC. 00075.98000 KODIAK RADIO, INC. 00152.24000 PC MANAGEMENT, INC 00158.70000 PC MANAGEMENT, INC 00075.66000 PC MANAGEMENT, INC 00158.70000 Page2 AMARILLO 35-12-28.1 N AMARILLO 35-12-28.1 N AMARILLO 35-12-28.1 N AMARILLO 35-12-28.1 N AMARILLO 35-12-28.1 N AMARILLO 35-12-28.1 N DUMAS 35-55-l 3.1 N HEREFORD 34-51-18.2 N PAMPA 35-31-04.1 N PAMPA 35-32-08.1 N AMARILLO 35-l 2-28.1 N AMARILLO 35-12-28.1 N JACKSONVILLE 34-53-20.3 N JACKSONVILLE 34-53-20.3 N LITTLE ROCK 34-44-26.3 N KODIAK 57-47-l 8.2 N ALVA 26-42-29.2 N TX 101-51-18.6 W TX 101-51-18.6 W TX 101-51-19.6 W TX 101-51-19.6 W TX 101-51-19.6 W TX 101-51-19.6 W TX 101-57-55.6 W TX 102-26-08.7 W TX 101-00-25.5 W TX 100-57-55.5 w TX 101-51-18.6 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9274.pdf  
- Centennial Wireless PCS License Corporation SALINAS 10/22/1999 10622.50000 17-59-12.8 N IL MD WMM679 088-51-32.2 W 0000038014 ILLINOIS VALLEY CELLULAR RSA 2 INCSTREATOR 08/26/1999 06063.80000 41-06-26.1 N OR NE 122-40-30.5 W 0000035136 BACKLINK LLC PORTLAND 10/15/1999 22725.00000 45-31-14.1 N OR NE 122-41-02.8 W 0000035137 BACKLINK LLC PORTLAND 10/15/1999 22925.00000 45-31-09.1 N OR NE 122-40-39.8 W 0000035138 BACKLINK LLC PORTLAND 10/15/1999 22675.00000 45-31-04.1 N NV NE 115-08-51.9 W 0000035273 AT&T Wireless Services of Nevada, Inc.LAS VEGAS 08/27/1999 19395.00000 36-06-02.8 N NV NE 115-08-51.9 W 0000035273 AT&T Wireless Services of Nevada, Inc.LAS VEGAS 08/27/1999 19600.00000 36-06-02.8 N MN NE 094-12-16.6 W 0000035369 APT Minneapolis, Inc. NORTH LONG LAKE 10/21/1999 06120.63000 46-28-26.0 N MN NE 094-12-16.6 W 0000035369 APT Minneapolis, Inc. NORTH LONG LAKE 10/21/1999 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9309.pdf  
- SERVICE COMPANYCHILDS 11/24/1999 02130.80000 34-20-25.1 N AZ RO KOY74 111-40-59.5 W 0000051574 ARIZONA PUBLIC SERVICE COMPANYCHILDS 11/24/1999 02146.00000 34-20-25.1 N AZ RO WED489 111-37-02.5 W 0000051575 ARIZONA PUBLIC SERVICE COMPANYSTRAWBERRY 11/24/1999 00953.95000 34-24-08.1 N AZ RO WGX752 112-01-48.5 W 0000051576 ARIZONA PUBLIC SERVICE COMPANYCLARKDALE 11/24/1999 02137.20000 34-50-47.0 N AZ RO WNTA875 111-42-02.5 W 0000051577 ARIZONA PUBLIC SERVICE COMPANYCHILDS 11/24/1999 02196.00000 34-21-04.1 N AZ RO WNTX614 112-22-15.6 W 0000051578 ARIZONA PUBLIC SERVICE COMPANYCROWN KING 11/24/1999 00928.83125 34-13-58.1 N AZ RO WNTX614 112-22-15.6 W 0000051578 ARIZONA PUBLIC SERVICE COMPANYCROWN KING 11/24/1999 00952.83125 34-13-58.1 N AZ RO WNTX615 111-48-43.5 W 0000051579 ARIZONA PUBLIC SERVICE COMPANYSCOTTSDALE 11/24/1999 00928.79375 33-38-39.1 N AZ RO WNTX615 111-48-43.5 W 0000051579 ARIZONA PUBLIC SERVICE COMPANYSCOTTSDALE 11/24/1999 00952.79375 33-38-39.1 N MW 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9320.pdf  
- 12/13/1999 21675.00000 42-33-37.1 N MI NE 083-10-16.2 W 0000056714 BACKLINK LLC TROY 12/13/1999 21325.00000 42-33-47.2 N ND NE 100-47-08.5 W 0000056721 Northern Border Pipeline Company Bismarck 10/19/1999 06093.45000 46-48-24.9 N ND NE 100-47-08.5 W 0000056721 Northern Border Pipeline Company Bismarck 10/19/1999 06123.10000 46-48-24.9 N ND NE 100-47-08.5 W 0000056721 Northern Border Pipeline Company Bismarck 10/19/1999 06152.75000 46-48-24.9 N NM NE 106-40-04.1 W 0000056805 Vodafone AirTouch Licenses LLC Albuquerque 12/13/1999 17825.00000 35-04-51.2 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TN NE 083-18-16.5 W 0000056923 Tennessee RSA #4 Sub 2, Inc. DANDRIDGE 12/13/1999 06150.28000 36-00-47.4 N OH NE 081-28-50.1 W 0000057352 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/1999/pnwl9328.pdf  
- 0000060253 PHOENIX, CITY OF PHOENIX 12/20/1999 18635.00000 33-31-44.1 N Page 40 MW - Microwave Public Safety Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ RO WNEZ382 112-08-34.5 W 0000060254 PHOENIX, CITY OF PHOENIX 12/20/1999 18605.00000 33-35-49.1 N AZ RO WNEZ383 112-07-28.5 W 0000060255 PHOENIX, CITY OF PHOENIX 12/20/1999 18695.00000 33-34-04.1 N AZ RO WNEZ384 112-04-37.5 W 0000060256 PHOENIX, CITY OF PHOENIX 12/20/1999 18635.00000 33-26-53.1 N AZ RO WNEZ384 112-04-37.5 W 0000060256 PHOENIX, CITY OF PHOENIX 12/20/1999 18690.00000 33-26-53.1 N AZ RO WNEZ385 112-06-18.5 W 0000060257 PHOENIX, CITY OF PHOENIX 12/20/1999 18925.00000 33-25-30.1 N AZ RO WNEZ385 112-06-18.5 W 0000060257 PHOENIX, CITY OF PHOENIX 12/20/1999 19010.00000 33-25-30.1 N PA RO WNTA281 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0003.pdf  
- Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City KY RO WEE209 085-07-14.8 W 0000063110 KENTUCKY, COMMONWEALTH OF SHELBYVILLE 12/28/1999 06735.00000 38-10-30.2 N KY RO WEE209 085-07-14.8 W 0000063110 KENTUCKY, COMMONWEALTH OF SHELBYVILLE 12/28/1999 06835.00000 38-10-30.2 N KY RO WEE383 083-26-04.6 W 0000063111 KENTUCKY, COMMONWEALTH OF MOREHEAD 12/28/1999 06835.00000 38-11-14.2 N HI RO WNTB408 157-53-04.1 W 0000063364 HONOLULU PUBLIC TRANSIT AUTHORITY HONOLULU 12/10/1999 21925.00000 21-20-12.6 N KY RO WED969 082-31-11.5 W 0000063392 KENTUCKY, COMMONWEALTH OF PIKEVILLE 10/22/1999 02192.80000 37-29-31.3 N KY RO WED969 082-31-11.5 W 0000063392 KENTUCKY, COMMONWEALTH OF PIKEVILLE 10/22/1999 02194.40000 37-29-31.3 N KY RO WED975 088-17-42.1 W 0000063393 KENTUCKY, COMMONWEALTH OF SALEM 10/22/1999 06805.00000 37-14-13.1 N KY RO WED975 088-17-42.1 W 0000063393 KENTUCKY, 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0052.pdf  
- 080-24-50.3 W 0000084979 POSITIVE ALTERNATIVE RADIO INC BLACKSBURG 02/24/2000 00950.62500 37-13-51.3 N VA MD WPNG734 080-44-45.2 W 0000085159 POSITIVE ALTERNATIVE RADIO INC PULASKI 02/24/2000 00944.12500 37-01-29.4 N VA MD WPNG735 080-44-45.2 W 0000085172 POSITIVE ALTERNATIVE RADIO INC PULASKI 02/24/2000 00946.00000 37-01-29.4 N VA MD WPNG736 080-10-06.0 W 0000085186 POSITIVE ALTERNATIVE RADIO INC SALEM 02/24/2000 00947.50000 37-11-07.2 N VA MD WLI969 079-50-04.1 W 0000085762 BASE COMMUNICATIONS INC Martinsville 02/25/2000 00946.50000 36-42-16.4 N VA MD WPOR949 079-50-04.1 W 0000085780 BASE COMMUNICATIONS INC MARTINSVILLE 02/25/2000 00946.00000 36-42-16.4 N OH NE 084-37-27.5 W 0000083694 Positive Radio Group, Inc.(OH) Greenville 02/22/2000 00950.00000 40-05-58.2 N VA NE 078-26-18.1 W 0000083781 WKGM Inc. Dillwyn 02/22/2000 00950.00000 37-33-24.0 N MT NE 113-59-34.4 W 0000085651 Fisher Radio Regional Group Inc. 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0057.pdf  
- MD WLL330 085-09-04.0 W 0000086596 Centennial Michiana License Company LLC dba Centennial Communications BATTLE CREEK 02/29/2000 06152.75000 42-17-20.0 N WV MD WMJ669 079-48-25.2 W 0000086693 EASTERBROOKE CELLULAR CORPORATION ELKINS 02/29/2000 02121.60000 38-51-53.3 N WV MD WMJ669 079-48-25.2 W 0000086693 EASTERBROOKE CELLULAR CORPORATION ELKINS 02/29/2000 10587.50000 38-51-53.3 N OH MD WPOS957 084-45-54.8 W 0000086736 Centennial Michiana License Company LLCHICKSVILLE 02/29/2000 06197.24000 41-16-04.1 N WV MD WMJ670 079-55-39.2 W 0000086835 EASTERBROOKE CELLULAR CORPORATION BEVERLY 02/29/2000 02171.60000 38-52-24.3 N WV MD WMJ670 079-55-39.2 W 0000086835 EASTERBROOKE CELLULAR CORPORATION BEVERLY 02/29/2000 06585.00000 38-52-24.3 N WV MD WMJ670 079-55-39.2 W 0000086835 EASTERBROOKE CELLULAR CORPORATION BEVERLY 02/29/2000 10652.50000 38-52-24.3 N MD MD WPJF469 076-43-36.8 W 0000086858 CELLCO PARTNERSHIP CATONSVILLE 02/14/2000 05945.20000 39-17-16.3 N MD MD WPJF469 076-43-36.8 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0060.pdf  
- COMPANY RAMONA 10/12/1999 06615.00000 33-00-32.1 N CA MD WNEQ695 116-58-22.1 W 0000055682 SAN DIEGO GAS AND ELECTRIC COMPANY RAMONA 10/12/1999 06665.00000 33-00-32.1 N CA MD WNEQ695 116-58-22.1 W 0000055682 SAN DIEGO GAS AND ELECTRIC COMPANY RAMONA 10/12/1999 10616.25000 33-00-32.1 N CA MD WNEQ695 116-58-22.1 W 0000055682 SAN DIEGO GAS AND ELECTRIC COMPANY RAMONA 10/12/1999 10622.50000 33-00-32.1 N CA MD KMM27 117-07-04.1 W 0000055683 SAN DIEGO GAS AND ELECTRIC COMPANY ESCONDIDO 10/12/1999 06775.00000 33-07-32.1 N CA MD KMM27 117-07-04.1 W 0000055683 SAN DIEGO GAS AND ELECTRIC COMPANY ESCONDIDO 10/12/1999 10557.50000 33-07-32.1 N CA MD KMM30 116-50-42.1 W 0000055684 SAN DIEGO GAS AND ELECTRIC COMPANY DULZURA 10/12/1999 06615.00000 32-35-42.2 N CA MD KMM30 116-50-42.1 W 0000055684 SAN DIEGO GAS AND ELECTRIC COMPANY DULZURA 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0077.pdf  
- 100-23-12.2 W 0000098119 TEXAS ELECTRONIC TRANSPORT COMPANY BRACKETTVILLE 03/24/2000 06063.80000 29-21-33.8 N TX MD KKY46 100-23-12.2 W 0000098119 TEXAS ELECTRONIC TRANSPORT COMPANY BRACKETTVILLE 03/24/2000 06093.45000 29-21-33.8 N TX MD KKY46 100-23-12.2 W 0000098119 TEXAS ELECTRONIC TRANSPORT COMPANY BRACKETTVILLE 03/24/2000 06123.10000 29-21-33.8 N TX MD KKY46 100-23-12.2 W 0000098119 TEXAS ELECTRONIC TRANSPORT COMPANY BRACKETTVILLE 03/24/2000 06152.75000 29-21-33.8 N TX MD KLR38 099-16-04.1 W 0000098121 TEXAS ELECTRONIC TRANSPORT COMPANY D'HANIS 03/24/2000 05945.20000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0000098121 TEXAS ELECTRONIC TRANSPORT COMPANY D'HANIS 03/24/2000 06004.50000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0000098121 TEXAS ELECTRONIC TRANSPORT COMPANY D'HANIS 03/24/2000 06034.15000 29-18-48.8 N TX MD KLR38 099-16-04.1 W 0000098121 TEXAS ELECTRONIC TRANSPORT COMPANY D'HANIS 03/24/2000 06063.80000 29-18-48.8 N TX MD KLR38 099-16-04.1 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0109.pdf  
- Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City TX NE 103-25-24.6 W 0000111815 EL PASO FIELD SERVICES COMPANYMENTONE 04/11/2000 00952.01875 31-46-15.4 N PA NE 078-17-40.0 W 0000111821 PENNSYLVANIA AMERICAN WATER COMPANY DECATUR TOWNSHIP 04/11/2000 00928.31875 40-55-37.0 N PA NE 078-17-40.0 W 0000111821 PENNSYLVANIA AMERICAN WATER COMPANY DECATUR TOWNSHIP 04/11/2000 00952.31875 40-55-37.0 N NM NE 107-35-04.1 W 0000111832 EL PASO FIELD SERVICES COMPANYTURLEY 04/11/2000 00928.30625 36-37-46.0 N NM NE 107-35-04.1 W 0000111832 EL PASO FIELD SERVICES COMPANYTURLEY 04/11/2000 00952.30625 36-37-46.0 N NM NE 108-11-09.0 W 0000111852 EL PASO FIELD SERVICE COMPANY FARMINGTON 04/11/2000 00928.50625 36-46-43.0 N NM NE 108-11-09.0 W 0000111852 EL PASO FIELD SERVICE COMPANY FARMINGTON 04/11/2000 00952.50625 36-46-43.0 N NM NE 104-44-25.8 W 0000111862 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0113.pdf  
- 0000088219 Aquasource, Inc. Cedar Hill 02/22/2000 00956.28125 32-35-30.1 N TX NE P 096-53-59.2 W 0000088220 Aquasource, Inc. VICTORIA 02/22/2000 00956.26875 28-43-57.8 N TX NE P 095-41-12.0 W 0000088222 Aquasource, Inc. CONROE 02/22/2000 00956.26875 30-16-46.7 N TX NE P 095-41-12.0 W 0000089796 Aquasource, Inc. Palestine 02/22/2000 00956.30625 32-02-34.1 N TX NE P 097-53-51.6 W 0000089880 AquaSource, Inc. Agua Dulce 02/22/2000 00956.31875 27-51-04.1 N TX NE P 097-35-04.6 W 0000090164 Aquasource, Inc. Weatherford 02/22/2000 00956.28125 32-58-27.4 N TX NE P 094-44-50.9 W 0000090170 Aquasource, Inc. Longview 02/22/2000 00956.30625 32-35-30.1 N NM NE 103-07-23.3 W 0000107208 Public Service Company of New MexicoHOBBS 04/04/2000 00932.28125 32-40-02.6 N NM NE 103-07-23.3 W 0000107208 Public Service Company of New MexicoHOBBS 04/04/2000 00941.28125 32-40-02.6 N NM NE 104-11-15.8 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0121.pdf  
- W 0000122896 BACKLINK LLC New York 05/03/2000 21775.00000 40-45-12.5 N NY NE 073-59-15.5 W 0000122896 BACKLINK LLC New York 05/03/2000 21775.00000 40-45-12.5 N NY NE 073-58-51.8 W 0000122897 BACKLINK LLC New York 05/03/2000 22575.00000 40-45-09.0 N NY NE 073-58-58.1 W 0000122898 BACKLINK LLC New York 05/03/2000 22825.00000 40-45-00.0 N NY NE 073-59-08.1 W 0000122899 BACKLINK LLC New York 05/03/2000 22625.00000 40-45-04.1 N NY NE 073-59-22.7 W 0000122900 BACKLINK LLC New York 05/03/2000 22575.00000 40-45-06.0 N NY NE 073-59-19.4 W 0000122901 BACKLINK LLC New York 05/03/2000 22925.00000 40-45-07.6 N NY NE 073-59-23.9 W 0000122902 BACKLINK LLC New York 05/03/2000 22725.00000 40-45-21.1 N NY NE 073-58-43.8 W 0000122903 BACKLINK LLC New York 05/03/2000 22425.00000 40-45-20.1 N NY NE 073-59-34.5 W 0000122904 BACKLINK LLC 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0137.pdf  
- 34 MG - Microwave Industrial/Business Pool State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City IL MD WPOT772 087-58-20.2 W 0000132559 COMMONWEALTH EDISON COMPANYLIBERTYVILLE 05/17/2000 00941.36875 42-18-54.0 N IL MD WPOT772 087-58-20.2 W 0000132559 COMMONWEALTH EDISON COMPANYLIBERTYVILLE 05/17/2000 00952.05625 42-18-54.0 N IL MD WPOT777 087-45-16.2 W 0000132617 COMMONWEALTH EDISON COMPANYSKOKIE 05/17/2000 00928.38125 42-03-04.1 N IL MD WPOT777 087-45-16.2 W 0000132617 COMMONWEALTH EDISON COMPANYSKOKIE 05/17/2000 00932.40625 42-03-04.1 N IL MD WPOT777 087-45-16.2 W 0000132617 COMMONWEALTH EDISON COMPANYSKOKIE 05/17/2000 00941.40625 42-03-04.1 N IL MD WPOT777 087-45-16.2 W 0000132617 COMMONWEALTH EDISON COMPANYSKOKIE 05/17/2000 00952.38125 42-03-04.1 N GA MD WPJF883 083-19-51.0 W 0000133743 GEORGIA POWER COMPANY VALDOSTA 05/18/2000 00928.70625 30-50-12.0 N GA MD WPJF883 083-19-51.0 W 0000133743 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0200.pdf  
- MD KYR23 078-42-20.0 W 0000195450 NORTH CAROLINA, STATE OF NC HIGHWAY PATROL RALEIGH 07/27/2000 06680.00000 35-47-56.5 N NC MD KYR23 078-42-20.0 W 0000195450 NORTH CAROLINA, STATE OF NC HIGHWAY PATROL RALEIGH 07/27/2000 06695.00000 35-47-56.5 N TN NE 084-10-32.7 W 0000192858 Tennessee, State of LA FOLLETTE 07/21/2000 00954.30000 36-24-35.3 N IN NE 086-53-27.0 W 0000192920 Lafayette Police Dept LAFAYETTE 07/24/2000 02144.40000 40-25-04.1 N IN NE 086-52-56.0 W 0000192926 Lafayette Police Dept LAFAYETTE 07/24/2000 02138.00000 40-26-52.1 N CA NE 118-23-44.4 W 0000192928 California, State of BISHOP 07/18/2000 18665.00000 37-21-26.7 N CA NE 119-23-39.4 W 0000193012 Berkley Petroleum Inc. Buttonwillow 07/25/2000 00953.05000 35-24-09.9 N GA NE 084-26-21.2 W 0000193404 HARTSFIELD ATLANTA INTERNATIONAL AIRPORT ATLANTA 07/25/2000 21825.00000 33-38-27.1 N GA NE 084-26-21.2 W 0000193404 HARTSFIELD 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0207.pdf  
- 08/04/2000 02128.00000 42-53-01.0 N IA MD WPND636 091-24-39.0 W 0000200510 IOWA RSA NO. 12 LIMITED PARTNERSHIP ELKADER 08/04/2000 06815.00000 42-53-01.0 N CA MD WPJC212 120-26-32.7 W 0000200542 CALIFORNIA RSA NO 3 LIMITED PARTNERSHIP JAMESTOWN 08/04/2000 05945.20000 - 06197.24000 37-56-16.7 N CA MD WPJC212 120-26-32.7 W 0000200542 CALIFORNIA RSA NO 3 LIMITED PARTNERSHIP JAMESTOWN 08/04/2000 05994.62000 37-56-16.7 N WA MD WPJB542 119-53-04.1 W 0000200715 WESTERN SUB RSA LIMITED PARTNERSHIP BEVERLY 08/04/2000 02121.60000 46-48-55.4 N WA MD WPJB542 119-53-04.1 W 0000200715 WESTERN SUB RSA LIMITED PARTNERSHIP BEVERLY 08/04/2000 06855.62500 46-48-55.4 N PR MD WMK681 065-56-35.8 W 0000200786 SAN JUAN CELLULAR TELEPHONE COMPANY GURABO 08/04/2000 06063.80000 18-16-46.4 N PR MD WMK681 065-56-35.8 W 0000200786 SAN JUAN CELLULAR TELEPHONE COMPANY GURABO 08/04/2000 11525.00000 18-16-46.4 N 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0228.pdf  
- Inc. SOMERVILLE 08/31/2000 17935.00000 42-23-02.0 N CA NE 114-39-16.9 W 0000212839 Los Angeles SMSA Limited Partnership San Bernardino 08/31/2000 10626.25000 34-17-03.0 N AR NE 092-10-07.5 W 0000212893 Nextel Partners, Inc. JEFFERSON 08/31/2000 06585.00000 34-22-12.3 N AR NE 092-07-22.9 W 0000212900 Nextel Partners, Inc. WHITE HALL 08/31/2000 06745.00000 34-17-10.4 N CA NE 117-08-25.1 W 0000213378 BACKLINK LLC SAN DIEGO 09/01/2000 21725.00000 32-46-04.1 N CA NE 117-09-30.7 W 0000213379 BACKLINK LLC SAN DIEGO 09/01/2000 21625.00000 32-46-40.9 N WA NE 122-20-32.7 W 0000213383 BACKLINK LLC SEATTLE 09/01/2000 19360.00000 47-37-31.7 N PA NE 075-09-56.4 W 0000213430 Teligent License Company II, L.L.C. Philadelphia 09/01/2000 19600.00000 39-57-12.2 N Page 44 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0236.pdf  
- 073-59-33.6 W 0000215426 New York 09/07/2000 40-43-59.7 N CO 105-00-15.3 W 0000215561 BACKLINK LLC 09/07/2000 22975.00000 39-45-05.1 N NE 105-00-58.9 W 0000215564 Denver 09/07/2000 22925.00000 CO NE 0000215565 BACKLINK LLC Denver 09/07/2000 22875.00000 39-45-13.3 N CO 104-59-25.8 W 0000215566 BACKLINK LLC 09/07/2000 22625.00000 39-44-49.8 N NE 105-00-13.1 W 0000215567 Denver 09/07/2000 22475.00000 CO NE 0000215568 BACKLINK LLC Denver 09/07/2000 22775.00000 39-45-04.1 N CO 104-59-26.7 W 0000215569 BACKLINK LLC 09/07/2000 22675.00000 39-44-40.0 N NE 104-59-40.1 W 0000215570 Denver 09/07/2000 22775.00000 CA NE 0000215598 Pacific Satellite Connection, Inc. Sacramento 09/07/2000 23075.00000 38-35-46.0 N IN 086-09-13.7 W 0000215599 KATLINK LLC 09/07/2000 19360.00000 39-55-41.9 N NE 086-09-13.7 W 0000215599 Indianapolis 09/07/2000 19400.00000 IN NE 0000215599 KATLINK LLC Indianapolis 19440.00000 39-55-41.9 N IN NE 0000215599 KATLINK 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0239.pdf  
- N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10815.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10855.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10895.00000 33-01-26.1 N CA MD WLA620 117-04-35.1 W 0000217534 PACIFIC BELL RANCHO BERNARDO 09/12/2000 10975.00000 33-01-26.1 N CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 10935.00000 33-02-30.2 N CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 10935.00000 33-02-30.2 N Page 16 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City CA MD WLA712 116-52-04.1 W 0000217535 PACIFIC BELL RAMONA 09/12/2000 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0252.pdf  
- Wireless Fiber Corp. WASHINGTON 09/26/2000 11405.00000 38-59-06.4 N CA NE 118-31-16.3 W 0000226030 KATLINK LLC Encino 09/26/2000 19680.00000 34-09-49.9 N CA NE 118-32-07.5 W 0000226031 KATLINK LLC Tarzana 09/26/2000 19600.00000 34-10-21.4 N CA NE 118-32-04.4 W 0000226032 KATLINK LLC Tarzana 09/26/2000 21275.00000 34-10-21.1 N DC NE 077-13-38.9 W 0000226037 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 10835.00000 38-55-20.4 N FL NE 080-08-04.1 W 0000226039 KATLINK LLC Miami Beach 09/26/2000 18120.00000 25-46-27.2 N DC NE 077-07-04.9 W 0000226075 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 11325.00000 38-53-00.4 N DC NE 077-13-38.9 W 0000226088 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 10715.00000 38-55-20.4 N DC NE 077-21-25.9 W 0000226089 Winstar Wireless Fiber Corp. WASHINGTON 09/26/2000 11215.00000 38-57-15.4 N DC NE 077-13-38.9 W 0000226090 Winstar Wireless Fiber 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0265.pdf  
- 03890.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 03970.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 04050.00000 32-43-36.1 N AZ MD WLL829 113-44-49.7 W 0000236817 CNG COMMUNICATIONS, INC. MOHAWK PASS 10/11/2000 04130.00000 32-43-36.1 N AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03770.00000 33-03-04.1 N Page 19 CF - Common Carrier Fixed Point to Point Microwave State Purpose Call Sign Longitude Area Op. Receipt Date File Number Frequency (MHz) Applicant Name Latitude City AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03770.00000 33-03-04.1 N AZ MD KPK30 113-08-06.6 W 0000236821 CNG COMMUNICATIONS, INC. MONTEZUMA 10/11/2000 03850.00000 33-03-04.1 N AZ MD KPK30 
 
- http://www.fcc.gov/Bureaus/Wireless/Public_Notices/2000/pnwl0271.pdf  
- WNUB779 120-38-37.6 W 0000243051 PAGING NETWORK OF SAN FRANCISCO INC IDRIA 10/19/2000 00929.46250 36-22-06.8 N CA RM WNUB779 119-17-00.4 W 0000243051 PAGING NETWORK OF SAN FRANCISCO INC SQUAW VALLEY 10/19/2000 00929.46250 36-44-35.8 N CA RM WPIY397 117-02-25.1 W 0000243367 AIRSTAR PAGING INC BARSTOW 10/19/2000 00929.08750 34-58-16.9 N CA RM WPIY397 116-26-01.0 W 0000243367 AIRSTAR PAGING INC PALM SPRINGS 10/19/2000 00929.08750 33-52-04.1 N CA RM WPIY397 118-34-55.3 W 0000243367 AIRSTAR PAGING INC SAN FERNANDO 10/19/2000 00929.08750 34-19-26.0 N CA RM WPIY397 118-34-55.3 W 0000243367 AIRSTAR PAGING INC SAN FERNANDO 10/19/2000 00929.08750 34-19-26.0 N CA RM WPIY397 118-54-27.3 W 0000243367 AIRSTAR PAGING INC THOUSAND OAKS 10/19/2000 00929.08750 34-09-52.0 N CA RM WPIY397 117-17-20.2 W 0000243367 AIRSTAR PAGING INC VICTORVILLE 10/19/2000 00929.08750 34-36-38.0 N 
 
- http://www.fcc.gov/Bureaus/Wireless/Reports/fcc00289.pdf  
- million Tele Danmark 41.6 Norway 720,000 NetCom 19.6 (controls 27.9% through investment in Tele Danmark) Belgium 1.9 million Belgacom 17.5 (controls 24.4% through investment in Tele Danmark, which owns 16.5% of Belgacom) Switzerland 413,000 DiAx 40 Hungary 867,000 MATAV 29.8 South Africa 2.1 million (Vodacom) Telkom SA(owns 50% of Vodacom) 18 Canada 1.9 million (Bell Mobility) Bell Canada 20 Mexico 4.1 million Telmex 9 Taiwan 478,000 TransAsia Tele- communications 19.4 SBC Brazil 900,000 Algar Telecom Leste SA (ATL) 50 (stake is jointly owned with Telmex and can be increased to 50% in 2004) Canada 2.6 million Rogers Cantel 17 Colombia 466,000 Celumovil 14 India 90,000 Birla Communications Ltd. 49 Taiwan 1.425 million FarEasTone 14 Japan 8.1 million (J-Phone) Japan Telecom 15 
 
- http://www.fcc.gov/Bureaus/Wireless/Reports/fcc98091.pdf  
- scale.77 Since the Second Report, there have been several acquisitions in this category, including the three described below. SBC Communications, Inc. ("SBC") announced that it intended to acquire Southern New England Telecommunication Corp. ("SNET")78 and its cellular licenses covering 5.7 million79 POPs.80 Century Telephone Enterprises, Inc. ("Century") acquired Pacific Telecom, Inc. giving Century an additional 1.9 million cellular POPs plus 4.1 million broadband PCS POPs.81 Lastly, Nextel Communications, Inc. ("Nextel"), the nation's largest SMR operator, acquired Pittencrieff Communications, Inc. ("Pittencrieff"),82 the second largest 75 Second Report , 12 FCC Rcd at 11281. 76 Broadband PCS operators also have been selling licenses to facilitate the deployment of their networks, as discussed below in the section analyzing the broadband PCS sector. 77 Second 
 
- http://www.fcc.gov/Bureaus/Wireline_Competition/Orders/2002/fcc02118.pdf  
- 5.23 NA 4.95 4.93 5.37 10.25 4.47 5.89 4.66 7.03 b,c,d,e Federal Communications Commission FCC 02-118 C-6 Metric Metric September October November December January Notes Number Full Name VZ CLE C VZ CLE C VZ CLE C VZ CLE C VZ CLE C 6020 PO-1-05- 6030 Telephone Number Availability & Reservation - CORBA 5.23 3.52 4.95 3.65 5.37 4.28 4.47 4.1 4.66 4.19 a PO-1-05- 6050 Telephone Number Availability & Reservation - Web GUI 5.23 5.8 4.95 5.69 5.37 5.97 4.47 5.89 4.66 5.64 PO-1-06- 6020 Facility Availability (Loop Qualification) - EDI 2.58 4.06 3.02 3.62 3.51 3.98 1.69 4.06 2.97 3.8 PO-1-06- 6030 Facility Availability (Loop Qualification) - CORBA 2.58 NA 3.02 NA 3.51 NA 1.69 NA 2.97 NA PO-1-06- 
 
- http://www.fcc.gov/Speeches/Kennard/2000/spwek001.doc  http://www.fcc.gov/Speeches/Kennard/2000/spwek001.html  http://www.fcc.gov/Speeches/Kennard/2000/spwek001.txt  
- the FCC implemented policies to stimulate high-speed Internet access through cable and copper. Some broadcasters have responded, and now more than 100 stations reaching 50% of the American people offer high quality digital TV signals. Dealers have received delivery of about 111,000 digital TVs since August of 1998. Cable modems are now in nearly 1.5 million households, and an estimated 4.1 million households subscribe to digital cable, and it is available to millions more. Almost 500,000 households access the Internet using high-speed DSL connections. And there are almost 11 million digital satellite households. So what's the problem? Why aren't more Americans able to enjoy IPTV? The problem is that those in the cable and consumer electronics and programming industries involved in 
 
- http://www.fcc.gov/cgb/dro/hacrules.pdf  http://www.fcc.gov/cgb/dro/hacrules.txt  http://www.fcc.gov/cgb/dro/hacrules.wp  
- An analog telephone complies with the Commission's volume control requirements if the telephone is equipped with a receive volume control that provides, through the receiver in the handset or headset of the telephone, 12 dB of gain minimum and up to 18 dB of gain maximum, when measured in terms of Receive Objective Loudness Rating (ROLR), as defined in paragraph 4.1.2 of ANSI/EIA-470-A-1987 (Telephone Instruments With Loop Signaling) . The 12 dB of gain minimum must be achieved without significant clipping of the test signal. The telephone also shall comply with the upper and lower limits for ROLR given in Table 4.4 of ANSI/EIA-470-A- 1987 when the receive volume control is set to its normal unamplified level. Note: Paragraph 4.1.2 of 
 
- http://www.fcc.gov/eb/FieldNotices/2003/DOC-255968A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). Power density is equal to the square of the electric field strength divided by the characteristic impedance of free space (377 ohms). Similarly, power density is equal to the square of the magnetic field strength times 
 
- http://www.fcc.gov/eb/FieldNotices/2003/DOC-256582A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 447 C.F.R. 1.1310, Note 1 to Table 1. 547 C.F.R. 1.1310, Note 2 to Table 1. 6See, for example, OET Bulletin 65. 7See 47 C.F.R. 1.1307(b), 1.1307(b)(1), 1.1310. 8 47 C.F.R. 1.1310. 9 Guidelines, Second Memorandum 
 
- http://www.fcc.gov/eb/FieldNotices/2003/DOC-283153A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. S: 1.1310, Note 1 to Table 1. 47 C.F.R. S: 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. S:S: 1.1307(b), 1.1307(b)(1), 1.1310. 47 C.F.R. S: 1.1310. Guidelines, 
 
- http://www.fcc.gov/eb/FieldNotices/2003/DOC-287609A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. S: 1.1310, Note 1 to Table 1. 47 C.F.R. S: 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. S:S: 1.1307(b), 1.1307(b)(1), 1.1310. 47 C.F.R. S: 1.1310. Guidelines, 
 
- http://www.fcc.gov/eb/FieldNotices/2003/DOC-287610A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. S: 1.1310, Note 1 to Table 1. 47 C.F.R. S: 1.1310, Note 2 to Table 1. See, for example, OET Bulletin 65. See 47 C.F.R. S:S: 1.1307(b), 1.1307(b)(1), 1.1310. 47 C.F.R. S: 1.1310. Guidelines, 
 
- http://www.fcc.gov/eb/Orders/2001/fcc01173.doc  http://www.fcc.gov/eb/Orders/2001/fcc01173.html  
- $16.10 per minute); and Low-Power Multi-Channel Ship Station Service during off-peak hours (from $2.80 to $2.50 per minute). Compare January 16, 2001 Letter at Exhibit A, Annex at § 1.8 with January 16, 2001 Letter at Exhibit B, Annex. Complaint at 4, ¶ 12; Answer at 18-19, ¶ 36; January 16, 2001 Letter at Exhibit B, Attachment 1 at § 4.1. IDB Mobile Communications, Inc. v. COMSAT Corporation, Supplemental Reply Brief of COMSAT Corporation, File No. E-97-48 (filed Jul. 21, 2000) at App. A (``COMSAT Supplemental Reply''). Moreover, in June 1995, COMSAT's tariffed rate for INMARSAT Standard-A space segment was $9.30 per minute, whereas the Contract rate was $5.10. See February 2, 2001 Letter at 3; January 16, 2001 Letter at 
 
- http://www.fcc.gov/eb/Orders/2002/FCC-02-105A1.html  
- defines the word ``terminates,'' both agreements provide a criterion for determining whether traffic terminates on the other party's network for the purposes of the agreements' reciprocal compensation provisions. Specifically, paragraph 5.7.5 of the First Starpower-Verizon Virginia Agreement provides that traffic shall be designated local or non-local based upon the ``actual originating and terminating points of the complete end-to-end call.''86 Paragraph 4.1 of the Second Starpower- Verizon Virginia Agreement similarly states that whether traffic is subject to local call transport and termination rates depends on the ``actual end-to-end jurisdictional nature of each call sent over the trunk.''87 27. We believe that each agreement's use of the phrase ``end-to-end'' is an incorporation of the Commission's long- standing method of determining the jurisdictional nature 
 
- http://www.fcc.gov/eb/Orders/2002/FCC-02-312A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 5 47 C.F.R. 1.1310, Note 1 to Table 1. 6 47 C.F.R. 1.1310, Note 2 to Table 1. 7 47 C.F.R. 1.1307(b). 8 The former Mass Media Bureau granted A-O's application for a license to cover 
 
- http://www.fcc.gov/eb/Orders/2002/FCC-02-314A1.html  
- ALLTEL Supplemental Answer and Century Supplemental Answer at IV-2 - IV-3, incorporating by reference Citizens Supplemental Answer at III-4. 119 MCI Telecommunications Corp. v. FCC, 59 F.3d 1407, 1414 (D.C. Cir. 1995), cert. denied, 517 U.S. 1129 (1996), quoting 47 U.S.C. 206 (emphasis added). 120 47 U.S.C. 209. 121 See 33, supra. 122 1 Dan B. Dobbs, Law of Remedies 4.1(1), at 555 (2d ed. 1993). 123 See id. 124 See MCI, 59 F. 3d at 1415. 125 Restatement (Third) of Restitution and Unjust Enrichment 17. 126 See Restatement (Third) of Restitution and Unjust Enrichment 1 cmt. H (Discussion Draft 2000) (``restitution . . . is itself a source of obligations, analogous in this respect to tort or contract. A liability 
 
- http://www.fcc.gov/eb/Orders/2003/FCC-03-258A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 5 47 C.F.R. 1.1310, Note 1 to Table 1. 6 47 C.F.R. 1.1310, Note 2 to Table 1. 7 See, for example, OET Bulletin 65. 8 See 47 C.F.R. 1.1307(b), 1.1307(b)(1), 1.1310. 9 Id. at 13520-21; 
 
- http://www.fcc.gov/eb/Orders/2004/FCC-04-281A1.html  
- Electromagnetic Fields,'' NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. (``IEEE'') and adopted by the American National Standards Institute (``ANSI'') in Section 4.1 of ``IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz,'' ANSI/IEEE C95.1-1992 (1992). 8Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://www.fcc.gov/eb/Orders/2005/DA-05-265A1.html  
- Provider [i.e., NIP] is in the business of providing Services . . .; and B. Customer desires to purchase Prepaid Calling Services from Provider for resale to Card Holders. Such language describing the parties' relationship does not differ materially among the Service Contracts. 29 See Revised Joint Statement at 5-6, 4; Service Contracts at 3.7 (custom branding) and 4.0 or 4.1 (technical support). 30 Revised Joint Statement at 7-8, 16. 31 Revised Joint Statement at 9, 20-21. See generally Uniform Commercial Code 2A-103 (stating that identification of the goods to be let is the sine qua non of a lease). 32 APCC Services et al. v. NetworkIP, Informal Complaint, File No. EB-02-MDIC-0017, at 2-4 (filed Mar. 29, 2002); APCC Services et 
 
- http://www.fcc.gov/eb/Orders/2006/FCC-06-173A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm^2 and 
 
- http://www.fcc.gov/eb/Orders/2007/DA-07-2279A1.html  
- Kent to Melanie Godschall, Investigations and Hearings Division, Enforcement Bureau, Federal Communications Commission, dated July 6, 2006. See Thompson Response at 5-6; Thompson Supplement to LOI Response at 8, 11-13. See Thompson Response at 5; Thompson Supplement to LOI Response at 8. See Thompson Response, Exhibit C. See id. The bar complaint cites the following Florida Rules of Professional Conduct: 4-4.1 (Truthfulness In Statements to Others), and 4-8.4 (Misconduct). See id. The bar complaint cites the following Florida Rule of Professional Conduct: 4-4.2 (Communication With Person Represented by Counsel). See Thompson Supplement to LOI response at 8. See Thompson Supplement to LOI Response at 11-12. See Letter from John B. Thompson, Attorney at Law, to Kevin J. Martin, Chairman, Federal Communications 
 
- http://www.fcc.gov/eb/Orders/2007/DA-07-4721A1.html  
- is unsupported by specific facts or analysis, and is undermined by the evidence of some boxing on NPTC's poles. Accordingly, we direct NPTC, within 60 days, to revise the Pole Attachment Agreement to eliminate this discriminatory provision. 1. The Pole Attachment Agreement Unreasonably Requires Salsgiver to Incur Make-Ready Costs With No Assurance That Those Costs Will Be Reasonable. 22. Section 4.1.3 of the Agreement provides that Salsgiver's submission of a pole attachment application is deemed to constitute Salsgiver's agreement to pay for the cost of the Make-Ready survey. Under the Agreement, NPTC is not required to provide, nor is Salsgiver apparently permitted to demand, an estimate of those costs before Salsgiver is deemed to have agreed to pay them. We find 
 
- http://www.fcc.gov/eb/Orders/2007/DA-07-5051A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm2 and 
 
- http://www.fcc.gov/eb/Orders/2007/FCC-07-124A1.html  
- such Commission rule or order. 22. This Consent Decree cannot be modified without the advance written consent of both Parties. 23. This Consent Decree may be signed in counterparts. For the Federal Communications Commission: ____________________________ Marlene H. Dortch Secretary ____________________________ Date For Verizon: ____________________________ Michael D. Poling Senior Vice President -- National Operations and Support ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). Under this provision, Verizon will not be required to provide outage reporting compliance training to employees whose responsibilities do not include gathering, analysis, or data entry of information regarding Verizon's network outages or compiling Verizon's outage reports, or whose involvement in Verizon's outage reporting activities is limited to performing job functions that are not 
 
- http://www.fcc.gov/eb/Orders/2008/DA-08-711A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ Kris Anne Monteith Chief Enforcement Bureau ____________________________ Date ____________________________ Thomas J. Sugrue Vice President, Government Affairs T-Mobile USA, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111 and 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Kathleen O'Brien Ham, T-Mobile USA, Inc. (Aug. 6, 2007). Id. Letter from David H. Solomon, Esq., Wilkinson Barker Knauer, LLP, to Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau (Sept. 5, 2007). Under this provision, 
 
- http://www.fcc.gov/eb/Orders/2009/FCC-09-27A1.html  
- Electromagnetic Fields," NCRP Report No. 86, Sections 17.4.1, 17.4.1.1., 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in Section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). Table 1 in Section 1.1310 of the Rules provides that the general population RFR maximum permissible exposure limit for a station operating in the frequency range of 30 MHz to 300 MHz is 0.200 mW/cm.2 47 
 
- http://www.fcc.gov/eb/Orders/2010/DA-10-2181A1.html  
- Decree may be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date ____________________________ Lohn Weber Chief Financial Officer Norlight, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(f). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. (November 18, 2009). Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to John Chuang, Corporate Counsel, Norlight, Inc. 
 
- http://www.fcc.gov/eb/Orders/2010/DA-10-2303A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Steve Nocella Senior Vice President Network Services XO Communications, LLC ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Heather Burnett Gold, Senior Vice President, External Affairs, XO Communications (May 21, 2010) ("LOI"). See LOI. E-mail from Todd D. Daubert, Esq., Sonnenschein Nath & Rosenthal, LLP to Kevin M. Pittman, Esq., Spectrum Enforcement Division, Enforcement Bureau 
 
- http://www.fcc.gov/eb/Orders/2010/DA-10-237A1.html  
- signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Bureau Chief Enforcement Bureau ____________________________ Date ____________________________ Scott W. McCloud Vice President-Wireless Networks Bluegrass Cellular, Inc. ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Ronald R. Smith, President, Bluegrass Cellular, Inc. (July 14, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Scott W. McCloud, Vice President, Wireless Networks, Bluegrass Cellular, Inc. 
 
- http://www.fcc.gov/eb/Orders/2010/DA-10-238A1.html  
- number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ William L. Roughton, Jr. Vice President, Legal and Regulatory Affairs Centennial Communications Corporation ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to Tony L. Wolk, Senior Vice President, General Counsel and Secretary, Centennial Corporation (August 15, 2008); Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission to William L. Roughton, Jr., 
 
- http://www.fcc.gov/eb/Orders/2011/DA-11-1362A1.html  
- of which counterparts together shall constitute one and the same fully executed instrument. ________________________________ P. Michele Ellison Chief Enforcement Bureau ________________________________ Date ________________________________ Stephen W. Crawford General Counsel and Senior Vice President, Mergers and Acquisitions Alpheus Communications, L.P. ________________________________ Date Alpheus Communications, L.P., Notice of Apparent Liability for Forfeiture, 25 FCC Rcd 8993 (Enf. Bur. 2010) ("NAL"). 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i), 503(b). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(f). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, to Stephen W. Crawford, Esq., General Counsel and Senior Vice President, Alpheus Communications, LP (September 10, 2009) ("LOI"). "User minutes" are defined as "assigned telephone number minutes ... for telephony and for 
 
- http://www.fcc.gov/eb/Orders/2011/DA-11-402A1.html  
- and the same fully executed instrument. For the Enforcement Bureau: ____________________________ P. Michele Ellison Chief, Enforcement Bureau ____________________________ Date AT&T: By: ____________________________ Paul Mancini Senior VP & Assistant General Counsel AT&T Services, Inc. 1120 20th Street, N.W. Suite 1000 Washington, DC 20036 ____________________________ Date 47 C.F.R. S: 4.9. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S:S: 4.1 et seq. 47 C.F.R. S: 4.9. Id. Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Jacquelyne Flemming, Executive Director Counsel, AT&T Services, Inc. (July 18, 2007). Letter from Peter H. Jacoby , General Counsel, AT&T Services, Inc., to Kathy Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission (August 24, 2007). Letter 
 
- http://www.fcc.gov/eb/Orders/2011/DA-11-816A1.html  
- Electromagnetic Fields," NCRP Report No. 86, sections 17.4.1, 17.4.1.1, 17.4.2, and 17.4.3 (1986). In the frequency range from 100 MHz to 1500 MHz, the MPE limits are also generally based on guidelines contained in the RF safety standard developed by the Institute of Electrical and Electronics Engineers, Inc. ("IEEE") and adopted by the American National Standards Institute ("ANSI") in section 4.1 of "IEEE Standard for Safety Levels with Respect to Human Exposure to Radio Frequency Electromagnetic Fields, 3 kHz to 300 GHz," ANSI/IEEE C95.1-1992 (1992). 47 C.F.R. S: 1.1310, Table 1 and Note 2. See 47 C.F.R. S:S: 1.1307(b), 1.1307(b)(1), 1.1307(b)(5); Guidelines, Second Memorandum Opinion and Order and Notice of Proposed Rulemaking, 12 FCC Rcd at 13538, 13540. See also, Public 
 
- http://www.fcc.gov/eb/Orders/2011/DA-11-968A1.html  
- be signed in any number of counterparts (including by facsimile), each of which, when executed and delivered, shall be an original, and all of which counterparts together shall constitute one and the same fully executed instrument. ____________________________ P. Michele Ellison Chief Enforcement Bureau ____________________________ Date ____________________________ Roger D. Linquist President and CEO MetroPCS California, LLC ____________________________ Date 47 C.F.R. S: 4.1 et seq. 47 U.S.C. S: 154(i). 47 C.F.R. S:S: 0.111, 0.311. 47 C.F.R. S: 4.9(e). See Letter from Kathryn S. Berthot, Chief, Spectrum Enforcement Division, Enforcement Bureau, Federal Communications Commission, to Mark A. Stachiw, Executive Vice President Metro PCS Communications, Inc. ("LOI") 47 C.F.R. S: 4.9(e). 47 C.F.R. S: 4.5(b). See LOI. See Letter from J. Christopher Luna, Staff Vice 
 
- http://www.fcc.gov/eb/Orders/da002431cd.doc  http://www.fcc.gov/eb/Orders/da002431cd.html  http://www.fcc.gov/eb/Orders/da002431cd.txt  
- in QUALCOMM's Petition. In consideration of the termination by the Enforcement Bureau of its inquiry into whether QUALCOMM may have violated the Commission's rules, and in accordance with the terms of this Consent Decree, QUALCOMM agrees to the following terms, conditions and procedures regarding compliance with Section 22.921. For the purposes of this Consent Decree, the following definitions shall apply: 4.1 ``Commission'' or ``FCC'' means the Federal Communications Commission; 4.2 ``Bureau'' means the Enforcement Bureau of the Federal Communications Commission; 4.3 ``QUALCOMM'' means QUALCOMM Incorporated; 4.4 ``Parties'' means QUALCOMM and the Bureau; and 4.5 ``Adopting Order'' means an order of the Bureau adopting the terms and conditions of this Consent Decree. The Parties agree that the provisions of this voluntary Consent 
 
- http://www.fcc.gov/enbanc/102998/tr102998.pdf  http://www.fcc.gov/enbanc/102998/tr102998.txt  http://www.fcc.gov/enbanc/102998/tr102998.wp  
- of providing LD service. 13 Some IXCs recover their ILEC flow-back portion from their 14 nationwide average toll rates, while others include it in 15 their end user USF recovery charges, thus raising the USF 16 line item on the bill. 17 AT&T has decided to charge 93 cents per month to 18 each of its residential accounts and a 4.1 percent surcharge 19 to its business customers, interstate revenues. Given that 20 each carrier has its own set of uncollectibles that it must 21 account for, it is not surprising that each would charge 22 their customer a different rate under the Universal Service 23 129 Heritage Reporting Corporation (202) 628-4888 banner. This has resulted in needless customer confusion. 1 
 
- http://www.fcc.gov/fcc-bin/audio/DA-06-2607A1.doc  http://www.fcc.gov/fcc-bin/audio/DA-06-2607A1.pdf  
- which provides that a transferor of a broadcast station license may retain ``no right of reversion of the license, no right to reassignment of the license in the future, and may not reserve the right to use the facilities of the station for any period whatsoever.'' 47 C.F.R. § 73.1150(a). See Objection at Exhibit C, § 2(g); Exhibit D, § 4.1 See December 27, 2005, Order at 2. Arecibo Radio Corp., Memorandum Opinion and Order, 101 FCC 2d 545 (1985); Radio Station WOW, Inc. v. Johnson, 326 U.S. 120, 131-32 (1945). Compare Kirk Merkley, Receiver, Memorandum Opinion and Order, 94 FCC 2d 829 (1983), recon. denied, Memorandum Opinion and Order, 56 RR 2d 413 (1984), aff'd sub nom. Merkley v. FCC, 
 
- http://www.fcc.gov/fcc-bin/audio/DA-08-1272A1.doc  http://www.fcc.gov/fcc-bin/audio/DA-08-1272A1.pdf  
- from the site and assembled on site. Id. at Section 1.2.4. The EA notes that the Snohomish River, a ``nearby wetland and ditched tributary creek, are located off site to the west'' and that there are no bodies of water or wetlands on the site. EA at Section 1.1. Id. at Section 1.2. Id. at Section 1.2.7. Id. at Section 4.1; see also EA, Figure 1, Site Location Map. Id. No endangered species were found to be present in the vicinity of the site. The bald eagle was de-listed by the USFWS on June 28, 2007. See Endangered and Threatened Wildlife . See EA, Attachment E, Biological Assessment, at 27. The BA also concludes that ``[n]o species were identified as proposed. 
 
- http://www.fcc.gov/fcc-bin/audio/DA-08-1891A1.doc  http://www.fcc.gov/fcc-bin/audio/DA-08-1891A1.pdf  
- to Nassau's violation of Section 73.3555(a) of the Commission's Rules. Sincerely, Peter H. Doyle Chief, Audio Division Media Bureau cc: David G. O'Neil, Esq. Capitol Broadcasting Corporation, Inc. Concord Broadcasting, LLC Letter to Capitol Broadcasting Corporation, Concord Broadcasting, LLC, and Nassau Broadcasting I, LLC, 23 FCC Rcd 5478 (MB 2008)(``WWHK Order''). See Application, Attachment 6, Joint Sales Agreement, at Section 4.1. WWHK Order, 23 FCC Rcd at 5480. See 47 C.F.R. § 73.3555(a)(1)(iii). See Broadcast Actions, Public Notice, Report No. 46168 (Feb. 8, 2006)(``Public Notice''). 47 C.F.R. §73.3555 Note 2(k)(1) (``Note 2''). Pursuant to Section 73.3555 Note 2(k)(1), a JSA that exceeds 15 percent of the weekly advertising time of a station is attributable to a party that owns other stations 
 
- http://www.fcc.gov/ib/sand/agree/files/can-bc/can-dtv.pdf  
-  F(50,10)] For F(90,90) calculations, add 7.1 dB in the UHF band or 6.1 dB in the VHF bands, to the F(50,90) values. For F(10,10) calculations, subtract the above from the F(50,10) values. Where the letter of understanding calls for use of the Longley-Rice model, it will be version 2.1 unless otherwise agreed by exchange of correspondence. 4. Separation Tables 4.1 Class Definitions These class definitions were developed for Canadian domestic use and are applied to US DTV allotments only to permit the use of the distance separations in an efficient manner. DTV Allotments Class VL  DTV allotments replacing low VHF band NTSC, protected coverage 89 km Class VU  DTV allotments replacing upper VHF band NTSC, protected coverage 82 
 
- http://www.fcc.gov/ib/sand/agree/files/can-nb/24-38fin.pdf  
- request. 3.5 If a license is transferred, the agreement(s) developed by the former licensee (see Section 4) shall continue to apply with respect to the new licensee until a new agreement is reached. 3.6 The Administrations reserve the right to impose appropriate technical limitations to facilitate reasonable implementation and operation of proposed or existing systems. 4. Cross Border Coordination Process 4.1 Sharing Agreements - Licensees on both sides of the border are encouraged to develop sharing agreements that will facilitate reasonable and timely development of broadband wireless systems.3 These agreements should allow for the provision of service by each licensee within its licensed service area to the maximum extent possible. If there is a sharing agreement between the licensees, that agreement 
 
- http://www.fcc.gov/ib/sand/agree/files/can-nb/806-890.pdf  
- and 851-866 MHz Bands Outs& of the Sharing and Protection Zones. Beyond 140 km from the border, the Agencies have unrestricted use of these bands. TL4s 12529 7 4. Special Sharing Arrangements In recognition of particular demographic circumstances of the border arca, the Agencies am60n the unequal division of spectnun between Canada and the united states'% the following two sectors: 4.1 a) Sector I: Sector 1 is defined to be the portion of Sharing Zone I in the United States ahd Canada, bounded on the West by 85OW lmgitudt and on the East by 81OW longitude. In this Sector, the United States has the unrtstricted gtopphic usc of the bands 806.ooOO to 811.2500 MHz, 815.7500 to 821.oooO MHz, 851.oooO to 856.2500 
 
- http://www.fcc.gov/ib/sand/agree/files/can-nb/lmdsagre.pdf  
- agreement(s) (see Section 4) or coordination agreement(s) (see Section 5) developed by the former licensee shall continue to apply with respect to the new licensee until a new agreement is reached. 3.5 The Agencies reserve the right to impose appropriate technical limitations to facilitate reasonable implementation and operation of proposed or existing systems. 4. Coordination in the 27 GHz Band 4.1 27.5  28.35 GHz Band - Coordination of LMDS and LMCS systems in the 27.5-28.35 GHz band shall be carried out by the licensees for the respective service areas on both sides of the border, as indicated in Appendix A. This coordination shall be in accordance with Sections 4.3-4.5. 4.2 27.35  27.5 GHz Band - For the purposes of 
 
- http://www.fcc.gov/ib/sand/agree/files/can-nb/mds2way.pdf  
- a body of water, the power flux density shall be calculated at the shoreline of the neighboring service area. 5 For operation where the transmitted bandwidth is other than 6 MHz, the pfd value should be adjusted accordingly. For example, for a 1 MHz bandwidth, the pfd value corresponding to -108 dBW would be -115.8 dBW. 4 4. Information exchange 4.1 The Administrations will exchange licensee names and points of contact to allow the licensees to contact the relevant licensee(s) on the other side of the border in order to facilitate licensee-to-licensee coordination in accordance with this Arrangement. 4.2 To facilitate cross-border coordination between licensees, the licensees are encouraged to exchange data as listed in Annex A to this Arrangement. 5 
 
- http://www.fcc.gov/ib/sand/agree/files/can-nb/wcsagree.pdf  
- in this case would require the agreement of both Administrations. 3.4 Any WCS station will require further coordination if proposed modifications would: (a) result in the pfd at or beyond the border exceeding -110 dB(W/m2) in any 1 MHz bandwidth; (b) involve operation on frequencies not previously coordinated; or (c) change the polarization. 4. Coordination with Existing Fixed Microwave Stations 4.1 Licensees of WCS systems with stations located within 120 km of existing fixed microwave stations that have been authorized by the other Administration prior to the date of this Arrangement are required to coordinate with licensees of such fixed microwave stations if the WCS station would produce a pfd exceeding - 110 dB(W/m2) in any 1 MHz bandwidth at or 
 
- http://www.fcc.gov/ib/sand/agree/files/mex-bc/am.pdf  
- assignment of the same frequencyt0substitutefor the cancelled assignment. . In such case,the Administrationshall retain,with respect to the substituting assignment, the rights and obligations of thecancelled assignment, including . priority. However, suchnewassignmentwillnot be permitted to cause objectionable interference to existing stations in the other country at alevel in excess ofthat caused by the cancelled assignment, and which has ken previously accepted. 4.1 4.2 e ARTICLE 4 Notification procedure The date of a notification will be deterruined by the date on which the required information submitted in conformity with this Article is received by the other Administration. If a conflict ,exists between two or morevalidnotifications, prioritywill be given to the notification which has the earlier date of receipt. The information required for the 
 
- http://www.fcc.gov/ib/sand/agree/files/mex-nb/pcs1850e.pdf  
- along the common border for the provision of PCS services within their respective countries. 2. The band 1910-1930 MHz has been designated in both countries for very low power PCS use. 3. Both Administrations agree to not authorize any new users in the 1850-1990 MHz band for operations of the fixed point-to-point service. 4. Coordination with Fixed Point-to-Point Service Operations 4.1Both Administrations agree that the provision of any new PCS service shall be on the basis that harmful interference is not caused to existing stations in the -4- fixed point-to-point service authorized by the other Administration. Both Administrations agree to exchange information on current stations in the fixed point-to-point service before 18 July 1995. 4.2Both Administrations agree to require coordination of 
 
- http://www.fcc.gov/ib/sand/mniab/traffic/files/ITRND01.pdf  
- Total International Total Toll Facilities- Based, Facilities- Pure Telephone Record TelexTelegraphOther End Carrier's End Carrier's End Carrier's Resale, and Resale User Carrier & User Carrier & UserCarrier & ISR 3/ 3/ 4/ End User 4/ End User 4/ End User 4/ 1950 $9.0 $0.2 $1.1 $39.3 $49.5 $49.5 $1,245 4.0 % 1951 12.1 0.3 1.9 $0.2 42.6 54.9 57.2 1,403 4.1 1952 15.4 0.3 2.8 0.4 41.3 57.2 60.3 1,535 3.9 1953 13.1 0.3 3.7 0.7 42.5 56.2 60.2 1,642 3.7 1954 13.7 0.2 4.3 0.8 45.0 59.5 64.0 1,796 3.6 1955 15.7 0.2 4.8 1.2 46.6 63.6 68.6 2,049 3.3 1956 18.7 0.3 5.3 1.9 49.8 70.4 76.0 2,277 3.3 1957 22.7 0.6 6.0 2.8 50.3 75.8 82.4 2,525 3.3 
 
- http://www.fcc.gov/ib/sand/mniab/traffic/files05/CREPOR05.pdf  
- at 5723-24, paras. 27-28. Currently, 165 routes are exempted from the ISP. See U.S.-Cambodia Route Exempted from the International Settlements Policy, Public Notice, IB Docket Nos. 02-324, 96-261, 20 FCC Rcd 963 (Int'l. Bur. 2005). 5 For example, carriers reported 4.8 billion minutes of non-traditional settlement traffic for Canada, and 1.9 billion minutes for the United Kingdom. They also reported 4.1 billion and 1.5 billion, respectively, minutes of traditional settlement traffic for each country. The Commission has permitted non-traditional settlement arrangements for U.S.-Canada and U.S.-U.K. traffic since 1992 and 1994, respectively. It is therefore unlikely that carriers are in fact settling substantial amounts of traffic on these two U.S. international routes under traditional settlement arrangements. 5 Reporting Requirements Different levels of 
 
- http://www.fcc.gov/ib/sand/mniab/traffic/files06/CREPOR06.PDF  
- 54.4 $561,771 0.0 0.0 0.0 0.0100.0 $27,977 0.0 0.0 0.0 0.0100.0 76,845,009 0.016.5 1.617.8 64.1 Angola $6,702,223 0.023.6 6.1 7.9 62.4 $142,872 0.0 0.0 0.0 0.0100.0 $22,706 0.0 0.0 0.0 0.0100.0 26,262,698 0.014.910.016.6 58.5 Benin $2,187,003 0.0 6.1 7.243.2 43.5 $92,925 0.0 0.0 0.0 4.8 95.2 $128 0.0 0.0 0.0 0.0100.0 27,092,126 0.0 2.1 8.648.6 40.7 Botswana $5,664,507 0.876.5 0.0 4.1 18.5 $101,935 0.0 5.9 0.0 0.0 94.1 $48 0.0 0.0 0.0 0.0100.0 33,593,992 0.571.6 0.0 5.3 22.6 Burkina $3,199,797 0.017.1 8.546.1 28.3 $206,928 0.0 0.0 0.010.3 89.7 $1,803 0.0 0.0 0.0 0.0100.0 21,276,558 0.011.7 7.951.2 29.3 Burundi $372,892 0.016.613.836.6 33.1 $108,780 0.0 0.0 0.0 0.0100.0 $501 0.0 0.0 0.0 0.0100.0 6,566,244 0.010.8 4.727.1 57.4 Cameroon $13,086,623 2.618.9 1.132.6 44.8 $994,922 
 
- http://www.fcc.gov/ib/sand/mniab/traffic/files07/CREPOR07.PDF  
- 13.3 0.0 17.5 69.2 $64,481,819 0.0 0.0 0.0 0.0100.0 4,547,339,581 0.2 13.8 1.0 30.5 54.6 Western Europe $776,307,034 0.1 28.5 1.3 20.9 49.2 $81,479,312 0.0 18.1 0.0 26.3 55.6 $170,351,650 0.0 0.0 0.0 0.0100.0 13,979,516,518 0.1 15.7 1.9 31.3 51.1 Algeria $8,715,356 0.0 7.0 4.3 21.5 67.3 $411,827 0.0 0.0 0.0 0.0100.0 $4,619 0.0 0.0 0.0 0.0100.0 89,141,636 0.0 4.7 4.1 21.9 69.3 Angola $7,410,226 0.0 30.6 1.3 22.9 45.2 $48,675 0.0 0.0 0.0 0.0100.0 $31,630 0.0 0.0 0.0 0.0100.0 39,282,697 0.0 19.5 1.4 34.8 44.2 Benin $3,447,338 0.0 11.6 9.7 33.0 45.8 $115,134 0.0 0.0 0.0 8.4 91.6 $316,380 0.0 0.0 0.0 0.1 99.9 32,274,360 0.0 7.3 10.6 33.4 48.6 Botswana $1,888,740 0.2 61.9 0.0 4.9 32.9 $100,152 0.0 3.9 
 
- http://www.fcc.gov/ib/sand/mniab/traffic/files08/CREPOR08.PDF  
- 0.0 0.0 0.0 30.3 69.7 $3,945,605 0.0 0.0 0.0 0.0100.0 1,790,893,162 0.0 0.2 1.5 29.5 68.8 Albania $10,396,947 0.0 0.0 11.0 12.4 76.6 $134,709 0.0 0.0 0.0 0.0100.0 $1,204 0.0 0.0 0.0 0.0100.0 71,484,158 0.0 0.0 12.2 13.9 73.9 Armenia $3,193,530 0.0 0.0 4.9 39.8 55.3 $15,137 0.0 0.0 0.0 2.0 98.0 $966 0.0 0.0 0.0 0.0100.0 56,537,886 0.0 0.0 4.1 36.1 59.7 Azerbaijan $4,302,024 0.0 0.0 1.7 27.7 70.6 $70,540 0.0 0.0 0.0 6.4 93.6 $9,154 0.0 0.0 0.0 36.8 63.2 37,063,226 0.0 0.0 1.9 26.3 71.8 Belarus $15,337,354 0.0 0.0 1.6 21.5 76.9 $103,220 0.0 0.0 0.0 61.4 38.6 $9,175 0.0 0.0 0.0 0.0100.0 84,346,937 0.0 0.0 1.9 22.2 75.9 Bosnia and Herzegovina $8,690,840 0.0 0.0 6.5 16.7 76.8 
 
- http://www.fcc.gov/mb/audio/alphaindex.html  
- [309]I [310]L [311]IBOC (In-Band On-Channel) Digital AM and FM Radio [312]Indecent or Obscene Broadcasts * Industry Guidance on the Commission's Case Law Interpreting 18 U.S.C. 1464 and Enforcement Policies Regarding Broadcast Indecency, Policy Statement, FCC 01-90, 16 FCC Rcd 7999, released April 6, 2001. [ [313]PDF | [314]MS Word 97 | [315]Text ] [316]Information about Applications [317]Interference Handbook (1993 Edition). 4.1 MB, PDF. Interference to FAA Installations from AM Stations: [318]"The FAA and FCC Agree to Simplify Procedures for Certain EMI Cases", Public Notice, released 4/16/1991. (AM Radio is the only broadcast service to which this Public Notice applies). [319]Inspection Authority -- This fact sheet, compiled by the [320]Enforcement Bureau, addresses some of the more common questions asked about inspections of 
 
- http://www.fcc.gov/mb/audio/decdoc/engrser.html  
- Inc., [WMJX (FM), Boston, MA] MO&O, FCC 93-300, 8 FCC Rcd 4065, released June 15, 1993 [ [566]PDF ]. NOTE: In the absence of any listener complaints, RITOIE interference did not require WMJX to satisfy listener complaints. The blanketing interference rule, 47 CFR 73.318, does not apply to RITOIE. 1993 Interference Handbook 1993 Edition; no longer updated [ [567]PDF ] (4.1 MB). NOTE: This handbook was produced by the former Field Operations Bureau of the FCC. Addresses, phone numbers, and FCC field office locations are long out of date. Search for businesses' web sites to obtain current contact information. December 2, 1992 Forus FM Broadcasting of New York, Inc. [WVOA-FM1] MO&O, DA 92-1547, 7 FCC Rcd 7880, released December 2, 1992 
 
- http://www.fcc.gov/mb/audio/includes/30-engrser.htm  
- Inc., [WMJX (FM), Boston, MA] MO&O, FCC 93-300, 8 FCC Rcd 4065, released June 15, 1993 [ [520]PDF ]. NOTE: In the absence of any listener complaints, RITOIE interference did not require WMJX to satisfy listener complaints. The blanketing interference rule, 47 CFR 73.318, does not apply to RITOIE. 1993 Interference Handbook 1993 Edition; no longer updated [ [521]PDF ] (4.1 MB). NOTE: This handbook was produced by the former Field Operations Bureau of the FCC. Addresses, phone numbers, and FCC field office locations are long out of date. Search for businesses' web sites to obtain current contact information. December 2, 1992 Forus FM Broadcasting of New York, Inc. [WVOA-FM1] MO&O, DA 92-1547, 7 FCC Rcd 7880, released December 2, 1992 
 
- http://www.fcc.gov/mb/peer_review/docs/prtpkieschnick.pdf  
- market-size grouping." However, the top line of the table states: "Number of Stations Included." to describe the entries in each year column. So, which is it: number of stations or number of markets? 4. Tables 2, 3, 4, 5, and 6 reported the same information but for different market segments (e.g., 51-75, etc.). Consequently all these tables share common problems. 4.1 Each table has columns for the "cash flows" of high rated stations and low-rated stations. On page 4, footnote 2, the report defines "cash flow as net revenues minus total expenses." Then on this same page in footnote 3, the author defines "pre-tax profits" as "cash flow minus depreciation & amortization & interest." If the author is following the standard 
 
- http://www.fcc.gov/mb/peer_review/peerreview.html  
- http://www.fcc.gov/mb/peer_review/prreqlpfm_rpt.pdf 49. http://www.fcc.gov/mb/peer_review/prlpfm_rpt_economic_study.pdf 50. http://www.fcc.gov/mb/peer_review/DOC-263786A3.pdf 51. http://www.fcc.gov/mb/peer_review/DOC-263786A2.pdf 52. http://www.fcc.gov/mb/peer_review/DOC-263786A1.pdf 53. http://fjallfoss.fcc.gov/edocs_public/attachmatch/DOC-263740A1.pdf 54. http://fjallfoss.fcc.gov/prod/ecfs/retrieve.cgi?native_or_pdf=pdf&id_document=6518910850 55. http://fjallfoss.fcc.gov/prod/ecfs/retrieve.cgi?native_or_pdf=pdf&id_document=6518910851 56. http://www.fcc.gov/mb/peer_review/prsharkmem.pdf 57. http://www.fcc.gov/mb/peer_review/prgreggmem.pdf 58. http://fjallfoss.fcc.gov/prod/ecfs/retrieve.cgi?native_or_pdf=pdf&id_document=6518330966 59. http://www.fcc.gov/mb/peer_review/prstudy1.pdf 60. http://www.fcc.gov/mb/peer_review/prreqstudy1.pdf 61. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A2.pdf 62. http://www.fcc.gov/mb/peer_review/prstudy2.pdf 63. http://www.fcc.gov/mb/peer_review/prreqstudy2.pdf 64. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A3.pdf 65. http://www.fcc.gov/mb/peer_review/prstudy3.pdf 66. http://www.fcc.gov/mb/peer_review/prstudy3a.pdf 67. http://www.fcc.gov/mb/peer_review/prreqstudy3.pdf 68. http://www.fcc.gov/mb/peer_review/prreqstudy3a.pdf 69. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A4.pdf 70. http://www.fcc.gov/mb/peer_review/prrespstudy4.pdf 71. http://www.fcc.gov/mb/peer_review/prrespstudy4a.pdf 72. http://www.fcc.gov/mb/peer_review/prrespstudy4b.pdf 73. http://www.fcc.gov/mb/peer_review/prrespstudy4c.pdf 74. http://www.fcc.gov/mb/peer_review/prstudy4.pdf 75. http://www.fcc.gov/mb/peer_review/prstudy4a.pdf 76. http://www.fcc.gov/mb/peer_review/prstudy4b.pdf 77. http://www.fcc.gov/mb/peer_review/prstudy4c.pdf 78. http://www.fcc.gov/mb/peer_review/prstudy4.1.pdf 79. http://www.fcc.gov/mb/peer_review/prstudy4.1a.pdf 80. http://www.fcc.gov/mb/peer_review/prreqstudy4.pdf 81. http://www.fcc.gov/mb/peer_review/prreqstudy4a.pdf 82. http://www.fcc.gov/mb/peer_review/prreqstudy4b.pdf 83. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A5.pdf 84. http://www.fcc.gov/mb/peer_review/prstudy5.pdf 85. http://www.fcc.gov/mb/peer_review/prreqstudy5.pdf 86. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A6.pdf 87. http://transition.fcc.gov/mb/peer_review/prrespstudy6.pdf 88. http://www.fcc.gov/mb/peer_review/prstudy6.pdf 89. http://www.fcc.gov/mb/peer_review/prstudy6a.pdf 90. http://www.fcc.gov/mb/peer_review/prreqstudy6.pdf 91. http://www.fcc.gov/mb/peer_review/prreqstudy6a.pdf 92. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A7.pdf 93. http://www.fcc.gov/mb/peer_review/prstudy7.pdf 94. http://www.fcc.gov/mb/peer_review/prstudy7a.pdf 95. http://www.fcc.gov/mb/peer_review/prreqstudy7.pdf 96. http://www.fcc.gov/mb/peer_review/prreqstudy7a.pdf 97. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A8.pdf 98. http://www.fcc.gov/mb/peer_review/prstudy8.pdf 99. http://www.fcc.gov/mb/peer_review/prreqstudy8.pdf 100. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A9.pdf 101. http://www.fcc.gov/mb/peer_review/prstudy9.pdf 102. http://www.fcc.gov/mb/peer_review/prreqstudy9.pdf 103. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A10.pdf 104. http://www.fcc.gov/mb/peer_review/prstudy10.pdf 105. http://www.fcc.gov/mb/peer_review/prreqstudy10.pdf 106. http://hraunfoss.fcc.gov/edocs_public/attachmatch/DA-07-3470A11.pdf 107. http://www.fcc.gov/encyclopedia/peer-review-agenda 108. http://www.fcc.gov/mb/peer_review/reviews.html 
 
- http://www.fcc.gov/ogc/documents/opinions/1999/usta.html  http://www.fcc.gov/ogc/documents/opinions/1999/usta.wp  
- the FCC accord-ed the greatest weight to its own estimates, although it also gave "some weight" to AT&T's estimates (we discuss this decision below). See 1997 Order, 12 FCC Rcd at 16,695, 37. The estimates the FCC considered, and the averages of those estimates over specified periods, are the following: Table 1 Year FCC AT&T 1986 0.5% 0.2% 1987 5.0 4.1 1988 5.0 6.4 1989 7.9 8.8 1990 8.8 11.0 1991 5.8 6.0 1992 3.4 4.1 1993 4.7 6.0 1994 5.4 5.9 1995 6.8 9.4 Specified periods (averaged) 1986-95 5.2 6.2 1987-95 5.9 6.9 1988-95 6.0 7.2 1989-95 6.1 7.3 1990-95 5.8 7.1 1991-95 5.2 6.3 Range of Averages: 5.2-6.1 6.2-7.3 1997 Order, 12 FCC Rcd at 16,696, 137. The FCC 
 
- http://www.fcc.gov/ogc/documents/opinions/2003/02-1131.pdf  
- 5 2. The 1999 Agreement In June 1999 Starpower notified Verizon that it intended to adopt the terms of an agreement Verizon had made with MCImetro Access Transmission Services of Virginia, Inc. in July 1997. The 1999 Agreement between Starpower and Verizon, which the VSCC approved in April 2000, contains the following provisions relevant to this dispute over reciprocal compensation: 4.1 [Starpower] may choose to deliver both Local Traf- fic and toll traffic over the same trunk group(s)TTTT In the event [Starpower] chooses to deliver both types of traffic over the same traffic exchange trunks, and desires application of the local call transport and termination rates, it will provide Percent Local Usage (``PLU'') infor- mation to [Verizon]TTTT In the event [Starpower] 
 
- http://www.fcc.gov/omd/contracts/pre-award/RFQ11000022.pdf  
- (NBIPVPN) ................................................................. 4 2.2 Private Line Service (PLS) ............................................................................................... 4 3 SERVICE REQUIREMENTS ............................................................................................ 5 3.1 Network Based IP-VPN Service ...................................................................................... 5 3.1.1 Network Based IP-VPN Service Requirements .......................................................... 5 3.1.2 Network-Based IP VPN CLINs .................................................................................. 5 3.2 Private Line Service (PLS) ............................................................................................... 6 3.2.1 PLS Requirements ...................................................................................................... 6 3.2.2 PLS CLINs: ................................................................................................................. 6 4 AGENCY SPECIFIED SERVICES ................................................................................... 7 4.1 Service Enabling Devices (SEDs) ..................................................................................... 7 5 PERFORMANCE MEASURES ......................................................................................... 9 6 GOVERNMENT FURNISHED EQUIPMENT AND INFORMATION .......................... 9 7 TRANSITION REQUIREMENTS ..................................................................................... 9 7.1 Transition Plan .................................................................................................................. 9 8 PLACE OF PERFORMANCE ......................................................................................... 10 9 PERIOD OF PERFORMANCE ....................................................................................... 10 10 BID MODEL/PRICING TABLE ..................................................................................... 11 10.1 NBIP-VPNs ...................................................................................................................... 11 10.2 PLS ................................................................................................................................... 20 11 INSTRUCTIONS TO OFFERORS .................................................................................. 
 
- http://www.fcc.gov/omd/contracts/pre-award/RevisedSOW-110729.pdf  
- evaluate offers for products or services. The contractor agrees that it will neither evaluate, nor advise the Government with regard to, its own products or services. In addition, the contractor agrees it will objectively evaluate, and advise the Government concerning, the products or services of its actual or prospective competitors. Federal Communications Commission FCC-SOL11000004 Page 4 of 8 4.0 NON-DISCLOSURE 4.1 In the course of performance pursuant to this task order, the contractor will access nonpublic information, including acquisition sensitive information. The contractor agrees that it will not use or disclose any such information unless authorized by the Contracting Officer. 4.2 The contractor further agrees that it will use its best efforts to ensure that its employees and others performing services 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-broadband-dead-zone-report.pdf  
- the information sharing that they will receive. Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. The Broadband Dead Zone Report and Consumer Broadband Test are only collecting data for these 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-ccd.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-core-financial.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-criminal-investigative-files.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-crisis.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-dqc.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-ecfs.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-email.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-experimental-radio.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-faca.pdf  
- the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 21 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-financial.pdf  
- Data sharing in accordance with Federal quidelines Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-foia.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-general-investigative-files.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-ils.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-investigations-hearings.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-labor-employee-relations.pdf  
- the MOU, or other "matching agreement?" 21 Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-lmts.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-pams.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-pay-leave-garnish.pdf  
- between the FCC and the other participants. Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. 22 Information is complete. Information 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-personal-security-files.pdf  
- the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 23 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-physical-access.pdf  
- the MOU, or other "matching agreement?" 22 Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-reasonable-accommodation-requests.pdf  
- the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 21 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-remedy.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-rmis.pdf  
- sharing and/or transmission activities by all parties. Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-small-business-contacts.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-telephone-call-details.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-transit.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-uls.pdf  
- insure that there are no data breaches.. Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. 24 Information is reliable for its intended use(s). Information is accurate. Information is complete. Information 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pia-violators.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/omd/privacyact/System_of_records/pshsb-coop-plan.pdf  
- under the MOU, or other "matching agreement?" Section 4.0 Data Quality, Utility, Objectivity, and Integrity Requirements: OMB regulations require Federal agencies to insure that the information/data that they collect and use meets the highest possible level of quality and integrity. It is important, therefore, that the information the Commission's information systems use meets the "benchmark standards" established for the information. 4.1 How will the information that is collected from FCC sources, including FCC employees and contractors, be checked for accuracy and adherence to the Data Quality guidelines? (Please check all that apply) Information is processed and maintained only for the purposes for which it is collected. Information is reliable for its intended use(s). Information is accurate. Information is complete. Information is 
 
- http://www.fcc.gov/ownership/materials/already-released/localismwelfare060005.pdf  
- 2ThisresultisnotspecifictotheHotellinglineardemandframework,butholdsforany discretechoicemodelwithtwoalternativesandnooutsideoption.SeeAndersonandde Palma(2001)forrelatedresults. 8 andforthelargefirm, 0 1= P = 0 2 0( 0) (18) Wecannowusetheadvertisingchoiceequations(14)and(15)torewrite(17) and(18)as: (1 ) = 0( 1) (19) and P = = 0( 0) (20) Thesecanbesummed,aswiththeanalysisofthefixedadsmodel,togive thesameequilibriumrelationsasthere,exceptwithnow replacing .For futurereference,wecanalsouse(16)towrite(19)and(20)as: µ1 2 6 ¶ = 0( 1), = (21) and P = µ1 2+ 6 ¶ = 0( 0) (22) Notethattheseequationsdefineasystemsolelyintermsofqualities.Clearly, thefirstoftheseindicates(sincethevalueof 0isthesameineach )that smallermarketshavesmallerqualities.Theycorrespondinglyselllessadvertis- ing,andtheyalsohavefewerviewers,andmakelessprofit. 4.1Secondbestoptimum Optimalqualitychoicemaybeevaluatedusingseveraldi erentbenchmarks (suchasthefirst-best,whenbothadvertisingandqualitiesaredeterminedop- timally,etc.).Wetakeasgiventhatfirmschooseadlevelsandsoconsidernow thesecondbestoptimumallocationofqualities.Thischoicereflectstheideaof notregulatingallmarketaspects,andaimstoshedlightonwhetherthequality levelsareintrinsicallysub-optimal.Theissueisthentheoptimalqualitychoice giventhatadvertisinglevelsaretobesetgiventhequalities.Thewelfaremax- imandisthesumofconsumersurplusandadvertisingrevenues,andcostsof providingqualityaretobesubtracted. Recallfromtheproduceranalysisthatadlevelsare2 timesmarketshares, andthesemarketsharesare =12+ 6 (see(16)). Thechoiceof 1thenentails: {(1 )(1 1 1+ 0 1)+ ł 1 1 0 1 ´+ 0 1+ 0 1+ (1 ) 1 1 1 1} 0( 1)=0 9 Thefirstterminparenthesesisthechangeinconsumersurplusforthe viewersofchannel1inmarket ,thesecondtermisthechangeinconsumer surplusfortheviewersofchannel0,andtheothertermsarethechangesin advertisingbenefits. Substitutingtherelations 1= 1 6 , 0 1= 0 1= 1 3 ,and 
 
- http://www.fcc.gov/ownership/materials/already-released/review090001.pdf  
- that focus on the operating performance of radio companies (i.e., EBIT margins and net profit margins). Ratios that shed light on the financing of radio companies are then explored (i.e., total debt as a percentage of total capital, fixed charge coverage after taxes, market to book ratio, and stock market returns). All charts appear at the end of this section. 4.1 EBIT Margins The earnings before interest and taxes margin (EBIT Margin) is defined as the ratio of a firm's earnings (before subtracting out interest and taxes) to the firm's total sales.23 As such, this ratio reflects how efficiently the firm generates profits from its sales, or alternatively stated, how well the firm minimizes the operating, personnel and administrative costs of 
 
- http://www.fcc.gov/ownership/materials/already-released/survivor090002.pdf  
- 60.2 32.3 27.8 46.2% 33.5 55.6% 11-20 34.6 23.4 11.3 32.7% 15.5 44.8% 21-30 27.0 20.4 6.5 24.1% 10.8 40.0% 31-40 19.0 15.5 3.5 18.4% 7.3 38.4% 41-50 14.0 12.7 1.3 9.3% 4.9 35.0% 51-60 13.7 10.2 3.5 25.5% 5.9 43.1% 61-70 11.0 8.8 2.2 20.0% 4.5 40.9% 71-80 9.7 9.5 0.2 2.1% 3.0 30.9% 81-90 10.8 8.7 2.0 18.5% 4.1 38.0% 91-100 9.4 8.7 0.7 7.4% 3.2 34.0% 101-110 7.8 6.8 1.0 12.8% 3.0 38.5% 111-120 6.8 6.4 0.4 5.9% 2.1 30.9% 121-130 6.8 6.2 0.6 8.8% 2.1 30.9% 131-150 5.7 5.1 0.6 10.5% 1.9 33.3% 151-175 5.3 4.6 0.7 13.2% 1.9 35.8% 176+ 4.0 3.4 0.7 17.5% 1.5 37.5% Source: National Association of Broadcasters, Television Financial Report, 2001 ed., 
 
- http://www.fcc.gov/ownership/roundtable_docs/waldfogel-b.pdf  
- Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemp. Hit Radio (CHR, top40) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5 4.2 6.3 
 
- http://www.fcc.gov/ownership/roundtable_docs/waldfogel-c.pdf  
- Oriented Rock/New Rock 3.0 3.7 0.5 3.1 3.3 1.9 Album Oriented Rock/Progressive 1.0 1.3 0.1 1.8 1.6 0.6 Black 7.5 1.7 32.5 1.6 4.0 1.6 Black/Adult Contemp. 3.2 0.8 18.3 1.4 4.6 1.7 Black/Gospel 1.2 0.0 1.8 0.1 0.0 0.0 Black/Oldies 1.0 0.1 2.4 0.3 0.5 0.0 Black/Talk 0.2 0.0 1.4 0.3 0.4 0.0 Big Band/Nostalgia 4.7 4.2 0.5 4.2 4.1 1.2 Big Band/Nostalgia/Religious 0.0 0.0 0.0 0.1 0.0 0.0 Country 13.0 11.9 1.5 10.6 8.7 4.0 Country/Full Service 0.1 0.2 0.0 5.2 6.0 8.6 Contemporary Hit Radio (CHR) 5.6 6.7 2.5 0.4 0.8 0.4 CHR/Adult Contemp. 0.8 0.9 0.3 0.1 0.0 0.0 CHR/New Rock 0.2 0.3 0.1 0.1 0.2 0.0 Contemporary Hit Radio/Urban 1.1 2.7 7.7 1.5 4.2 6.3 Classical 
 
- http://www.fcc.gov/pshs/docs-psap/nena-aid062505.pdf  
- TECHNICAL IMPACTS SUMMARY......................................................................................................................6 2.5 DOCUMENT TERMINOLOGY..............................................................................................................................6 2.6 REASON FOR REISSUE......................................................................................................................................6 2.7 COST FACTORS.................................................................................................................................................6 2.8 COST RECOVERY CONSIDERATIONS.................................................................................................................7 2.9 ACRONYMS/ABBREVIATIONS...........................................................................................................................7 3 MUTUAL AID AGREEMENTS......................................................................................................................8 3.1 PARTIES...........................................................................................................................................................8 3.2 AUTHORITY......................................................................................................................................................8 3.3 DEFINITIONS....................................................................................................................................................8 3.4 ASSISTANCE TO BE RENDERED.........................................................................................................................8 3.5 CONDITION(S) FOR IMPLEMENTATION..............................................................................................................8 3.6 REQUEST FOR IMPLEMENTATION......................................................................................................................8 3.7 IMPLEMENTATION............................................................................................................................................8 3.8 DEMOBILIZATION.............................................................................................................................................9 3.9 COMPENSATION...............................................................................................................................................9 3.10 INSURANCE......................................................................................................................................................9 3.11 LIABILITY.........................................................................................................................................................9 3.12 MAINTENANCE.................................................................................................................................................9 3.13 EXCLUSIVITY...................................................................................................................................................9 3.14 SIGNATURES.....................................................................................................................................................9 4 REFERENCES.................................................................................................................................................10 4.1 AMERICAN RADIO RELAY LEAGUE................................................................................................................10 4.2 COMMONWEALTH OF KENTUCKY STATEWIDE EMERGENCY MANAGEMENT MUTUAL AID AND ASSISTANCE AGREEMENT.................................................................................................................................................................10 4.3 FLORIDA CHAPTER ASSOCIATED PUBLIC SAFETY COMMUNICATIONS OFFICIALS..........................................10 4.4 NORTH CAROLINA CHAPTER OF THE NATIONAL EMERGENCY NUMBER ASSOCIATION..................................10 4.5 NORTH CAROLINA STATEWIDE EMERGENCY MANAGEMENT MUTUAL AID AND ASSISTANCE AGREEMENT..10 4.6 STATE OF WASHINGTON MUTUAL AID AND INTERLOCAL AGREEMENT.........................................................10 5 EXHIBITS........................................................................................................................................................11 5.1 SAMPLE INTERSTATE MUTUAL 
 
- http://www.fcc.gov/pshs/docs-radio/NcarolinaPlan04.pdf  
- traffic and to secure all the highway access points. This was December 2004 16 VOICE COMMUNICATIONS SYSTEM achieved by adding eleven new sites to the Motorola SmartZone 3.0 system purchased from the Special Olympics. The State Highway Patrol partnered with Wake County in 1999 to upgrade the State Highway Patrol's existing SmartZone 3.0 system to a mixed mode Motorola SmartZone 4.1 system and support the additional sites needed to provide countywide coverage. This partnership has allowed the State Highway Patrol to upgrade its older system and position itself to support digital communications and expand the coverage in the Wake and surrounding areas. Senator Edwards and Congressman Price were successful in securing a federal grant of nearly $1m in 2003 to expand 
 
- http://www.fcc.gov/pshs/docs/clearinghouse/case-studies/Hurricane-Ike-Harris%20County-120109.pdf  
- situation, data will neither be sent back to the central controller, nor logged into the database records, as we see later in the hourly PTT data statistics. 11 The RRS presently covers nine counties and supports more than 33,000 users and 641 departments. Currently, the system covers 9,581 square miles supporting a population of 5,236,716. The system uses a Motorola 4.1 Mixed Mode (Digital/Analog) SmartZone System to support 24 trunked multicast sites using a total of 259 channels. The RRS's users talk to each another on shared talkgroups over a large coverage area. The current SmartZone 4.1 radio system does not operate on 700 MHz channels and is not a Project 25 (P25) compliant system. Multicast systems broadcast identical audio information 
 
- http://www.fcc.gov/pshs/docs/clearinghouse/plans/santalouisacaemergplan.pdf  
- the OA shall develop their emergency communications unit plan consistent with the City Santa Luisa ACS or RACES Plan of the Governor's Office of Emergency Services, or as adjunct to this plan. RACES only plan- COUNTY Rev 4 7/29/01 PAGE 6 COUNTY OF SANTA LUISA RADIO AMATEUR CIVIL EMERGENCY SERVICE PLAN 4.0 ORGANIZATION (Customize to local emergency management agency titles) 4.1 Operational Area emergency services organization applicable to the RACES is: COUNTY DISASTER COUNCIL COUNTY EXECUTIVE OFFICER DIRECTOR OF EMERGENCY SERVICES EMERGENCY SERVICES COORDINATOR JURISDICTION RACES COORDINATOR (title may vary) RACES OFFICER 4.2 The volunteer (unpaid) staff position responsible for the implementation and administration of this service is the RACES Officer appointed by the County of Santa Luisa. The RACES Officer 
 
- http://www.fcc.gov/pshs/docs/clearinghouse/plans/valleycommctr.pdf  
- disseminated, any record or records of system security passwords or devices of other persons without the expressed written permission of the Director or designee. 3.9 Anyone who has cause to believe that system security, security file and/or integrity has been violated, compromised, or jeopardized, shall report same without delay to their supervisor, technical staff, Assistant Director or Director. 4.0 RESPONSIBILITY: 4.1 Internal and external users must have no expectation of privacy when utilizing any messaging system, including the CAD and Mobile Data Systems capabilities such as MAIL or any of the TO, ROUTE, NOTE or NOTB CAD functions (also included is the function of EMER which is allowed under the supervisory security level for Center employees only). Electronic messages cannot be 
 
- http://www.fcc.gov/pshs/docs/emergency-information/Pandemic_Comms_Impact_Study_%28December%202007%29.pdf  
- the telecommuting strategy to succeed. iv Table of Contents 1 Introduction 1-1 1.1 Purpose 1-1 1.2 Background 1-1 1.2.1 Pandemic Influenza 1-1 1.2.2 Telecommuting 1-1 1.3 Problem Definition 1-2 1.4 Scope 1-2 1.5 Document Organization 1-3 2 Stakeholder Involvement 2-1 3 Methodology 3-1 3.1 Potential Congestion Points 3-1 3.2 Recommended Preparations 3-1 3.3 Modeling 3-1 4 Potential Congestion Points 4-1 4.1 Assumptions 4-1 4.1.1 Pandemic Influenza 4-1 4.1.2 Network User Behavior 4-1 4.1.3 Communications Infrastructure 4-1 4.2 Enterprise Networks 4-3 4.2.1 Pandemic Preparedness 4-3 4.2.2 Potential Congestion Points 4-3 4.3 Residential Internet Access Networks 4-4 4.3.1 Pandemic Preparedness 4-4 4.3.2 Potential Congestion Points 4-5 5 Recommended Preparations 5-1 5.1 Short Term 5-1 5.2 Long Term 5-3 6 Outstanding Issues 6-1 6.1 
 
- http://www.fcc.gov/pshs/docs/emergency-information/Pandemic_Comms_Impact_Study_(December%202007).pdf  
- the telecommuting strategy to succeed. iv Table of Contents 1 Introduction 1-1 1.1 Purpose 1-1 1.2 Background 1-1 1.2.1 Pandemic Influenza 1-1 1.2.2 Telecommuting 1-1 1.3 Problem Definition 1-2 1.4 Scope 1-2 1.5 Document Organization 1-3 2 Stakeholder Involvement 2-1 3 Methodology 3-1 3.1 Potential Congestion Points 3-1 3.2 Recommended Preparations 3-1 3.3 Modeling 3-1 4 Potential Congestion Points 4-1 4.1 Assumptions 4-1 4.1.1 Pandemic Influenza 4-1 4.1.2 Network User Behavior 4-1 4.1.3 Communications Infrastructure 4-1 4.2 Enterprise Networks 4-3 4.2.1 Pandemic Preparedness 4-3 4.2.2 Potential Congestion Points 4-3 4.3 Residential Internet Access Networks 4-4 4.3.1 Pandemic Preparedness 4-4 4.3.2 Potential Congestion Points 4-5 5 Recommended Preparations 5-1 5.1 Short Term 5-1 5.2 Long Term 5-3 6 Outstanding Issues 6-1 6.1 
 
- http://www.fcc.gov/transaction/aol-tw/tseng_comment051100.pdf  
- A TRADITIONAL OPPONENT TO OPEN ACCESS.......................................................9 SECTION 2.5. CURRENT STATUS OF THE POLICY DEBATE..............................................................................................10 SECTION 2.6. RECENT ACTIVITY..................................................................................................................................12 SECTION 3. OPEN ACCESS CABLE NETWORK ARCHITECTURES.................................................................13 SECTION 3.1. HYBRID FIBER-COAX CABLE NETWORK..................................................................................................13 SECTION 3.2. OPEN ACCESS TECHNOLOGY OPTIONS....................................................................................................14 SECTION 3.3. POINT TO POINT PROTOCOL OVER ETHERNET (PPPOE)............................................................................16 SECTION 3.4. LAYER 2 TUNNELING PROTOCOL (L2TP)................................................................................................17 SECTION 4. INCREMENTAL CAPITAL COST MODEL.......................................................................................19 SECTION 4.1. BACKGROUND........................................................................................................................................19 SECTION 4.2. METHODOLOGY.....................................................................................................................................19 SECTION 4.3. GENERAL PARAMETERS AND ASSUMPTIONS FOR 3 SCENARIOS (U.S., BOSTON, PORTLAND)......................20 SECTION 4.4. EQUIPMENT DESCRIPTION AND PRICES....................................................................................................21 SECTION 4.5. BANDWIDTH OVERHEAD........................................................................................................................22 SECTION 4.6. PROJECTED PENETRATION RATES AND ONE-TIME AND ONGOING CAPITAL COSTS...................................23 SECTION 4.7. INCREMENTAL CAPITAL COST SUMMARY................................................................................................24 SECTION 4.7.1. SCENARIO #1 (U.S.)............................................................................................................................24 SECTION 4.7.2. SCENARIO #2 (BOSTON).......................................................................................................................25 SECTION 4.7.3. SCENARIO #3 (PORTLAND)...................................................................................................................26 SECTION 4.8. 
 
- http://www.fcc.gov/transaction/att-comcast/bellsouth_exhibit1.pdf  
- 1 2 2.1 2.2 2.3 2.4 Defining Broadband Access Broadband and Digital Convergence Broadband and Wireless Networks Next Generation Broadband Implications of Broadband Definition B & J 3 3 3.1 3.2 3.3 3.4 3.5 Primary Policy Goals & Objectives Promoting Intermodal Competition Technology Neutrality Policies Facilities-Based Competition Widespread Deployment of Broadband Access Eliminating Regulatory Obstacles A & D 10 4 4.1 4.2 4.3 4.4 4.5 Disincentives for Investment in Broadband Access Need for Investment in Broadband Access Disincentive Effects of Regulated Rates for Interconnection, Resale and UNEís Disincentive Effects of TELRIC Prices Disincentive Effects of Investment Returns Disincentive Effects of Retail Price Regulations C, E & G E.1. E.4 E.2 & 3 15 5 Regulatory Policies for Broadband Access & Services 
 
- http://www.fcc.gov/transaction/att-comcast/oppwp35.pdf  
- Policy, other Commission Staff, or any Commissioner. Given the preliminary character of some titles, it is advisable to check with the authors before quoting or referencing these working papers in other publications. i Table of Contents EXECUTIVE SUMMARY......................................................................................1 1. INTRODUCTION............................................................................................7 2. METHODOLOGY - EXPERIMENTAL ECONOMICS.....................................9 3. EXPERIMENTAL DESIGN...........................................................................14 3.1 Treatment Variables..............................................................................................................14 3.2 Experiment Institution..........................................................................................................17 3.3 Performance Measures..........................................................................................................22 4.0 EXPERIMENT RESULTS..........................................................................26 4.1 Economic Efficiency..............................................................................................................27 4.2 Buyerís Bargaining Power....................................................................................................28 4.3 Buyer Surplus........................................................................................................................34 4.4 Seller Profits and Losses........................................................................................................36 4.5 Regression Analysis ń CAP MFN Treatment Data...............................................................40 5.0 CONCLUDING COMMENTS.....................................................................50 APPENDIX A: ECONOMIC THEORY................................................................54 A.1 Traditional Oligopsony/Oligopoly Theory............................................................................54 A.2 Some Solutions Based on Cooperative Game Theory...........................................................55 A.2.1 The ěNash Bargainingî Solution......................................................................................57 A.2.2 The ěShapley Valueî Solution..........................................................................................57 A.2.3 The ěCoreî Solution........................................................................................................58 A.3 Illustration of the Cooperative 
 
- http://www.fcc.gov/transaction/att-comcast/qwest_exparte062102.pdf  
- multichannel video programming to the emerging broadband Internet market. This merger substantially increases the risk that cable MSOs will further entrench themselves as the dominant providers of broadband Internet access (they currently control an estimated two-thirds of all high-speed connections to the Internet) and interpose themselves as "gatekeepers" between consumers and content providers to protect and extend their monopoly power. 4.1. AT&T/COMCAST'S "DEFENSE" Since the broadband Internet is a relatively new market, there is, by definition, little empirical evidence to which one can point. There is an industry track record,32 which has been to 1) enter into exclusive arrangements with "pet" ISPs and exclude others until compelled by the government to open their networks to at least some independent ISPs; 2) 
 
- http://www.fcc.gov/transaction/comsat-telenor/fcc01-369.pdf  
- who may handle Classified, Controlled Unclassified or Sensitive Information to maintain the confidentiality and security of such information in accordance with applicable U.S. legal authority and the terms of this Agreement; and f. Maintain appropriately secure facilities (e.g., offices or areas) for the handling and storage of any Classified, Controlled Unclassified and Sensitive Information. ARTICLE 4: AUDITING, REPORTING, and NOTICE 4.1 Access to Information: In response to reasonable requests made by the FBI or the DOJ, Telenor shall provide in the United States access to information concerning technical, physical, management, or other security measures and other reasonably available FEDERAL COMMUNICATIONS COMMISSION FCC 01-369 37 information needed by the FBI or the DOJ to assess compliance with this Agreement. 4.2 Visits and 
 
- http://www.fcc.gov/transaction/echostar-directv/genmot_atta022502.pdf  
- future trends. Analysis of churn from DIRECTV in the top 15 DMAs80 indicates that this switching rate to EchoStar is somewhat lower than the switching rate for the country as a whole. Indeed, the DIRECTV churn data suggest that for every one customer who left DIRECTV for EchoStar because of cost or price reasons in 2001 in these 15 DMAs, 4.1 customers churned from DIRECTV to cable and 1.6 customers churned from DIRECTV to an antenna. Among those subscribers in these 15 DMAs who disconnected when DIRECTV raised its prices, an even lower share went to EchoStar. (It should be noted that the sample size is so small that this result must be viewed as imprecise.) These data suggest a somewhat 
 
- http://www.fcc.gov/transaction/nbc-telemundo/exhibit6.pdf  
- set forth in the disclosure schedule delivered by S Sub to the Buyer and the Acquisition Subsidiary on or before the date of this Agreement (the "S Sub Disclosure Schedule"), which exceptions shall make specific reference to the Section of this Agreement to which they relate, S Sub represents and warrants to the Buyer and the Acquisition Subsidiary as follows: 4.1 Organization, Standing and Power, Subsidiaries. (a) S Sub is a corporation duly organized, validly existing and in good standing under the laws of the jurisdiction of its incorporation, has all requisite corporate power and authority to own, lease and operate its properties and assets and to carry on its business and is duly qualified to do business and is in 
 
- http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304C98.PDF  
- Version STUDY AREA: XXXXXXXXXXXX SUBMISSION XXX PERIOD: From mmm yyyy To mmm yyyy TABLE I COSA: XXXX PAGE 16 of 91 TABLE I - SEPARATIONS AND ACCESS TABLE Common Line Category Subject to Separations State Interstate Pay Inside WireBFP Total Common Line ROW (a) (b) (c) (d) (e) (f) (g) (i) 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304F98.PDF  
- Version STUDY AREA: XXXXXXXXXXXX SUBMISSION XXX PERIOD: From mmm yyyy To mmm yyyy TABLE I COSA: XXXX PAGE 16 of 91 TABLE I - SEPARATIONS AND ACCESS TABLE Common Line Category Subject to Separations State Interstate Pay Inside WireBFP Total Common Line ROW (a) (b) (c) (d) (e) (f) (g) (i) 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304P98.PDF  
- OtherTrafficServicePositionsassociatedwithcommonbasiccontrolunitsthatare allocatedpursuanttoSection36.123(b)(1)(iv)anddirectlyassignpursuanttoSection 69.306(b). 1167 WeightedstandardworksecondsusedtoallocateotherTrafficServicePosition SystemspursuanttoSection36.123(b)(1)(iv). 1168 TotalTrafficServicePositions,totalofRows1160,1162,1164,and1166,including amountsthataredirectlyassignedpursuanttoSection69.306(b). 1170 TotalCategory1COE,totalofRows1112,1129,1154,and1168. 2.Category2COE,TandemSwitchingEquipment 1200 TandemSwitchingEquipmentthatisassociatedwithprivatelinesandisdirectly assignedpursuanttoSection36.124(b). 1201 TandemSwitchingEquipmentthatisassociatedwithmessageuseandisdirectly assignedpursuanttoSection36.124(b). 1202 TandemSwitchingEquipmentthatisjointlyusedandisallocatedpursuanttoSection 36.124(b). FCCReport43-04-Rep.Def.RowInstructions December1998 Page106of158 1203 Tandemminutes-of-useusedtoallocatejointlyusedTandemSwitchingEquipment pursuanttoSection36.124(b). 1204 TotalCategory2COE,totalofRows1200,1201,and1202includingCategory2 COEthatisdirectlyassignedpursuanttoSection69.306(c). 3.Category3COE,LocalSwitchingEquipment 1210 LocalSwitchingEquipmentthatisassociatedwithprivatelinesandisdirectly assignedpursuanttoSection36.1(c). 1211 LocalSwitchingEquipmentthatisassociatedwithmessageuseandisdirectly assignedpursuanttoSection36.1(c). 1212 LocalSwitchingEquipmentamountthatisallocatedpursuanttoSection36.125and directlyassignedpursuanttoSection69.306(d). 1213 Interstateallocationfactor(inpercent)usedtoallocateCategory3COEpursuantto Section36.125(b) 1214 Compositeallocationfactor(inpercent)usedtocomputetheinterstateallocation factorusedtoallocateCategory3COEpursuanttoSection36.125(c). 1215 "AComponent"(inpercent)usedtocalculatetheinterstateallocationfactorusedto allocateCategory3COEpursuanttoSection36.125(d). 1216 DialEquipmentMinutes(minutesofholdingtimeoforiginatingandterminating localswitchingequipment,asdefinedintheGlossaryofPart36)usedtocalculatethe interstateallocationfactorpursuanttoSections36.125(b)and(c). 1217 "BComponent"(inpercent)usedtocalculatetheinterstateallocationfactorusedto allocateCategory3COEpursuanttoSection36.125(c)and(d). 1219 TotalCategory3COE,totalofRows1210,1211,and1212includingCategory3 COEthatisdirectlyassignedpursuanttoSection69.306(d). 4.Category4COE,CircuitEquipment a)Category4.1,ExchangeCircuitEquipment (1) Category4.11,WidebandExchangeLineCircuitEquipment 1220 Category4.11COEthatisassociatedwithprivatelinecircuitsandisdirectlyassigned pursuanttoSections36.126(c)(1)and36.155. FCCReport43-04-Rep.Def.RowInstructions December1998 Page107of158 1221 Category4.11COEthatisassociatedwithmessagecircuitsandisdirectlyassigned pursuanttoSections36.126(c)(1)and36.155. 1222 Category4.11COEthatisjointlyusedandisallocatedpursuanttoSections 36.126(c)(1)and36.155. 1223 Minutes-of-useusedtoallocatejointlyCategory4.11COEpursuanttoSections 36.126(c)(1)and36.155. 1224 TotalCategory4.11COE,totalofRows1220,1221,and1222includingCategory 4.11COEthatisdirectlyassignedpursuanttoSection69.305andAmendmentofPart 69oftheCommission'sRulesandRegulations,AccessCharges,toConformItwith Part36,JurisdictionalSeparationsProcedures,CCDocketNo.87-113,FCC88-400 releasedDecember12,1988,4FCCRcd765,772(1988)(Part69Reconsideration Order),atpara.48. (2) Category4.12COE,ExchangeTrunkCircuitEquipment(Wideband andNon-Wideband) NOTE:Category4.12COEisdividedintobasicandspecialifamountsofexchange andinterexchangespecialcircuitequipmentaresignificantpursuanttoSection 36.126(b)(4).IfthereportingcarrierdoesnotsegregateCategory4.12COEintobasic andspecial,itmustreportallsuchCOEasbasic. (a)BasicNon-WidebandCategory4.12COE 1230 Basicnon-widebandCategory4.12COEthatisassociatedwithprivatelinecircuits andisdirectlyassignedpursuanttoSections36.126(c)(2)and36.155. 1231 Basicnon-widebandCategory4.12COEthatisassociatedwithmessagecircuitsand isdirectlyassignedpursuanttoSections36.126(c)(2)and36.155. 1232 Basicnon-widebandCategory4.12COEthatisjointlyusedandisallocatedpursuant toSections36.126(c)(2)and36.155. 1233 Minutes-of-useusedtoallocatejointlyusedCategory4.12COEpursuanttoSections 36.126(c)(2)and36.155. 1234 Totalbasicnon-widebandCategory4.12COE,totalofRows1230,1231,and1232. (b) SpecialNon-WidebandCategory4.12COE 1240 Specialnon-widebandCategory4.12COEthatisassociatedwithprivatelinecircuits andisdirectlyassignedpursuanttoSections36.126(c)(2)and36.155.Seealso Glossary,Part36. FCCReport43-04-Rep.Def.RowInstructions December1998 Page108of158 1241 Specialnon-widebandCategory4.12COEthatisassociatedwithTWXcircuitsand isallocatedpursuanttoSections36.126(c)(2)and36.155. 1242 TWXminutes-of-useusedtoallocatespecialnon-widebandCategory4.12COEthat 
 
- http://www.fcc.gov/wcb/armis/documents/1998PDFs/4304PF98.PDF  
- Version STUDY AREA: XXXXXXXXXXXX SUBMISSION XXX PERIOD: From mmm yyyy To mmm yyyy TABLE I COSA: XXXX PAGE 16 of 91 TABLE I - SEPARATIONS AND ACCESS TABLE Common Line Category Subject to Separations State Interstate Pay Inside WireBFP Total Common Line ROW (a) (b) (c) (d) (e) (f) (g) (i) 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/1999PDFs/4304C99.PDF  
- STUDY AREA: XXXXXXXXXXXX SUBMISSION XXX PERIOD: From mmm yyyyy To mmm yyyyy TABLE I COSA: XXXX PAGE 16 of 91 TABLE I - SEPARATIONS AND ACCESS TABLE Common Line Total Category Subject to Separations State Interstate Pay Inside Wire BFP Common Line ROW (a) (b) (c) (d) (e) (f) (g) (i) 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/1999PDFs/4304P99.PDF  
- STUDY AREA: XXXXXXXXXXXX SUBMISSION XXX PERIOD: From mmm yyyyy To mmm yyyyy TABLE I COSA: XXXX PAGE 16 of 91 TABLE I - SEPARATIONS AND ACCESS TABLE Common Line Total Category Subject to Separations State Interstate Pay Inside Wire BFP Common Line ROW (a) (b) (c) (d) (e) (f) (g) (i) 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2000PDFs/4304C00.PDF  
- ALLOC. N/A N/A N/A N/A 1204K$ TOTAL COE CAT. 2 INV. N/A N/A N/A N/A 3. Category 3 COE  Local Switching Equipment 1212K$ CAT. 3 SWITCH. INV. ASSG. JOINT N/A N/A 1213% IS. ALLOC. FACTOR FOR CAT. 3 N/A N/A N/A N/A 1216# DIAL EQPT. MINUTES N/A N/A N/A N/A 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2000PDFs/4304P00.PDF  
- ALLOC. N/A N/A N/A N/A 1204K$ TOTAL COE CAT. 2 INV. N/A N/A N/A N/A 3. Category 3 COE  Local Switching Equipment 1212K$ CAT. 3 SWITCH. INV. ASSG. JOINT N/A N/A 1213% IS. ALLOC. FACTOR FOR CAT. 3 N/A N/A N/A N/A 1216# DIAL EQPT. MINUTES N/A N/A N/A N/A 4. Category 4 COE - Circuit Equipment a) Category 4.1 COE - Exchange Circuit Equipment (1) Category 4.11 COE - Wideband Exchange Line Circuit Equipment 1220K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. PL N/A N/A N/A N/A 1221K$ COE CAT. 4.11 WDBD. EXC. LINE CKT. EQPT. ASSG. MSG. N/A N/A N/A N/A 1222K$ COE CAT. 4.11 WDBD. EXC. LINE EQPT. ASSG. JT. USE N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2001PDFs/4304C01.PDF  
- 1276% Loop Allocation Factor N/A N/A N/A N/A N/A N/A N/A 1277Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A N/A 1323# Conversation 
 
- http://www.fcc.gov/wcb/armis/documents/2002PDFs/4304c02.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2002PDFs/4304p02.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2003PDFs/4304c03.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2003PDFs/4304p03.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2004PDFs/4304c04.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2004PDFs/4304p04.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2005PDFs/4304c05.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2005PDFs/4304p05.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2006PDFs/4304c06.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2006PDFs/4304p06.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2007PDFs/4304c07.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/2007PDFs/4304p07.pdf  
- N/A N/A N/A N/A N/A N/A N/A 1277 Total COE Cat. 4.13 Basic Exch. Ckt. Eqpt. N/A N/A N/A N/A N/A N/A N/A 1280 Tot. COE Cat. 4.13 Spl. Exch. Ckt. Eqpt. Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1290 Total COE Cat. 4.13 Exch. Ckt. Eqpt. Inv. N/A N/A N/A N/A N/A 1300 Total COE Cat. 4.1  Exch. Line Ckt. Eqpt. N/A 1310 Total COE Cat. 4.21 IX Ckt. Eqpt. Furnished to Others N/A N/A N/A N/A N/A N/A N/A 1320 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Dir. Assg. PL N/A N/A N/A N/A N/A N/A N/A 1322 COE Cat. 4.22 WDBD IX Ckt. Eqpt.  Joint Use N/A N/A N/A N/A N/A N/A 
 
- http://www.fcc.gov/wcb/armis/documents/order_da_91_143.pdf  
- I I I I 1129 'Tot SOB 36/69 I I N/A I I November 1990 FCC Report 43-04 -Report Definition -Form FCC REPORT 43-04 ARMIS ACCESS REPORT Rev. COMPANY : STUDY AREA: PERIOD: COSA: xxxxxxxxxxxxxxxxxxxxxxxxxxxxxx xxxxxxxxxxxxxxxxxxxx From mmm yyyy To mmm yyyy xxxx Page 10 of 90 Approved by OMB 3060-0395 Expires 10/31/92 xxxxxxxxxxxx VERSION SUBMISSION X TABLE I PAGE 4.1 OF 30.3 TABLE I -SEPARATIONS AND ACCESS TABLE (Dollars in Thousands) I I Subject tol I I Common Line I I Category ISeparations' State I Interstatel Pay IInside Wirel BFP I Row I (a) I Ib) I (c) I (d) I (e) I (f) I (q) I c) Auxiliary Service Boards 1130 ISeparate DA 36/69 I -I I 1 N/A 
 
- http://www.fcc.gov/wcb/cpd/Nanc/nanccorr.html  
- for Resolution of the Telecordia Dispute [[42]Acrobat] Attachment 3: NANC Telecordia Dispute - NCTA, Comcast, Cox. [[43]Acrobat] 06/20/11 LETTER: NANC Local Number Portability Administration Working Group Report on Best Practices on Porting "Projects". [[44]Acrobat] Attachments: Attachment 1: LPNA WG Best Practice on Porting "Projects" [[45]Word][[46]Acrobat] Attachment 2: Approved LPNA WG Best Practice 67 [[47]Word][[48]Acrobat] Attachment 3: NANC OPS Flows Narratives v4.1 [[49]Word][[50]Acrobat] Attachment 3.a: NANC Flows v.4.0 (10-16-2009) [[51]Acrobat] Attachment 3.a.1: Final Business Week Chart (10/16/2009) [[52]Word][[53]Acrobat] Attachment 4: Chart 1 Simple Port LSR and FOC Interval Chart [[54]Word][[55]Acrobat] Attachment 5: Chart 2 One Bus Day LRS-FOC DD Time Shart [[56]Word][[57]Acrobat] 06/20/11 LETTER: NANC Future of Numbering Working Group White Paper on Toll Free Resources. [[58]Acrobat] Attachment: NANC FoN WG Toll 
 
- http://www.fcc.gov/wcb/cpd/Nanc/toreport.doc  
- Marcel Champagne NYNEX Kevin Cooke OPASTCO John McHugh Pacific Bell Sandra E. Cheung Pac Bell Mobil Svc Linda Melvin Perot Systems Tim McCleary Pocket Com/CTA Nina Blake SBC Marilyn Murdock (Co-Chair) Sprint Dave Garner Telecom Software Enterprises Lisa Marie Maxson Teleport Phil Presworskey Time Warner/NCTA Karen Kay US West Cynthia Gagnon WinStar Steve Merrill WorldCom Bettie Shelby 4. WORKING ASSUMPTIONS 4.1 The LNPA T&O Task Force adopted the following working assumptions which govern the operation of the Task Force: A. Membership on the Task Force adequately represents the industry. B. Only issues that fall within the scope of the LNPA T&O Task Force Mission Statement are considered by the Task Force. C. Task force members elect co-chairs from the Incumbent Local 
 
- http://www.fcc.gov/wcb/cpd/Nanc/wknggrp.doc  
- comply with the FCC deployment schedule. The Cellular Telecommunications Industry Association (CTIA) and other standards and industry forums are currently addressing number portability technical solutions. Therefore, it is necessary to develop and update the FRS and IIS documents with wireless requirements and to develop a schedule to include these changes in a subsequent NPAC SMS release. 4. LNPA VENDOR SELECTION 4.1 Criteria Governing the LNPA Selection Process 4.1.1 The Telecommunications Act of 1996 and the FCC's July 2, 1996 LNP Order established mandatory criteria (Criteria, individually Criterion) for the selection of the LNPA and all related activities. Central among these Criteria are competitive neutrality, which is a requirement for the third party LNPA itself (LNP Order, ¶93), the LNPA's administrative activities 
 
- http://www.fcc.gov/wcb/ppd/depreciation/documents/fcc00306.pdf  
- Life Rate Category Description Life Salvage Depreciation Rate ----------------------------------- -------------- ----------- ------------------- ---------------- (years) (%) (%) (%) A B C D=(100%-B-C)/A 2112 MOTOR VEHICLES 3.0 10 68.2 7.3 2115 GARAGE WORK EQ 7.1 0 21.4 11.1 2116 OTHER WORK EQ 6.0 0 46.2 9.0 2121 BUILDINGS 29.0 0 26.3 2.5 2122 FURNITURE 5.0 0 43.2 11.4 2123.1 OFFICE SUPPORT EQ 4.1 0 9.8 22.0 2123.2 COMPANY COMMUN EQ 3.6 0 100.0 - 2124 GEN PURPOSE COMPUTERS 2.4 0 94.7 2.2 2212 DIGITAL ELECTRONIC SW 6.6 0 42.9 8.7 2220 OPERATOR SYSTEMS 5.6 0 100.0 - 2231 RADIO SYSTEMS 3.8 0 77.8 5.8 2232 CIRCUIT EQ 5.8 0 48.2 8.9 2362 OTHER TERMINAL EQ 2.7 0 39.0 22.6 2411 POLES 13.1 -78